florida state seminoles (5-1, 0-1 acc) vs no. 16/17 ... · florida state won a program record 29...

Post on 01-Aug-2020

0 Views

Category:

Documents

0 Downloads

Preview:

Click to see full reader

TRANSCRIPT

FLORIDA STATE SEMINOLES (5-1, 0-1 ACC)

VS NO. 16/17 TENNESSEE VOLUNTEERS (5-0, 0-0 SEC)

THIRD ROUND / EMERALD COAST CLASSIC THE ARENA AT NORTHWEST FLORIDA STATE COLLEGE

NICEVILLE, FLORIDA FRIDAY, NOVEMBER 29, 2019; 7:00 P.M. (ET)

SEMINOLE IMG RADIO NETWORK (TOM BLOCK, KEITH JONES) CBS SPORTS NETWORK (BRAD JOHANSEN, STEVE LAPPAS, JUSTIN WALTERS)

“Keep an eye on this Florida State team. They are picked 5th in the ACC this season. Last year they were picked 7th and had a program best 29 wins. Don’t bet against Leonard Hamilton.”

Paul Biancardi ESPN

FLORIDA STATE TRAVELS TO NICEVILLE FOR MATCH-UP WITH NATIONALLY RANKED TENNESSEE Florida State, which has won five consecutive games, travels to Niceville, Fla., to play Tennessee at The Arena at Northwest Florida State College in the third round of the Emerald Coast Classic. The Seminoles and the Volunteers are meeting for the ninth time – and for the first time since a 101-90 Florida State victory on January 15, 1989 in Tallahassee. Florida State is playing in the Panhandle of Florida in Niceville for the first time in school history. The campus of Northwest Florida State College is approximately 150 miles west of the Florida State University campus in Tallahassee – the capital city of the state of Florida. The Seminoles’ game in Niceville marks their sixth consecutive game in the state of Florida. After opening the season at Pittsburgh, the Seminoles have played four games in Tallahassee (4-0) and one in Gainesville against Florida (1-0 with a victory over the then No. 6 Gators of the SEC). The Seminoles play nine of their first 11 games of the season in the state of Florida in four different arenas (seven at the Donald L. Tucker Center in Tallahassee, two in The Arena at Northwest Florida, one at the Exactech Arena at the Stephen C. O’Connell Center at the University of Florida and one at the BB&T Center in Sunrise, Fla. in the Orange Bowl Classic). Following Friday’s game against Tennessee, the Seminoles will face either Purdue or No. 19/20 VCU in the final round of the Emerald Coast Classic on Saturday. Florida State travels to play at Indiana in the ACC / Big Ten Challenge on Tuesday, December 3, 2019 at 9:00 p.m. ET FLORIDA STATE VS. TENNESSEE – CONNECTIONS Florida State will play Tennessee in the third round of the Emerald Classic on Friday, November 29, 2019 at 7:00 p.m. (ET) at The Arena at Northwest Florida State College. It is the ninth meeting between the two teams – and the first since a regular season meeting on January 15, 1989 in Tallahassee – a game won by the Seminoles by a 101-90 margin. The Vols lead the series, which began during the 1957-58 season, by a 5-3 margin. A total of six of the first eight games have been played on one of the teams’ campuses (five at Tennessee and one at Florida State) with two games played in holiday tournaments at neutral sites. The Seminoles are 1-1 against the Vols in games played at a neutral site. Rick Barnes is in his fourth season as the Volunteers Head Coach. He was the head coach at Clemson in the ACC from 1995-98 – the Seminoles were 4-4 against Barnes when he was the Tigers’ head coach. The Seminoles have also faced Barnes as an assistant coach at Alabama (1985-86, 0-1). Michael Schwartz, a former assistant coach at Miami, is an assistant coach for Barnes at Tennessee. The Seminoles were 10-2 against the Hurricanes with Schwartz on the staff. Desmond Oliver, a former assistant coach at Charlotte, was on the 49ers’ staff in both 2012 and 2013 when the Seminoles defeated Charlotte twice in two games. IN-SEASON TOURNAMENT CHAMPIONSHIP HISTORY Florida State has won 16 in-season tournament championships with its most recent title coming at the 2017 Jamaica Classic. The Seminoles also won the 2008 Global Sports Classic, the 2009 Old Spice Classic, and the 2012 Coaches vs. Cancer Classic to give 18th-year Head Coach Leonard Hamilton four tournament championships during his tenure at Florida State. HAMILTON WITH 70 WINS OVER RANKED TEAMS Florida State’s Leonard Hamilton enters Friday’s game against No. 16/17 Tennessee looking for his 71st career win over a nationally ranked team. He earned two wins over ranked teams at Oklahoma State, 17 at Miami and 51 at Florida State. He has earned four wins over No. 1 ranked teams: against No. 1 Oklahoma (February 4, 1989 while at Oklahoma State); against No. 1 Duke (March 1. 2006 while at Florida State); against No. 1 North Carolina (March 4, 2009 while at Florida State) and against No. 1 Duke (January 12, 2011 while at Florida State). Nearly 13 percent of Hamilton’s total of 539 wins have come against nationally ranked teams (70 of 539, .1298 percent). LOOK FOR FLORIDA STATE TO… …Defeat No. 16/17 Tennessee and gain its second victory of the season over a nationally ranked team. The Seminoles defeated then No. 6/6 ranked Florida by a 63-51 decision in Gainesville on November 10, 2019; …Defeat No. 16/17 Tennessee and win in 21st game against a nationally ranked opponent in the last four seasons. The Seminoles defeated a school-record seven nationally ranked teams during the 2016-17 season; …Defeat No. 16/17 Tennessee and earn its fifth win over a ranked team from the SEC in the last four years. The Seminoles have three wins over ranked Florida teams and one over a ranked LSU team since Dec. 11, 2016.

2019-20 Florida State Schedule/Results O22 1 Barry University W, 95-66 N1 1 Columbus State W, 84-54 N6 * at Pittsburgh L, 61-63 N10 at Florida W, 63-51 N15 Western Carolina W, 79-74 N20 2 Chattanooga W, 89-53 N23 Saint Francis (Pa.) W, 80-65 N25 2 Chicago State W, 113-56 N29 3 vs. Tennessee 7:00 p.m. N30 3 vs. Purdue/VCU TBA D3 at Indiana 9:00 p.m. D8 * Clemson 2:00 p.m. D17 North Florida 8:30 p.m. D21 USF 12 Noon D28 North Alabama 2:00 p.m. D31 * Georgia Tech 12 Noon J4 * at Louisville 2:00 p.m. J8 * at Wake Forest 7:30 p.m. J15 * Virginia 7:00 p.m. J18 * at Miami 12 Noon J25 * Notre Dame 8:00 p.m. J28 * at Virginia 7:00 p.m. F1 * at Virginia Tech 4:00 p.m. F3 * North Carolina 7:00 p.m. F8 * Miami 12 Noon F10 * at Duke 7:00 p.m. F15 * Syracuse 12 Noon F18 * Pittsburgh 8:00 p.m. F22 * at NC State 4::00 p.m. F24 * Louisville 7:00 p.m. F29 * at Clemson 2:00 p.m. M4 * at Notre Dame 9:00 p.m. M7 * Boston College 4:30 p.m. M ACC Tournament TBA Greensboro, N.C. *ACC Game 1 Exhibition Game; 2 Emerald Coast Classic at Tallahassee, Fla.; 3 Emerald Coast Classic at Northwest Florida State College, Niceville, Fla.; 4 ACC/Big Ten Challenge at Bloomington, Ind.; 5 Metro by T-Mobile Orange Bowl Basketball Classic at BB&T Center, Sunrise, Fla.; 6 ACC Tournament at Greensboro Coliseum, Greensboro, N.C.

2018-19 ACC Standings

Team W L Pct. W L Pct. Virginia 16 2 .889 34 3 .919 N. Carolina 16 2 .889 29 7 .806 Duke 14 4 .778 32 6 .842 Florida State 13 5 .722 29 8 .784 Virginia Tech 12 6 .667 27 9 .750 Louisville 10 8 .556 20 14 .588 Syracuse 10 8 .556 20 14 .588 NC State 9 9 .500 24 11 .686 Clemson 9 9 .500 20 14 .588 Georgia Tech 6 12 .333 14 18 .438 Boston College 5 13 .278 14 17 .452 Miami 5 13 .278 14 19 .424 Wake Forest 4 14 .222 11 20 .355 Pittsburgh 3 15 .167 14 19 .424 Notre Dame 3 15 .167 14 19 .424

Leonard Hamilton’s Career Record W L Pct. Years Career 539 427 .558 1987-Pr. at Okla. State 56 63 .471 1987-90 at Miami 144 147 .495 1991-00 at Florida State 339 217 .610 2002-Pr.

