1 bioinformatics & computational biology thanks to mark gerstein (yale) & eric green (nih)...
Post on 20-Dec-2015
215 views
TRANSCRIPT
1
Bioinformatics & Computational Biology
Thanks to Mark Gerstein (Yale) & Eric Green (NIH)for many borrowed & modified PPTs
Drena DobbsIowa State University
2
What is Bioinformatics?(& What is Computational Biology?)
Wikipedia: •Bioinformatics & computational biology
involve the use of techniques from mathematics, informatics, statistics, and computer science (& engineering) to solve biological problems
Gerstein: • (Molecular) Bioinformatics is conceptualizing biology in
terms of molecules & applying “informatics” techniques - derived from disciplines such as mathematics, computer science, and statistics - to organize and understand information associated with these molecules, on a large scale
3
What is the Information?Biological Sequences, Structures,
ProcessesCentral Dogma
of Molecular Biology
• DNA sequence -> RNA -> Protein -> Phenotype
• Molecules Sequence, Structure, Function
• Processes Mechanism, Specificity, Regulation
Central Paradigm for Bioinformatics
• Genomic (DNA) Sequence -> mRNAs & other RNA sequences -> Protein sequences -> RNA & Protein Structures -> RNA & Protein Functions -> Phenotype
• Large Amounts of Information Standardized Statistical
idea from D Brutlag, Stanford, graphics from S Strobel)Modified from Mark Gerstein
4
Explosion of "Omes" & "Omics!"Genome, Transcriptome, Proteome
• Genome - the complete collection
of DNA (genes and "non-genes") of
an organism
• Transcriptome - the complete
collection of RNAs (mRNAs &
others) expressed in an organism
• Proteome - the complete
collection of of proteins expressed
in an organism
5
Genome = ConstantTranscriptome & Proteome = Variable
• Genome - the complete collection
of DNA (genes and "non-genes") of
an organism
• Transcriptome - the complete
collection of RNAs (mRNAs &
others) expressed in an organism*• Proteome - the complete
collection of proteins expressed in
an organism*
* Note: Although the
DNA is "identical" in all
cells of an organism, the
sets of RNAs or proteins
expressed in different
cells & tissues of a single
organism vary greatly --
and depend on variables
such as environmental
conditions, age.
developmental stage
disease state, etc.
6
Molecular Biology Information: DNA & RNA
Sequences Functions: • Genetic material• Information transfer (mRNA)• Protein synthesis (tRNA/mRNA)• Catalytic & regulatory activities (some very new!)
Information:• 4 letter alphabet
(DNA nucleotides: AGCT)• ~ 1,000 base pairs in a small gene • ~ 3 X 109 bp in a genome (human)
DNA sequence:
atggcaattaaaattggtatcaatggttttggtcgtatgcacaacaccgtgatgacattgaagttgtaggtattaaatggcttatatgttgaaatatgattcaactcacggtcgaaagatggtaacttagtggttaatggtaaaactatccgGcaaacttaaactggggtgcaatcggtgttgatatcgctttaactgatgaaactgctcgtaaacatatcactgcaggcgcaaaaaaagtt
RNA sequence has "U" instead of "T"
• Where are the genes?• Which DNA sequences encode mRNA?• Which DNA sequences are "junk"? • Which RNA sequences encode protein?
Modified from Mark Gerstein
7
Molecular Biology Information: Protein
Sequences
• Biocatalysis• Cofactor transport/storage• Mechanical motion/support• Immune protection• Regulation of growth and
differentiation
Information: • 20 letter alphabet (amino acids)
ACDEFGHIKLMNPQRSTVWY (but not BJOUXZ)
• ~ 300 aa in an average protein (in bacteria)
• ~ 3 X 106 known protein sequences
Protein sequences:
d1dhfa_ LNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTd8dfr__ LNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSd4dfra_ ISLIAALAVDRVIGMENAMPWN-LPADLAWFKRNTLd3dfr__ TAFLWAQDRDGLIGKDGHLPWH-LPDDLHYFRAQTV
Functions: Most cellular functions are performed or facilitated by proteins
• What is this protein?• Which amino acids are most important -- for folding, activity, interaction with other proteins? • Which sequence variations are harmful (or beneficial)?
Modified from Mark Gerstein
8
Molecular Biology Information:
Macromolecular Structures
DNA/RNA/Protein Structures
• How does a protein (or RNA) sequence fold into an active 3-dimensional structure?
• Can we predict structure from sequence?
• Can we predict function from structure (or perhaps, from sequence alone?)