A QUICK REVIEW OF THE 2018-29 SEASON Florida State enjoyed one of the greatest seasons in school history in 2018-19 as it played in its third consecutive NCAA Tournament, advanced to the Sweet 16 of the NCAA Tournament for the school-record tying second consecutive season, finished the season ranked 10th nationally, advanced to the championship game of the ACC Tournament, finished fourth in the ACC standings and defeated six nationally ranked teams. Florida State won a program record 29 games and earned a school-record 13 ACC wins, finishing fourth in the best conference for college basketball in the country. The Seminoles defeated Virginia, who won the National Championship, in the semifinals of the ACC Tournament to reach the championship game of the ACC Tournament for the third time in school history. FLORIDA STATE NATIONALLY IN THE LAST TWO SEASONS The Seminoles are one of seven teams in the nation (Florida State, Duke, Gonzaga, Kentucky, Michigan, Purdue and Texas Tech) who have advanced at least as far as the Sweet 16 of the NCAA Tournament in both of the last two seasons. The Seminoles advanced to the Elite Eight in 2018 and to the Sweet 16 in 2019. HAMILTON MOVES CLOSER TO SIXTH WINNINGEST COACH IN ACC HISTORY With 339 career victories during his tenure at Florida State, 18th-year Head Coach Leonard Hamilton enters the Seminoles’ game against Saint Francis on Saturday as the seventh all-time winningest coach in ACC history. He needs only 10 wins to move into sixth place in ACC history (passing Maryland’s Lefty Driesell) and only 11 wins to become just the sixth coach in the illustrious history of the nation’s best basketball conference to win 350 career games. Hamilton In ACC History Rank Coach, School Career Wins 1. Mike Krzyzewski, Duke 1,059 2. Dean Smith, North Carolina 879 3. Gary Williams, Maryland 461 5. Bobby Cremins, Georgia Tech 354 6. Lefty Driesell, Maryland 348 7. Leonard Hamilton, Florida State 339 THE LAST TEAM TO BEAT VIRGINIA Florida State, which has won 21 of its last 25 games (.840 winning percentage) dating to a 77-68 victory over Clemson on January 22, 2019, is the last team to beat defending national champion Virginia. The Seminoles topped the Cavaliers, 69-59, in the semifinals of the 2019 ACC Tournament in Charlotte to advance to the ACC Tournament Championship game for the third time in school history. SEMINOLES REMAIN HOT FROM THE FREE THROW LINE; ENTER FRIDAY’S GAME AS ACC LEADER Florida State, which shot a season-high .871 percent from the free throw line and made 27 free throws in its win over Chicago State, enters Friday’s game against No. 16/17 Tennessee ranked first in the ACC in free throw shooting percentage with a .817 mark through its first six games of the season. The Seminoles are shooting nearly nine percentage points higher from the line than the second-ranked free throw shooting team in the ACC – Louisville at .732. Florida State is the only team in the ACC shooting above .800 percent from the free throw and the only ACC team shooting better than 74 percent from the free throw line. Breaking Down Florida State From The Free Throw Line Games FTM FTA Pct. Notes Last 2 42 48 .875 Seminoles shooting .929 (16 of 28) in the last two first halves First 4 65 83 .783 Seminoles averaged 16.3 FGM/Game in first 4 games SEMINOLES WITH DOUBLE FIGURE STEALS IN LAST TWO GAMES Florida State earned 11 steals in its 80-65 win over Chattanooga on Nov. 23 and totaled a season-high 13 steals in its victory over Chicago State on Nov. 25 to move into fifth place in the ACC team standings with an 8.2 steals per game average. The Seminoles’ 24 steals in the last two games led to 58 points off turnovers and limited the Mocs and the Cougars to 54 and 52 shots, respectively. Florida State averaged nearly twice as many steals (12.0) in the last two games when compared to its steals average in the first four games of the season. Breaking Down The Seminoles Defensive Abilities Games Steals SPG Notes Last 2 24 12.0 Anthony Polite with a career-high 5 steals in FSU victory over Saint Francis First 4 25 6.3 Trent Forrest with 2 steals in season opener at Pitt Improvement +5.7 Trent Forrest ranked 9th in school history with 175 career steals SEMINOLES’ BENCH OUTSCORES CHICAGO STATE With three bench players in double figure scoring (Patrick Williams, 16; Nathanael Jack, 14; Balsa Koprivica, 10) in their victory over Chicago State on Monday night in Tallahassee, the Seminoles’ bench outscored the Cougars by a 64-56 margin for the game. The 11 reserves for Florida State scored 64 points and the Cougars as a team scored 56. Florida State’s bench has outscored its opponents’ bench in each of the last five games (all victories) by a 195-115 margin and by a 210-149 (+61 points) for the first six games of the year. Breaking Down Florida State Off Of The Bench Opponent FSU Bench Oppt Bench Notes Pitt 15 34 Anthony Polite leads FSU with 8 points off of the bench. Florida 13 9 Anthony Polite leads FSU with 7 points off of the bench Western Carolina 25 9 Patrick Williams leads FSU with 18 points off of the bench Chattanooga 51 7 Patrick Williams leads FSU with 16 points off of the bench Saint Francis 42 19 Wyatt Wilkes scores leads FSU with 14 points off the bench Chicago State 64 11 Patrick Williams leads FSU with 16 points off the bench

Florida State Basketball / National Polls

ASSOCIATED PRESS POLL Rk. Team 19-20 Rec. 1. Duke (53) 6-0 2. Louisville (7) 6-0 3. Michigan State (4) 3-1 4. Kansas 3-1 5. Maryland 5-0 6. North Carolina 4-0 7. Virginia (1) 6-0 8. Gonzaga 6-0 9. Kentucky 5-1 10. Ohio State 5-0 11. Oregon 5-0 12. Texas Tech 5-0 13. Seton Hall 4-1 14. Arizona 6-0 15. Utah State 7-0 16. Memphis 5-1 17. Tennessee 4-0 18. Auburn 5-0 19. Baylor 5-1 20. VCU 5-0 21. Colorado 4-0 22. Villanova 4-2 23. Washington 5-1 24. Florida 5-2 25. Xavier 6-1

ARV – Florida State (26th place)

USA TODAY POLL Rk. Team Points 1. Duke (27) 766 2. Louisville (1) 728 3. Michigan State (1) 689 4. North Carolina 640 5. Kansas 637 6. Virginia 628 7. Gonzaga 576 8. Maryland (1) 572 9. Ohio State (1) 524 10. Oregon 471 11. Kentucky 454 12. Texas Tech 430 13. Seton Hall 378 14. Arizona 365 15. Utah State 296 16. Tennessee 276 17. Auburn 255 18. Baylor 223 19. VCU 213 20. Memphis 163 21. Villanova 147 22. Washington 108 23. Xavier 96 24. Colorado 76 25. Florida 71

ARV – Florida State (29h place)

ACC Operation Basketball (Oct. 8, 2019) 1. Duke (51) 1564 2. North Carolina (19) 1493 3. Louisville (29) 1448 4. Virginia (12) 1405 5. Florida State 1157 6. NC State 1038 7. Notre Dame 915 8. Syracuse 910 9. Miami 768 10. Pitt 577 11. Clemson 564 12. Georgia Tech 437 13. Boston College 382 14. Virginia Tech 334 15. Wake Forest 328