Modified from Mark Gerstein
9
We don't yet understand the protein folding code - but we try to engineer
proteins anyway!
Modified from Mark Gerstein
10
Molecular Biology Information:
Biological ProcessesFunctional Genomics• How do patterns of gene
expression determine phenotype?
• Which genes and proteins are required for differentiation during during development?
• How do proteins interact in biological networks?
• Which genes and pathways have been most highly conserved during evolution?
11
On a Large Scale?
Whole GenomeSequencing
Genome sequences now accumulate so quickly that, in less than a week, a single laboratory can produce more bits of data than Shakespeare managed in a lifetime, although the latter make better reading.
-- G A Pekso, Nature 401: 115-116 (1999)
Modified from Mark Gerstein
12
QuickTime™ and aTIFF (LZW) decompressor
are needed to see this picture.
Automated Sequencing for Genome Projects
Another recent improvement: rapid & high resolution separation of fragments in capillaries instead of gels (E Yeung,Ames Lab, ISU)
QuickTime™ and aTIFF (LZW) decompressor
are needed to see this picture.
Modified from Eric Green
More recently? Pyro-sequencing 454 sequencing http://www.454.com/$ 1000 genomes?
13
1st Draft Human Genome - "Finished" in 2001
QuickTime™ and aTIFF (LZW) decompressor
are needed to see this picture.
Modified from Eric Green
14
Human Genome Sequencing
Two approaches:
• Public (government) - International Consortium
(6 countries, NIH-funded in US)• "Hierarchical" cloning & BAC-by-BAC sequencing• Map-based assembly
• Private (industry) - Celera (Craig Venter)• Whole genome random "shotgun" sequencing • Computational assembly (took advantage of public maps & sequences,too)How many genes? ~ 20,000 (Science May 2007)
Craig'sGuess which human genome they sequenced?
15
Public Sequencing - International Consortium
QuickTime™ and aTIFF (LZW) decompressor
are needed to see this picture.
Modified from Eric Green
16
QuickTime™ and aTIFF (LZW) decompressor
are needed to see this picture.
Comparison of Sequenced Genome Sizes
Plants? Some have much larger genomes than human!
Modified from Eric Green
17
"Complete" Human Genome Sequence - What next?
QuickTime™ and aTIFF (LZW) decompressor
are needed to see this picture.
from Eric Green
18
Next Step after the Sequence?
• Expression Analysis• Structural Genomics• Protein Interactions• Pathway Analysis• Systems Biology
Understanding Gene Function on a Genomic
Scale
Evolutionary Implications of: • Introns & Exons• Intergenic Regions as "Gene Graveyard"
Modified from Mark Gerstein
19
Interpreting the Human Genome Sequence!
QuickTime™ and aTIFF (LZW) decompressor
are needed to see this picture.
from Eric Green
20
Comparative Genomics: compare entire genomic sequences
QuickTime™ and aTIFF (LZW) decompressor
are needed to see this picture.
from Eric Green
21
Comparing Genomes: Functional Elements
QuickTime™ and aTIFF (LZW) decompressor
are needed to see this picture.
from Eric Green
22
Gene Expression Data: the Transcriptome (& Proteome)
MicroArray Data
Yeast Expression Data:
• Levels for all 6,000 genes!
• Experiments to investigate how genes respond to changes in environment or how patterns of expression change in normal vs cancerous tissue
(courtesy of J Hager)Modified from Mark Gerstein
ISU's Biotechnology Facilities include state-of-the-art Microarray & Proteomics instrumentation
23
Other Whole-Genome
Experiments
Systematic Knockouts:
Make "knockout" (null) mutations in every gene - one at a time - and analyze the resulting phenotypes!
For yeast:
6,000 KO mutants!
2-hybrid Experiments:
For each (and every) protein, identify every other protein with which it interacts!
For yeast: 6000 x 6000 / 2 ~ 18M interactions!!
Modified from Mark Gerstein
24
Molecular Biology Information:Integrating Data
•Understanding the function of genomes requires integration of many diverse and complex types of information: Metabolic pathways Regulatory networks Whole organism physiology Evolution, phylogeny Environment, ecology Literature (MEDLINE)
Modified from Mark Gerstein
25
Storing & Analyzing Large-scale Information:
Exponential Growth of Data Matched by Development of Computer Technology
CPU vs Disk & Net• Both the increase in
computer speed and the ability to store large amounts of information on computers have been crucial
• Improved computing resources have been a driving force in Bioinformatics
Modified from Mark Gerstein (Internet picture adaptedfrom D Brutlag, Stanford)
ISU's supercomputer "CyBlue" is among 100 most powerful in the world
26Weber Cartoon
from Mark Gerstein
27
Challenges in Organizing & Understanding High-throughput Data:
Redundancy and Multiplicity• Different sequences can have the
same structure• Organism has many similar genes• Single gene may have multiple
functions• Genes and proteins function in
genetic and regulatory pathways• How do we organize all this
information so that we can make sense of it?