POSSIBLE STARTING LINEUP FOR FLORIDA STATE… F #10 Malik Osborne (6.8 ppg and 5.7 rpg; Career-high tying 4 blocked shots at Pitt, November 6, 2019) C #15 Dominik Olejniczak (4.4 ppg and 2.6 rpg; Career-high tying 1.000 FT Pct. vs. Chicago St., Nov. 25, 2019) G #2 Anthony Polite (6.0 ppg and 3.3 rpg; Career-high tying 9 points vs. Chicago State, November 25, 2019) G #3 Trent Forrest (12.2 ppg and 4.7 apg; Career-high tying 2 3FGM vs. Chicago State, November 25, 2019) G #24 Devin Vassell (12.3 ppg and 4.0 rpg; Career-high 17 points vs. Chattanooga, November 20, 2019) …AND TOP RESERVES G #31 Wyatt Wilkes (4.5 ppg and 1.5 rpg; Career-high 14 points vs. Saint Francis, November 23, 2019) F #1 RaiQuan Gray (6.0 ppg and 4.3 rpg; Career-high 7 rebounds vs. Chicago State, November 25, 2019) G #23 M.J. Walker (11.3 ppg and 4.0 rpg; Career-high tying 1.000 FT Pct. at Pitt, November 6, 2019) F #4 Patrick Williams (10.8 ppg and 3.8 rpg; Career-high 18 points vs. W. Carolina, November 15, 2019) G #11 Nathanael Jack (5.8 ppg and 2.0 rpg; Career-high 14 points vs. Chicago State, November 25, 2019) F #30 Harrison Prieto (0.5 ppg and 1.0 rpg; Career-high tying 2 points vs. Chattanooga, November 20, 2019) G #0 RayQuan Evans (4.0 ppg and 2.3 apg; Career-high 6 points vs. Saint Francis, November 23, 2019) C #5 Balsa Koprivica (6.5 ppg, 3.3 rpg; Career-high 11 points vs. Saint Francis, November 23, 2019) POSSIBLE STARTING LINEUP FOR TENNESSEE F #10 John Fulkerson (10.8 ppg, 7.0 rpg; Totaled 14 pts and 2 stls vs. Washington, November 16, 2019) G #1 Lamonte Turner (12.8 ppg, 4.3 rpg; Totaled 17 points and 12 assists vs. Chattanooga, Nov. 25, 2019) G #5 Josiah-Jordan James (4.8 ppg, 6.3 rpg; Totaled 9 points and 2 stls vs. Washington, Nov. 16, 2019) G #23 Jordan Bowden (17.5 ppg, 3.5 rpg; Totaled 26 points and 2 rebounds vs. Murray State, Nov. 12, 2019) G #35 Yves Pons (12.8 ppg, 8.5 apg; Totaled 19 points and 4 blks vs. Murray State, November 12, 2019) FLORIDA STATE VS. TENNESSEE -- A SERIES HISTORY The Series: Tennessee leads the series, 5-3 First Game: December 9, 1957; at Tennessee 74, Florida State 57 Last Game: January 15, 1989; at Florida State 101, Tennessee 90 Last Florida State Win: January 15, 1989; at Florida State 101, Tennessee 90 Last Tennessee Win: December 19, 1987; at Tennessee 81, Florida State 78 Last Florida State Win on a Neutral Court: December 30, 1986; Florida State 91, Tennessee 90 Last Tennessee Win in a Neutral Court: December 22, 1964; Tennessee 65, Florida State 45 Current Streak: Florid State has won 1 Current Streak on a Neutral Court: Florida State has won 1 FLORIDA STATE VS. TENNESSEE – THE LAST FOUR GAMES Jan. 15, 1989 Dec. 19, 1987 Dec. 30, 1986 Dec. 22, 1964 at Florida State 101 Florida State 78 Florida State 91 Florida State 43 Tennessee 90 at Tennessee 81 Tennessee 90 Tennessee 65 FLORIDA STATE VS. TENNESSEE – THE LAST GAME With four players scoring in double figures, then No. 14 Florida State gained a 101-90 victory over No. 17 Tennessee on January 15, 1989 at the Tallahassee Leon County Civic Center. Tony Dawson’s double-double led the Seminoles with 30 points scored and 10 rebounds, as he went 6-of-7 from the line. George McCloud scored 29 points, recorded four steals, and pulled down five rebounds in the victory. Irving Thomas scored 16 and pulled down eight rebounds, while Tharon Mayes added 14 points. Florida State took the lead after three minutes of play and never trailed again. The Seminoles outscored the Volunteers by a 51-38 margin in the first half as they shot 53.5% from the field, and led by thirteen at the intermission. Tennessee gained momentum in the second half, outscoring the Seminoles by a slim 52-50 margin, but a consistent 53.4% shooting percentage and a staunch defensive effort from Florida State earned the win. Florida State’s defense propelled the Volunteers into several miscues and they produced just six assists to 19 turnovers, compared to the Seminoles’ 14 assists to eight turnovers. TONIGHT’S OFFICIALS Tonight’s referees will be assigned by the Emerald Coast Classic officials prior to the game. 2018-19 FLORIDA STATE ROSTER No. Name Pos. Ht. Wt. Yr. Hometown 0 RayQuan Evans G 6-4 210 Jr. Billings, Mont./North Idaho College 1 RaiQuan Gray F 6-8 260 RSo. Ft. Lauderdale, Fla./Dillard 2 Anthony Polite G 6-6 215 RSo. Lugano, Switzerland/St. Andrews Christian School (Fla.) 3 Trent Forrest G 6-5 210 Jr. Chipley, Fla./Chipley 4 Patrick Williams F 6-8 225 Fr. Charlotte, N.C./West Charlotte 5 Balsa Koprivica C 7-1 260 Fr. Belgrade, Serbia/Montverde Academy 10 Malik Osborne F 6-9 215 So. Matteson. Ill./Bosco Institute/Rice 11 Nathanael Jack G 6-5 195 Jr. Mississauga, Ontario, Canada/Eastern Florida State 12 Justin Lindner G 6-1 180 RJr. Memphis, Tenn./Christian Brothers 15 Dominik Olejniczak C 7-0 260 Gr. Tourn, Poland/Ole Miss/Drake 20 Travis Light G 6-5 175 RJr. Vienna, Va./IMG Academy 23 M.J. Walker G/F 6-5 213 Jr. Riverdale, Ga./Jonesboro 24 Devin Vassell G 6-6 180 So. Suwanee, Ga./Peachtree Ridge 30 Harrison Prieto F 6-8 230 RJr. Mandeville, La./St. Paul’s School 31 Wyatt Wilkes F 6-8 220 RSo. Orlando, Fla./Winter Park 33 Will Miles G 6-6 220 RJr. Orlando, Fla./Trinity Prep 42 Cleveland Yates G 6-2 214 Fr. Memphis, Tenn./Briarcrest Christian School 44 Ty Hands G 6-5 180 RFr. West Palm Beach, Fla./Palm Beach Lakes PRONUNCIATION GUIDE: RayQuan Evans (RAY-Qwan); RaiQuan Gray (RAY-Qwan); Balsa Koprivica (Ball-Sha KA-Pre-Vizza); Dominik Olejniczak (DOM-a-nick Ole’-knee-CHUCK); Devin Vassell (Dev-in Vuh-SELL - like Sam Cassell with a V).

Florida State Men’s Basketball Upcoming Milestones

Leonard Hamilton

Victories as an ACC Coach 339 (Career at Florida State)

+10 (Needs) 349

To Become the 6th Winningest Coach in ACC History (all victories)

Leonard Hamilton

ACC Victories at Florida State (Regular Season + ACC Tourn.)

151 (career at Florida State) +10 (Needs)

161 To Become the 5th Winningest Coach in ACC

history (ACC games) – surpassing Frank McGuire of North Carolina and

South Carolina

Leonard Hamilton Wins vs. AP No. 1 In Career 4 (career at Florida State)

+4 (Needs) To move into a tie for first place college

basketball history with Roy Williams for all-time wins vs. the nation’s No. 1 ranked

team

Trent Forrest Career Steals

175 (career at Florida State) +6 (Needs)

181 To move into 8th place for career steals in

school history passing Chris Singleton (2009-11)

Trent Forrest Career Assists

359 (career at Florida State) +3 (Needs)

362 To move into 10th place in school history for

career assists passing LaMarr Greer (1995-98)

Trent Forrest Career Points

857 (career at Florida State) +143 (needs)

1,000 To become the 49th player in school history

to school 1,000 or more career points

M.J. Walker Career 3-Point Field Goals Made

89 (career at Florida State) +11 (needs)

100 To become the 23rd player at Florida State with 100 or more career 3-point field goals

made

M.J. Walker Career 3-Point Field Goals Made

89 (career at Florida State) +5 (needs)

To move into 23rd place in school in school history with 94 career 3-point field goals

made passing Aubrey Boyd (1988-91), Michael Joiner (2001-04) and Todd

Galloway (2003-06)

FORREST MAKES TRIP DOWN 1-10 WEST FOR HOMECOMING AT EMERALD COAST CLASSIC Senior Trent Forrest makes a familiar trip down I-10 West with his teammates for the third and fourth rounds of the Emerald Coast Classic this week. The Seminoles’ team bus will pass through Washington County and his home of Chipley, Fla. Forrest was a star at Chipley High School as he scored more than 3,000 career points and earned All-State honors as one of the greatest players in Chipley history. Chipley is roughly 85 miles from Tallahassee and just over an hour from Niceville and the site of the ECC. It’s safe to say that Forrest has been working on gathering tickets from his teammates since the Seminoles’ were announced to be playing in the tournament during the Fall of 2018. FORREST CONTINUES TO MOVE CLOSER TO 1,000 CAREER POINTS Senior Trent Forrest scored 12 points in Florida State’s victory over Chicago State on Monday night – the fourth time in six games that he has scored in double figures this season. He enters Friday’s game against No. 16/17 Tennessee with 857 career points and needs only 143 to become just the 48th player in school history to score 1,000 or more career points. One of the most prolific scorers in the history of basketball in the state of Florida, Forrest scored 3,103 career points as a high school star meaning he is approaching the 4,000 career point mark. In combining his high school (3,103 career points) and his college scoring total (857 career points), Forrest has scored 3,960 points and needs only 40 to reach 4,000 points for his prep and college career combined. Breaking Down Forrest’s Scoring Totals at Florida State Season Games Points PPG Notes 2016-17 35 171 4.9 Season-high 13 points vs. Nicholls State 2017-18 34 269 7.9 Season-high 21 points vs. Boston College 2018-19 37 344 9.3 Career-high 23 points vs. Southeast Missouri 2019-20 6 73 12.2 Season-high 19 points at Pitt Totals 112 857 7.7 Double figure scoring in 33 career games FORREST NAMED TO COUSY AWARD WATCH LIST Trent Forrest, who was named to the 2019 NCAA Tournament All-West Regional Team in 2019, is on the 2020 Bob Cousy Award Watch List – an award which is presented annually by the Naismith Basketball Hall of Fame to the nation’s top collegiate point guard. Forrest is one of four point guards from the Atlantic Coast Conference on the list of 20 which will be narrowed down to five players in March as finalists for the award. FORREST NEARING TOP-10 FOR STEALS AND ASSISTS AT FLORIDA STATE Senior Trent Forrest enters Friday’s game against No. 16/17 Tennessee ranked ninth in school history with 175 career steals and 11th in school history with 359 career assists. He needs only two assists to move into a tie for 10th place in school history with 361 career assists. Should Forrest move into the top 10 for both categories, he will be only the fourth player in school history (Delvon Arrington, Bob Sura and Charlies Ward) to rank in Florida State’s top 10 for both steals AND assists. WITH 16 POINTS AGAINST CHICAGO STATE, VASSELL REGAINS TEAM SCORING LEAD Sophomore Devin Vassell scored 16 points in Florida State’s victory over Chicago State and moved into Florida State’s team scoring lead with 74 points and a career-high 12.3 points per game scoring average. He scored his career-high of 17 points in Florida State’s victory over Saint Francis (November 23) and has scored in double figures in five of the first six games of the season. Vassell is averaging nearly eight points more per game this season as compared to his freshman season and has already scored (through six games) in double figures as many times this season (five) as he did in 33 games as a freshman (five). Breaking Down Vassell’s Scoring Totals Season Games Points PPG Notes 2019-20 6 74 12.3 Double figure scoring in five games 2018-19 33 149 4.5 Double figure scoring in five games Improvement +7.8 Double figure scoring in 10 games KEY TO VASSELL’S SCORING SUCCESS – SHOOTING THE BALL WELL FROM ALL OVER THE COURT One of the many keys to the increased scoring success by Seminole sophomore Devin Vassell is his increased success shooting the basketball this season. He has increased his shooting percentages from all over the court – from the field and from the 3-point line – as he enters Friday’s game against Tennessee as Florida State’s leading scorer with a career-high 12.3 points per game scoring average. Vassell has increased his field goal shooting percentage by 14 percentage points and his 3-point shooting percentage by five percentage points. Breaking Down Vassell’s Shooting Success Season FG Pct. 3FG pct. PPG Notes 2019-20 .577 .467 12.3 Averaging a career-high 12.3 points scored per game 2018-19 .437 .419 4.5 Ranked ninth on the team with a 4.5 points per game scoring average Improvement +.140 +.048 +7.8 Team leader with his 12.3 points per game scoring average FRESHMAN WILLIAMS LEADS THE ACC IN FREE THROW SHOOTING PERCENTAGE Freshman Patrick Williams enters Friday’s game against No. 16/17 Tennessee as the ACC leader with a perfect 1.000 shooting mark (17 of 17) from the free throw line. He is averaging 2.8 free throws made and 2.8 free throws attempted in the first six games of his collegiate career. Breaking Down Williams From The Free Throw Line Opponent FTM FTA Pct. Notes at Pitt 2 2 1.000 2 second half FT’s pull Florida State to 62-61 with 8 seconds left at Florida 0 0 .000 Scored all four of his points from the field Western Carolina 7 7 1.000 2 of 2 FT with 16 seconds left to lift Florida State over Catamounts Chattanooga 2 2 1.000 2 first half FT’s help Florida State a 41-29 halftime lead Saint Francis 2 2 1.000 2 of 2 FT’s in first half lead Florida State to 38-36 intermission lead Chicago State 4 4 1.000 4 of 4 FT’s in second half as Florida State pulled away

Florida State Men’s Basketball By The Numbers

2 Two Florida State players – Patrick Williams (first, 1.000 percent) and Trent Forrest (fifth, .870 percent) – are ranked in the top five in the ACC statistics for individual free throw shooting. 2 Florida State is one of only two teams in the ACC (and is joined by only Duke) that has advanced at least as far as the Sweet 16 of the NCAA Tournament in both of the last two seasons. The Seminoles advanced to within one step of the NCAA Final Four -- the Elite Eight – in the 2018 NCAA Tournament. 3 Head Coach Leonard Hamilton has named three captains for the 2019-20 season – Trent Forrest, M.J. Walker and Harrison Prieto. 3 Three Seminoles – Devin Vassell, Trent Forrest and Malik Osborne -- have started each of the first six games of the season for Florida State. 4 Florida State is looking to play in its school-record tying fourth consecutive NCAA Tournament in 2020. 4 Florida State is the fourth winningest program in the ACC since the start of the 2005-06 season ranking behind only Duke, North Carolina and Virginia in the composite ACC standings in the last 15 years. 5 Five different Seminoles – Trent Forrest vs. Pitt; Devin Vassell vs. Florida, Chattanooga and Chicago State; M.J. Walker vs. Western Carolina; Patrick Williams vs. Western Carolina and Chicago State and Wyatt Wilkes vs. Saint Francis – have led the Seminoles in scoring through the first six games of the 2019-20 season. 5 Florida State is undefeated, 5-0, when it outscores its opponent. 5 Redshirt sophomore Anthony Polite earned his career-high of five steals in Florida State’s victory over Saint Francis. He became the first Seminole with five steals in a game since current senior Trent Forrest totaled five steals in a Florida State victory over Louisville on February 9, 2019. 6 Florida State’s +57 margin of victory against Chicago State on Monday night is tied for the sixth largest margin of victory in school history. 8 Eight different Seminoles have started at least one game for the Seminoles in the first six contests of the 2019-20 season. 12 A season high 12 different Seminoles scored at least one point against both Chattanooga and Chicago State. 83 Senior Trent Forrest has been a part of 83 Seminole victories during his career – including a school-record 29 wins during the 2018-19 season.