Integrative Genomics: genes >< structures <> functions <> pathways <> expression <>regulatory systems <> ….
Modified from Mark Gerstein
28
"Simple" example? ProteinsMolecular Parts = Conserved
Domains
Modified from Mark Gerstein
29
"Parts List" approach to bike maintenance:
What are the shared parts (bolt, nut, washer, spring, bearing), unique parts (cogs, levers)? What are the common parts -- types of parts (nuts & washers)?
How many roles can these play? How flexible and adaptable are they mechanically?
Where are the parts
located? Modified from Mark Gerstein
30
~2,000 folds
~20,000 genes
~2,000 genes1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 …
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 …
(human)
World of protein structures is also finite,
providing a valuable simplification!
Global Surveys of a Finite Set of Parts from Many Perspectives
Same logic for pathways, functions, sequence families, blocks, motifs....
Functions picture from www.fruitfly.org/~suzi (Ashburner); Pathways picture from, ecocyc.pangeasystems.com/ecocyc (Karp, Riley). Related resources: COGS, ProDom, Pfam, Blocks, Domo, WIT, CATH, Scop....
(T. pallidum)
Modified from Mark Gerstein
31
BUT, what actually happens in cells & in whole organisms is much more
complex! providing a challenging complication!!
Exploring the Virtual Cell at ISU
Virtual Cell projects elsewhere...
NCBI's Bookshelf - a great resource!
32
So, having a list of parts is not enough!
BIG QUESTION?
SYSTEMS BIOLOGY
How do parts work together to form a functional system?
What is a system? Macromolecular complex, pathway, network, cell, tissue, organism, ecosystem…
33
Is this Bioinformatics? (#1,with Answers)
• Creating digital libraries Automated bibliographic search and textual comparison Knowledge bases for biological literature
• Motif discovery using Gibb's sampling • Methods for structure determination
Computational X-ray crystallography NMR structure determination
• Distance Geometry
• Metabolic pathway simulation
YES
YES
YES
YES
Modified from Mark Gerstein
34
Is this Bioinformatics? #2
• Gene identification by sequence inspection Prediction of splice sites, promoters, etc.
• DNA methods in forensics • Modeling populations of organisms
Ecological Modeling
• Genomic sequencing methods Assembling contigs Physical and genetic mapping
• Linkage analysis Linking specific genes to various traits
YES
YES
YES
YES
YES
Modified from Mark Gerstein
35
Is this Bioinformatics? #3
• Rational drug design• RNA structure prediction• Protein structure prediction
• Radiological image processing Computational representations for human anatomy
• (e.g., Visible Human)
• Artificial life simulations Artificial immunology Virtual cells
YES
Maybe
Modified from Mark Gerstein
Yes
36
So, this is Bioinformatics
What is it good for?
37
EXAMPLES OF BIOINFORMATICS RESEARCH
A few general ones&
a few personal favorites!