WILLIAMS AVERAGING IN DOUBLE FIGURES AS SEMINOLES FACE TENNESSEE Freshman Patrick Williams enters Friday’s game against Tennessee averaging 10.8 points per game – he is one of four Seminoles averaging in double figures through the first six games of the season. He has scored in double figures in three of the first six games of his career (including three of the last four) and is averaging 14.0 points scored per game in the last four games. Though he has not been in the starting lineup yet this season, he has been on the floor for the Seminoles at the end of the games at Pittsburgh (12 second half minutes played), at Florida (9 second half minutes played) and Western Carolina (13 second half minutes played) – all games whose outcomes came down to the final minutes of the games. Breaking Down Williams – Game By Game Opponent Minutes Points Rebounds FTM-FTA Notes at Pitt 27 5 3 2-2 First career game – ACC and Overall at Florida 16 4 5 0-0 First game against a nationally ranked team Western Carolina 23 18 4 7-7 Tied for team high in scoring column Chattanooga 20 16 3 2-2 One of five from FSU in double figure scoring Saint Francis 22 6 5 2-2 Also 1 blocks, 1 steal and 1 assist Chicago State 20 16 3 4-4 Tied for team high in scoring column POLITE PLAYING WELL AS A STARTER Redshirt sophomore Anthony Polite has started each of the last three games for the Seminoles and will look to be in the starting lineup for the fourth consecutive game against Tennessee. He tied his career-high with nine points in the Seminoles’ victory over Chicago State (November 25), pulled down his career-high of seven rebounds in Florida State’s win over Saint Francis (November 23), totaled his career-high of five assists against Chicago State and earned his career-high of five steals against Saint Francis. Breaking Down Polite As A Starter Opponent Minutes Points Rebounds Assists Steals Chattanooga 25 1 2 0 0 Saint Francis 29 8 7 2 5 Chicago State 15 9 4 5 3 Totals 69 18 13 7 8 Averages as a Starter 23.0 6.0 4.3 2.3 2.7 Averages as a Reserve 22.7 6.0 2.3 0.3 1.3 OLEJNIZCAK EARNS HIS WAY INTO THE SEMINOLES’ STARTING LINEUP Graduate transfer Dominik Olejniczak has started both of the last two games for the Seminoles in victories over Saint Francis and Chicago State. He played in his 100th career game in the Florida State’s victory over Chicago State on Monday night in Tallahassee and has now started 43 games during his collegiate career. Breaking Down Olejniczak’s Starting Assignments Season School GP GS PPG RPG MPG 2015-16 Drake 30 8 6.5 4.1 16.4 2017-18 Ole Miss 32 11 4.3 2.6 14.1 2018-19 Ole Miss 33 22 4.3 3.2 18.3 2019-20 Florida State 5 2 4.4 2.6 9.6 OLEJNICZAK AGAINST TENNESSEE Graduate transfer Dominik Olejniczak will play against Tennessee for the fourth time in his career after transferring from Ole Miss of the SEC to Florida State of the ACC. OSBORNE CONTINUES TO BE A CONSTANT FOR THE SEMINOLES Redshirt sophomore Malik Osborne, who is playing his first season at Florida State after transferring from Rice University, is one of just three Seminoles who has started all six games so far this season. He enters Friday’s game against No. 16/17 Tennessee as the Seminoles’ leading rebounder (34 rebounds / 5.7 rpg) and as the team’s leader in blocked shots (seven blocked / 1.2 bpg). Osborne enters Friday’s game against Tennessee averaging 6.8 points scored per game – he has scored in double figures twice (in victories over Florida and Chattanooga) and totaled nine rebounds in his first game as a Seminole at Pitt and in the Seminoles’ victory over Western Carolina. Breaking Down Osborne Game By Game Opponent Pts Rebs Blocks Notes at Pitt 2 9 4 FSU leader in rebounds and blocked shots at Florida 10 4 0 1 of 3 Seminoles in double figure scoring in victory Western Carolina 6 9 1 FSU leader in rebounds and blocked shots Chattanooga 10 3 0 1 of 5 Seminoles in double figure scoring in victory Saint Francis 9 4 2 FSU leader in blocked shots Chicago State 4 5 0 Perfect two of two shooting from the field OSBORNE USED TO HIS ROLE AS A STARTER For redshirt sophomore Malik Osborne his role as a starter for the Seminoles is exactly what he is used to during his collegiate career. He is slated to start his 34th consecutive game on Friday against Tennessee in the semifinals of the Emerald Coast Classic. After beginning his career as a reserve in the first four games of his career at Rice, he started the final 27 games of the 2017-18 season for the Owls before transferring to play at Florida State. Breaking Down Osborn’s Career Season School GP GS PPG RPG Minutes 2017-18 Rice 31 27 9.0 6.5 27.1 2019-20 Florida State 6 6 6.8 5.7 22.3

What’s In A Seminoles’ Name RayQuan Evans – “My full name is RayQuan Ethan Evans. My dad took the name of one of the singers, Raekwon, from the 1990’s band Wu Tang Clan, and put his own spin on the spelling for my first name. Ethan, from the Bible, came from my mom. The name Ethan means strong, firm and long-lived.” RaiQuan Gray –“My full name is RaiQuan Kelvan Gray. I wasn’t named after anyone specifically. My name means wisdom and power. All the children in my family have an R to begin their names – my sister, Raven and my brother, Rasheed. My middle name is similar to my dad’s middle name which is Kelvin.” Anthony Polite – “My full name is Anthony Michael Lewis Polite. Anthony comes from Saint Antonio (also known as Anthony of Lisbon) whose birthday was June 13, 1231. My grandmother was also born on June 13 and my mother really loved the name Anthony. My middle name, Michael, is from my dad and Lewis is after my mother’s grandfather – my great-grandfather.” Trent Forrest – “My full name is Landon Trent Forrest. I was named after the actor Michael Landon because my family really enjoyed him as an actor. Trent is not a family name – it was the chosen middle name for me by my parents and one that I preferred as a child. My oldest brother is named Lester Tremaine Forest (LTF) and my parents wanted to keep the same initials for me.” Balsa Koprivica – “My name comes from the ancient Serbian King Balšić and his family. The Balšićs were a noble family that ruled from 1362 to 1421, during and after the fall of the Serbian Empire. Balsa also means strong and well built.” Malik Osborne – “My full name is Malik James Osborne. Malik comes from a close friend of my father and James from my father.” M.J Walker – “My full name is James Michael Walker, Jr. I am named after my father who is James Michael Walker, Sr.” Devin Vassell – “My full name is Devin Anthony Vassell. I got my first name from my grandmother. My parents were going to name me Anthony, but my grandmother preferred Devin, so that’s what my family went with.” Harrison Prieto – “My full name is Harrison Hansbrough Prieto. I’m named after my great-grandfather, Peter Harrison Hansbrough, but my mom liked the named Harrison more than she did Peter, so she chose to name me Harrison.” Wyatt Wilkes – “My full name is Wyatt David Wilkes. I’m not really named after anyone; my parents wanted a name that wasn’t easily nicknamed and one that sounded original.”

2019-20 Florida St. Men's BasketballCombined Team Statistics

All gamesPage 1/1

as of Nov 26, 2019

Game RecordsRecord Overall Home Away NeutralALL GAMES 5-1 4-0 1-1 0-0CONFERENCE 0-1 0-0 0-1 0-0NON-CONFERENCE 5-0 4-0 1-0 0-0

Score by PeriodsTeam 1st 2nd OT TOTFlorida St. 240 245 0 485Opponents 183 179 0 362

Team Box Score

No. PlayerTotal 3-Point F-Throw Rebounds

GP-GS MIN AVG FG-FGA FG% 3FG-FGA 3FG% FT-FTA FT% OFF DEF TOT AVG PF DQ A TO BLK STL PTS AVG24 VASSELL, Devin 6-6 143:01 23.8 30-52 .577 7-15 .467 7-11 .636 10 14 24 4.0 10 0 6 4 4 7 74 12.303 FORREST, Trent 6-6 172:16 28.7 24-57 .421 5-13 .385 20-23 .870 5 18 23 3.8 9 0 28 19 3 10 73 12.223 WALKER, M.J. 3-3 75:14 25.1 8-25 .320 4-13 .308 14-17 .824 0 12 12 4.0 8 0 3 3 1 1 34 11.3

4 WILLIAMS, Patrick 6-0 128:06 21.3 22-40 .550 4-11 .364 17-17 1.000 6 17 23 3.8 7 0 6 10 5 5 65 10.810 OSBORNE, Malik 6-6 133:45 22.3 16-32 .500 4-10 .400 5-6 .833 11 23 34 5.7 15 1 4 4 7 1 41 6.8

5 KOPRIVICA, Balsa 6-0 73:29 12.2 16-20 .800 0-0 .000 7-12 .583 9 11 20 3.3 13 1 1 6 2 2 39 6.513 POLITE, Anthony 6-3 137:02 22.8 11-31 .355 7-19 .368 7-8 .875 3 17 20 3.3 5 0 8 13 3 12 36 6.001 GRAY, RaiQuan 4-3 83:36 20.9 6-18 .333 1-8 .125 11-14 .786 5 12 17 4.3 10 1 6 7 1 2 24 6.011 JACK, Nathanael 4-0 40:19 10.1 7-16 .438 7-16 .438 2-2 1.000 1 7 8 2.0 5 0 5 3 0 1 23 5.831 WILKES, Wyatt 6-1 65:50 11.0 9-22 .409 6-19 .316 3-3 1.000 4 5 9 1.5 5 0 4 2 1 3 27 4.515 OLEJNICZAK, Dominik 5-2 48:12 9.6 9-14 .643 0-0 .000 4-4 1.000 8 5 13 2.6 10 0 0 5 3 0 22 4.4

0 EVANS, RayQuan 4-0 55:23 13.8 4-10 .400 0-3 .000 8-10 .800 1 1 2 0.5 4 0 9 3 0 5 16 4.012 LINDNER, Justin 3-0 09:51 3.3 1-1 1.000 0-0 .000 2-2 1.000 0 3 3 1.0 2 0 2 3 0 0 4 1.320 LIGHT, Travis 3-0 07:37 2.5 1-2 .500 1-2 .500 0-0 .000 0 0 0 0.0 0 0 0 0 0 0 3 1.033 MILES, Will 3-0 07:37 2.5 1-3 .333 0-0 .000 0-0 .000 1 0 1 0.3 2 0 1 1 0 0 2 0.730 PRIETO, Harrison 4-0 15:10 3.8 1-3 .333 0-1 .000 0-2 .000 1 3 4 1.0 2 0 0 0 0 0 2 0.542 YATES, Cleveland 3-0 03:31 1.2 0-0 .000 0-0 .000 0-0 .000 0 0 0 0.0 0 0 0 0 0 0 0 0.0Team 5 8 13Total 6 1200 166-346 .480 46-130 .354 107-131 .817 70 156 226 37.7 107 3 83 83 30 49 485 80.8Opponents 6 1200 119-326 .365 39-131 .298 85-118 .720 65 119 184 30.7 114 - 47 102 14 34 362 60.3

Team StatisticsFSU OPP

Scoring 485 362Points per game 80.8 60.3Scoring margin +20.5 -

Field goals-att 166-346 119-326Field goal pct .480 .365

3 point fg-att 46-130 39-1313-point FG pct .354 .2983-pt FG made per game 7.7 6.5

Free throws-att 107-131 85-118Free throw pct .817 .720F-Throws made per game 17.8 14.2

Rebounds 226 184Rebounds per game 37.7 30.7Rebounding margin +7.0 -

Assists 83 47Assists per game 13.8 7.8

Turnovers 83 102Turnovers per game 13.8 17.0Turnover margin +3.2 -Assist/turnover ratio 1.0 0.5

Steals 49 34Steals per game 8.2 5.7

Blocks 30 14Blocks per game 5.0 2.3

Winning streak 5 -Home win streak 4 -

Attendance 30759 19867Home games-Avg/Game 4-7690 2-9934Neutral site-Avg/Game - 0-0

Team ResultsDate Opponent Score Att.11/06/2019 at Pittsburgh L 61-63 901611/10/2019 at Florida W 63-51 1085111/15/2019 Western Caro. W 79-74 949011/20/2019 Chattanooga W 89-53 757211/23/2019 Saint Francis (PA) W 80-65 759511/25/2019 Chicago St. W 113-56 6102

F L O R I D A S T A T E U N I V E R S I T Y

GuardRayQuan Evans#0

RayQuan Evans’ Career High’sPTS ........... 6 vs. Saint Francis (11-23-19)FGM ......... 2 vs. Chicago State (11-25-19)...................2 vs. Saint Francis (11-23-19)FGA .......... 5 vs. Saint Francis (11-23-19)FG% ......... .500 vs. Chicago State (11-25-19)3FGM .......3FGA ........ 2 vs. Chicago State (11-25-19)3FG% .......FTM .......... 4 vs. Chattanooga (11-20-19)FTA ........... 6 vs. Chattanooga (11-20-19)FT% ......... 1.000 vs. Saint Francis (11-23-19)OR.............1 vs. Saint Francis (11-23-19)DR .............1 vs. Saint Francis (11-23-19)REBS ........2 vs. Saint Francis (11-23-19)AST ...........5 vs. Saint Francis (11-23-19)BLK ..........STL ........... 4 vs. Chattanooga (11-20-19)MIN ..........22 vs. Chicago State (11-25-19)underlined denotes career high established or tied during the 2019-20 season

6-4, 210, Junior, Billings, Montana

2019-20 Season* Expected to play a big role in the Seminoles’ rotation at the point guard position.* One of two junior college transfers (also Nathanael Jack) in the expected to contribute to the Seminoles’ success.* Made his Florida State debut 3 minutes played in Florida State’s victory over Western Carolina* Extended playing time against Chattanooga with 4 points and 4 steals in 13 minutes of play* Totaled 6 points, 5 assists and 2 rebounds in Florida State’s victory at home against Saint Francis* Totaled 6 points, 2 assists and 1 steal in Florida State’s victory over Chicago State in Tallahassee

At North Idaho* Graduated from North Idaho College in 2019 with an Associate’s Degree in Graphic Design.* Recognized as the Northwest Athletic Conference Male Basketball Athlete of the Year in 2019.* Named to the All-East Region Defensive Team and as the East Region MVP in 2019.* LedtheCardinalstoatwo-yearcombinedrecordof56-10;theyfinishedwithacombined27-5overallrecord in NWAC play including a perfect 16-0 record during the 2018-19 season.* Averaged18.2points,7.4reboundsand4.9assistsinleadingNorthIdahotoitssecondconsecutive Northwest Athletic Conference championship in 2019.

On Evans* His dad played basketball at the University of Montana. He played two seasons as a forward at Montana. (1993 and 1994). He averaged 9.1 points, 4.2 rebounds, 0.9 steals and 0.3 blocked during his career* Has three brothers – Tray, Tye and Cam.* Originally from (and born in) Georgetown, S.C. Moved to Montana to begin his freshman year of high school.

2019-20 Game-By-Game Statistics -- RaiQuan EvansDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina 1-0 3 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N20 Chattanooga 2-0 13 0-1 .000 0-0 .000 4-6 .667 0-0 0 0 2 1 0 4 4N23 St. Francis (Pa.) 3-0 17 2-5 .400 0-1 .000 2-2 1.000 1-1 2 1 5 0 0 0 6N25 Chicago State 4-0 22 2-4 .500 0-2 .000 2-2 1.000 0-0 0 3 2 2 0 1 6N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

2RayQuan Evans averaged 18.2points,7.4reboundsand 4.9 assists in leading North Idaho College to its second consecutive North-west Athletic Conference championship in 2019.

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- RaiQuan GrayDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 *atPittsburgh 1-1 27 3-6 .500 0-2 .000 1-2 .500 2-1 3 5 2 1 0 0 7N10 atFlorida 2-2 24 1-5 .200 1-3 .333 4-6 .667 0-5 5 1 2 1 0 1 7N15 Western Carolina 3-3 17 1-4 .250 0-1 .000 2-2 1.000 1-1 2 1 1 2 1 0 4N20 Chattanooga DNPN23 St. Francis (Pa.) DNPN25 Chicago State 4-3 16 1-3 .333 0-2 .000 4-4 1.000 2-5 7 3 1 2 0 1 6N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

RaiQuan Gray’s Career HighsPTS ........... 11 vs. Murray State (3-23-19)FGM ......... 3 vs. 6 teams...................Last at Pitt (11-6-19)FGA .......... 9 vs. Vermont (3-21-19)FG% ......... 1.000 vs. 3 Teams...................Last at Wake Forest (3-9-19)3FGM ....... 3 vs. Murray State (3-23-19)3FGA ........ 4 vs. Murray State (3-23-19)3FG% ....... 1.000 at North Carolina (2-23-19)FTM .......... 4 vs. 5 Teams...................Last vs. Chicago State (11-25-19)FTA ........... 6 at Florida (11-10-19)FT% ......... 1.000 vs. 6 Teams...................Last vs. Chicago State (11-25-19)OR.............2 vs. 6 teams ...................Last vs. Chicago State (11-25-19)DR .............6 vs. Gonzaga (3-28-19)REBS ........7vs.ChicagoState(11-25-19)AST ...........3 vs. Miami (1-9-19)BLK ..........1vs.7Teams...................Last vs. Western Carolina (11-15-19)STL ........... 5 vs. Murray State (3-23-19)MIN ..........27atPitt(11-6-19)underlined denotes career high established or tied during the 2019-20 season

6-8, 260, Redshirt-Sophomore, Ft. Lauderdale, Fla.