38
Designing New Drugs
•Understanding how proteins bind other molecules•Structural modeling & ligand docking•Designing inhibitors or modulators of key proteins
Figures adapted from Olsen Group Docking Page at Scripps, Dyson NMR Group Web page at Scripps, and from Computational Chemistry Page at Cornell Theory Center).Modified from Mark Gerstein
39
Finding homologs of "new" human genes
Modified from Mark Gerstein
40
Finding WHAT? Homologs - "same genes" in different
organisms(actually, orthologs)• Human vs. Mouse vs. Yeast
Much easier to do experiments on yeast to determine function Often, function of an ortholog in at least one organism is known
Best Sequence Similarity Matches to Date Between Positionally ClonedHuman Genes and S. cerevisiae Proteins
Human Disease MIM # Human GenBank BLASTX Yeast GenBank Yeast Gene Gene Acc# for P-value Gene Acc# for Description Human cDNA Yeast cDNA
Hereditary Non-polyposis Colon Cancer 120436 MSH2 U03911 9.2e-261 MSH2 M84170 DNA repair proteinHereditary Non-polyposis Colon Cancer 120436 MLH1 U07418 6.3e-196 MLH1 U07187 DNA repair proteinCystic Fibrosis 219700 CFTR M28668 1.3e-167 YCF1 L35237 Metal resistance proteinWilson Disease 277900 WND U11700 5.9e-161 CCC2 L36317 Probable copper transporterGlycerol Kinase Deficiency 307030 GK L13943 1.8e-129 GUT1 X69049 Glycerol kinaseBloom Syndrome 210900 BLM U39817 2.6e-119 SGS1 U22341 HelicaseAdrenoleukodystrophy, X-linked 300100 ALD Z21876 3.4e-107 PXA1 U17065 Peroxisomal ABC transporterAtaxia Telangiectasia 208900 ATM U26455 2.8e-90 TEL1 U31331 PI3 kinaseAmyotrophic Lateral Sclerosis 105400 SOD1 K00065 2.0e-58 SOD1 J03279 Superoxide dismutaseMyotonic Dystrophy 160900 DM L19268 5.4e-53 YPK1 M21307 Serine/threonine protein kinaseLowe Syndrome 309000 OCRL M88162 1.2e-47 YIL002C Z47047 Putative IPP-5-phosphataseNeurofibromatosis, Type 1 162200 NF1 M89914 2.0e-46 IRA2 M33779 Inhibitory regulator protein
Choroideremia 303100 CHM X78121 2.1e-42 GDI1 S69371 GDP dissociation inhibitorDiastrophic Dysplasia 222600 DTD U14528 7.2e-38 SUL1 X82013 Sulfate permeaseLissencephaly 247200 LIS1 L13385 1.7e-34 MET30 L26505 Methionine metabolismThomsen Disease 160800 CLC1 Z25884 7.9e-31 GEF1 Z23117 Voltage-gated chloride channelWilms Tumor 194070 WT1 X51630 1.1e-20 FZF1 X67787 Sulphite resistance proteinAchondroplasia 100800 FGFR3 M58051 2.0e-18 IPL1 U07163 Serine/threoinine protein kinaseMenkes Syndrome 309400 MNK X69208 2.1e-17 CCC2 L36317 Probable copper transporter
Modified from Mark Gerstein
41
Comparative Genomics Genome/Transcriptome/Proteome/Metab
olome
Databases, statistics•Occurrence of a
specific genes or features in a genome How many kinases in yeast?
•Compare Tissues Which proteins are
expressed in cancer vs normal tissues?• Diagnostic tools• Drug target discovery
Modified from Mark Gerstein
42
Molecular Recognition:Analyzing & Predicting Macromolecular
Interfaces (in DNA, RNA & protein complexes)
Drena Dobbs, GDCBJae-Hyung LeeMichael TerribiliniJeff SanderPete Zaback
Vasant Honavar, Com SFeihong WuCornelia Caragea
Robert Jernigan, BBMBTaner SenAndrzej Kloczkowski
Kai-Ming Ho, Physics
Designing Zinc Finger DNA-binding proteins to recognize specific sites in genomic DNA
Drena Dobbs, GDCBJeff SanderPete Zaback
Dan Voytas, GDCBFenglli Fu
Les Miller, ComSVasant Honavar, ComS
Keith Joung, Harvard
44
Structure & function of human telomerase: Predicting structure & functional sites in a clinically important but "recalcitrant" RNP
www.intl-pag.org/
Cell Biologist:
Biochemist:
Imagined structure:
Lingner et al (1997) Science 276: 561-567.www.chemicon.com
How would a systems biologist study telomerase?
45
Resources for Bioinformatics & Computational Biology
• Wikipedia: Bioinformatics
• NCBI - National Center for Biotechnology Information
• ISCB - International Society for Computational Biology
• JCB - Jena Center for Bioinformatics• UBC - Bioinformatics Links Directory
46
ISU Resources & Experts
ISU Research Centers & Graduate Training Programs:BCB - Bioinformatics & Computational Biology
Baker Center - Bioinformatics & Biological Statistics
CIAG - Center for Integrated Animal GenomicsCILD - Computational Intelligence, Learning &
Discovery
ISU Facilities:Biotech - Instrumentation FacilitiesCIAG - Center for Integrated Animal GenomicsPSI - Plant Sciences Institute
PSI Centers
47
http://www.dnai.org/c/index.html
For fun: DNA Interactive: "Genomes"
A tutorial on genomic sequencing, gene structure,
genes prediction
Howard Hughes Medical Institute (HHMI)Cold Spring Harbor Laboratory (CSHL)