#1 RaiQuan Gray Forward

2019-20 Season* One of three Seminoles with experience as a starter who is expected to play a large part in the Seminoles’ fortunes.* Astarterwith7pointsand3reboundsatPittinFloridaState’sseasonopener* Totaled7points,5reboundsand2assistsinFloridaState’svictoryoverNo.6FloridainGanesville* Scored6pointsandpulleddownacareer-high7reboundsinFloridaState’svictoryoverChicagoSt.inTallahassee

2018-19 Season* Averaged3.9points(10thontheteam),2.3rebounds(sixth),0.8steals(third)andshot.721fromthefreethrow. line(seventh)asheplayedin36ofFloridaState’s37gamesinleadingtheSeminolestotheSweet16oftheNCAA Tournament.* AstarterduringtheregularseasoninFloridaState’svictoryoverSoutheastMissouriState(Dec.17)andinthe Seminoles’ NCAA Tournament games against Vermont (March 21), Murray State (March 23) and Gonzaga (March 28) in the Sweet 16.* AnintegralpartofFloridaState’srecord-setting2018-19seasonastheSeminolesfinishedwitha28-9record,a 13-5 record in ACC play, in fourth place in the ACC standings, with their third appearance in school history in the ACC Tournament Championship game and a second consecutive appearance in the Sweet 16 of the NCAA Tournament.* Totaled his career-high of 11 points in Florida State’s second round NCAA Tournament game victory over Murray State at the XL Center in Hartford, Conn…his 11 points came in a starters role during which he played his career- high of 24 minutes.

2017-18 Season* A redshirt season. He did not appear in any games during the regular season.* Averaged 8.5 points and 4.5 rebounds in Florida State’s pair of exhibition games wins to begin the season.

On Gray* GraduatedfromDillardHighSchoolin2017* As a senior he led Dillard to a 28-5 record overall while averaging a double-double of 16 points and 12 rebounds.* HelpedthePanthersfinish28-4andnationallyranked20thbyMaxPreps.* Was recognized by MaxPreps as a part of the Tour of Champions nationally ranked teams.* Selectedasamemberofthe2016and2017All-BrowardCountyFirst-TeambytheMiamiHerald.

4/3RaiQuan Gray started four games as a redshirt fresh-man -- one in the regular season against Southeast Missouri State and three

in the NCAA Tournament against Vermont, Murray

State and Gonzaga

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- Anthony PoliteDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 23 2-10 .200 2-6 .333 2-2 1.000 1-3 4 3 0 3 0 1 8N10 atFlorida 2-0 18 2-3 .667 1-1 1.000 2-2 1.000 0-2 2 1 0 1 1 1 7N15 Western Carolina 3-0 24 1-4 .250 1-4 .250 0-0 .000 0-2 2 0 1 2 1 2 3N20 Chattanooga 4-1 25 0-4 .000 0-3 .000 1-2 .500 0-2 2 1 0 1 0 0 1N23 St. Francis (Pa.) 5-2 29 3-6 .500 2-4 .500 0-0 .000 1-6 7 0 2 5 1 5 8N25 Chicago State 6-3 15 3-4 .750 1-1 1.000 2-2 1.000 2-2 4 0 5 0 0 3 9N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Anthony Polite’s Career HighsPTS ........... 9 vs. Chicago State (11-25-19) ...................9 vs. Murray State (3-23-19)...................9 vs. Canisius (11-19-18)FGM ......... 3 vs. 4 teams...................Last vs. Chicago State (11-25-19)FGA ..........7vs.Winthrop(1-1-19)FG% ......... 1.000 vs. Wake Forest (2-13-19)3FGM ....... 2 vs. 4 teams...................Last vs. Saint Francis (11-23-19)3FGA ........ 6 vs. LSU (11-23-18)3FG% ....... 1.000 vs. Murray State (3-23-19)FTM .......... 4 vs. Canisius (11-19-18)FTA ........... 4 vs. Canisius (11-19-18)................... 4 vs. Florida (11-6-18)FT% ......... 1.000 vs. 8 teams...................Last vs. Chicago State (11-25-19)OR.............4 vs. Troy (12-3-18)DR .............6 vs. Saint Francis (11-23-19)REBS ........7vs.SaintFrancis(11-23-19)AST ...........5 vs. Chicago State (11-25-19)BLK .......... 1 at Florida (11-10-16)...................1 at Pitt (1-14-19)STL ........... 5 vs. Saint Francis (11-23-19)MIN ..........29 vs. Saint Francis (11-23-19)underlined denotes career high established or tied during 2019-20 season

GuardAnthony Polite#26-6, 215, Redshirt Sophomore, Lugano, Switzerland

2019-20 Season* Will play a large role in Florida State’s success as sure-handed point guard* EntershisthirdseasonintheSeminoles’programhavingplayedin31gamesinhisfirsttwoseasons* Totaled7points,2reboundsand1stealinFloridaState’victoryoverNo.6FloridainGainesville* AstarterforthefirsttimeinhiscareerintheSeminoles’victoryoverChattanoogainTallahassee* Totaled8pointsandacareer-high7reboundsinFloridaState’svictoryoverSaintFrancisinTallahassee* Scored a career-high tying 9 points to go along with a career-high 5 assists in Florida State’s win over Chicago State

2018-19 Season* Averaged2.7points(11thontheteam),1.6rebounds(ninth)and0.6steals(seventh)whileplayingin30ofFlorida State’s37gamesduringitsrecord-settingandNCAATournamentseason.* Averaged 11.5 minutes played per game as one of 11 Seminoles who averaged 11 or more minutes played per game* Shot.773fromthefieldashefinishedtheseasonasoneofonlyfiveplayersontheteamtoshoot77percentorbetter from the free throw line* Ahugeliftoffofthebenchwith9points,4reboundsand3stealsinFloridaState’svictoryoverMurrayStatein the NCAA Tournament -- a win that sent the Seminoles to the Sweet 16 of the NCAA Tournament

2017-18 Season * A redshirt season as he did not play in any games for the Seminoles during the regular season* Averaged 6.0 points and 3.5 assists in Florida State’s two exhibition game victories to begin the season* Totaled 1 rebound, 1 assist and 1 steal in his career debut against George Washington on Nov. 14

9/16Anthony Polite tied his

career-high with nine points in Florida State’s victory over Murray State in the

second round of the NCAA Tournament -- a win that sent the Seminoles to the

Sweet 16

F L O R I D A S T A T E U N I V E R S I T Y

#3 Trent Forrest Guard

Trent Forrest’s Career HighsPTS ..........23vs.SoutheastMissouri(12-17-18)FGM ........8 at Pitt (11-6-19)..................8 vs. Gonzaga (3-28-19)..................8vs.SoutheastMissouri(12-17-18)..................8 vs. Boston College (3-3-18)FGA .........16 at Pitt (11-6-19)FG% .........857vs.NichollsState(12-8-16)...................857vs.DetroitMercy(11-20-16)3FGM ......2 vs. Chicago State (11-25-19)3FGA .......4vs.SoutheastMissouri(12-17-18)3FG % .....1.000 vs. Chicago State (11-25-19)..................1.000 vs. Nicholls State (12-8-16)FTM .........11 at Pitt (1-14-19)FTA ..........12 at Pitt (1-14-19)FT% ........1.000 vs. 13 Teams..................Last vs. Saint Francis (11-23-19)OR............6atDuke(2-28-17)DR ............11 vs. UAB (11-22-18)REBS .......11 vs. UAB (11-22-18)..................11 vs. Syracuse (1-13-18)AST ..........12vs.SouthernMiss(12-21-17)BLK .........2 vs. 4 teams..................Last vs. Chattanooga (11-20-19)STL ..........5 vs. Louisville (2-9-19)..................5 vs. UConn (12-8-18)MIN .........40 vs. Syracuse (1-13-18)underlined denotes career high established or tied during 2019-20 season

6-4, 210, Senior, Chipley, Fla.

2019-20 Season* On the Watch List for the Bob Cousy Award presented to the nation’s top point guard.* A pre-season All-ACC Second-Team selection by the voting media at Operation ACC Basketball.* AteamcaptainasnamedbyHeadCoachLeonardHamiltonandhisstaff.* Florida State’s undisputed team leader and starting point guard for the second consecutive season.* Scored a game-high 19 points in Florida State’s season opener at Pitt* Totaled8pointsandagame-high7reboundsinFloridaState’svictoryatNo.6FloridainGainesville* Scored 16 points to go along with 2 rebounds, 2 assists and 1 steal in Florida State’s win over Western Carolina

2018-19 Season* Averagedacareer-high9.3points(thirdontheteam),4.5rebounds(fourth),3.7assists(first)andacareer-high1.9 steals(first)asFloridaState’sstartingpointguard.* Named to the NCAA Tournament All-West Regional Tournament team in leading FSU to the NCAA Sweet 16* Career-high 23 points with 8 rebounds, 4 assists and 3 steals in Florida State’s victory over Southeast Missouri * Totaled 10 points, 6 rebounds and 3 assists in Florida State’s victory over No. 2 Virginia in the ACC Tournament* Totaled 20 points, 5 rebounds, 4 assists and 3 steals in Florida State’s Sweet 16 game against Gonzaga in the NCAA Tournament

2017-18 Season * Averaged7.9points(fifth)and3.9assists(first)asheplayedin34gameswithtwostarts* Named to the 2018 All-ACC Academic Men’s Basketball Team and the 2018 ACC Honor Roll* Career-high21pointsandfirstcareerdouble-doubleof21pointsand10reboundsagainstBostonCol.onMarch3* Totaled 16 points and 4 assists came in Florida State’s overtime win over Clemson on Feb. 14* Totaled16pointstogoalongwith7assistsand3stealsin32minutesagainstNCState* Totaled 14 points, 5 rebounds, 4 steals and 3 assists in Florida State’s victory over Xavier in the NCAA Tournament

2016-17 Season* Averaged4.9points(tiedforseventh),2.7rebounds(seventh)and1.2steals(first)asheplayedinall35games* Namedtothe2017ACCAll-AcademicMen’sBasketballTeam* Totaled his season-high of 13 points and 6 rebounds in Florida State’s victory over Nicholls State on Dec. 8* Doublefiguresforthefirsttimeinhiscareerwith10pointsand3reboundsinFloridaState’swinoverIona

On Forrest* A consensus top 50 prep player who was ranked 45th among all prep players by ESPN.com entering college with the class of 2016* Ranked as the seventh best player in the state of Florida, the 11th best shooting guard in the nation, the 48th best player in the country and was a four-star player by Sports Illustrated* Ranked as the 62nd best high school player in the nation by Scout.com* A strong athlete on the wing who is an outstanding athlete and a stellar defender

2019-20 Game-By-Game Statistics -- Trent ForrestDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 *atPittsburgh 1-1 39 8-16 .500 1-3 .333 2-3 .667 0-2 2 2 2 5 1 2 19N10 atFlorida 2-2 31 1-7 .143 1-3 333 5-6 .833 3-5 8 1 7 4 0 1 8N15 Western Carolina 3-3 32 5-14 .357 1-3 .333 5-5 1.000 1-1 2 4 2 1 0 1 16N20 Chattanooga 4-4 30 2-4 .500 0-1 .000 1-2 .500 0-4 4 1 7 4 2 1 5N23 St. Francis (Pa.) 5-5 26 3-7 .429 0-1 .000 7-7 1.000 1-4 5 1 4 3 0 2 13N25 Chicago State 6-6 15 5-8 .625 2-2 1.000 0-0 .000 0-2 2 0 6 2 0 3 12N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

3Trent Forrest became just the third player in FSU

history to be named to the NCAA All-Region Team in 2019. Phil Cofer and

Terance Mann were named to the All-West

Regional Team in 2018.

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- Patrick WilliamsDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 *atPittsburgh 1-0 27 1-5 .200 1-2 .500 2-2 1.000 0-2 2 1 0 1 1 0 5N10 at Florida 2-0 15 2-4 .500 0-1 .000 0-0 .000 1-4 5 2 0 1 3 1 4N15 Western Carolina 3-0 23 5-8 .625 1-2 .500 7-7 1.000 1-3 4 0 1 2 0 0 18N20 Chattanooga 4-0 20 6-10 .600 3-5 .600 2-2 1.000 1-2 3 0 3 0 0 1 16 N23 St. Francis (Pa.) 5-0 22 2-6 .333 0-2 .000 2-2 1.000 1-4 5 1 1 5 1 1 6N25 Chicago State 6-0 20 6-8 .750 0-1 .000 4-4 1.000 1-2 3 3 1 1 0 1 16N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Patrick Williams’ Career HighsPTS ..........18 vs. Western Carolina (11-15-19)FGM ........6 vs. Chicago State (11-25-19)..................6 vs. Chattanooga (11-20-19)FGA .........10 vs. Chattanooga (11-20-19)FG% .........750vs.ChicagoState(11-25-19)3FGM ......2 vs. Chattanooga (11-20-19)3FGA .......3 vs. Chattanooga (11-20-19)3FG % .......667 vs. Chattanooga (11-20-19)FTM .........7vs.WesternCarolina(11-15-19)FTA ..........7vs.WesternCarolina(11-15-19)FT% ........1.000 vs. Chicago State (11-25-19)..................1.000 vs. Saint Francis (11-23-19)..................1.000 vs. Chattanooga (11-20-19)..................1.000 vs. Western Carolina (11-15-19)..................1.000 at Pitt (11-6-19)OR............1 vs. Chicago State (11-25-19)..................1 vs. Chattanooga (11-20-19)..................1 vs. Western Carolina (11-15-19)..................1 at Florida (11-10-19)DR ............4 vs. Saint Francis (11-23-19)..................4 at Florida (11-10-19)REBS .......5 at Florida (11-10-19)AST ..........3 vs. Chattanooga (11-20-19)STL ..........2 vs. Chattanooga (11-20-19)BLK .........3 at Florida (11-10-19)MIN .........27atPitt(11-6-19)underlined denotes career high established or tied during 2018-19 season

6-8, 225, Freshman, Charlotte, N.C.

2019-20 * AtopcandidateforACCRookieoftheYearinhisfirstseasonasaSeminole* A silky smooth player who can play any position on the court* Totaled 5 points, 2 rebounds and 1 blocked shot in his career debut at Pitt* Totaled 4 points, 5 rebounds and a game-high tying 3 blocked shots in Florida State’s victory over No. 6 Florida* Scoredagame-hightying18pointsandwasaperfect7-7fromthefreethrowlineinFSU’swinoverW.Carolina* Totaled 16 points, 3 rebounds, 3 assists and 2 steals in Florida State’s win over Chattanooga in Tallahassee* Totaled 16 points, 3 rebounds and 1 blocked shot in Florida State’s victory over Chicago State in Tallahassee

On Williams* Afive-starplayerandaconsensustop-25recruit* ESPN ranked him as the 34th best player and the sixth best small forward in the country* TheNo.7smallforwardandthetopprospectinthestateofNorthCarolinain2019* Named to the Naismith High School Boy’s Watch List prior to the start of his freshman season* Was a guard growing up as he arrived as a freshman at West Charlotte on only 6-0* His growth spurt has allowed him to be one of the most versatile players in the incoming class.

ForwardPatrick Williams#4

1/7Patrick Williams was named as the No. 1

prospect in the state of North Carolina and the No. 7smallforwardprospectinthe nation by ESPN.com as

a high school senior.

F L O R I D A S T A T E U N I V E R S I T Y

Balsa Koprivica’s Career HighsPTS ........... 11 vs. Saint Francis (11-23-19)FGM ......... 5 vs. Saint Francis (11-23-19)...................5 vs. Chattanooga (11-20-19)FGA .......... 6 vs. Saint Francis (11-23-19)...................6 vs. Chattanooga (11-20-19)FG% ......... 1.000 vs. Western Carolina (11-15-19)3FGM .......3FGA ........3FG% .......FTM .......... 4 vs. Chicago State (11-25-19)FTA ........... 6 vs. Saint Francis (11-23-19)FT% ......... 1.000 vs. Western Carolina (11-15-19)...................1.000 at Pitt (11-6-19)OR.............3 vs. Chattanooga (11-20-19)DR .............5 vs. Chicago State (11-25-19)REBS ........7vs.ChicagoState(11-25-19)...................7vs.Chattanooga(11-20-19)AST ...........1 vs. Chattanooga (11-20-19)BLK .......... 1 vs. Chattanooga (11-20-19)...................1 vs. Western Carolina (11-15-19)STL ........... 2 vs. Saint Francis (11-23-19)MIN ..........20 vs. Saint Francis (11-15-19)underlined denotes career high established or tied during 2019-20 season

#5 Balsa Koprivica Center7-1, 260, Freshman, Belgrade, Serbia

2019-20 Season* Oneoftwo7-footersontheSeminoles’rosterwhowillearnagreatdealofplayingtime.* Totaled 4 points, 2 rebounds and 1 blocked shot in Florida State’s victory over Western Carolina* Doublefiguresscoringforthefirsttimeinhiscareerwith10pointsand7reboundsinFloridaState’swinover Chattanooga* Totaled 11 points, 3 rebounds and 2 steals in Florida Stat’s victory over Saint Francis in Tallahassee* Doublefiguresforthethirdstraightgamewith10pointsand7reboundsinFloridaState’swinoverChicagoState

On Koprivica* A consensus top-60 national recruit* Afour-starrecruitbyScout,Rivals,247SportsandESPN* TheNo.12centerandtheNo.56overallplayerinthe2019recruitingclassaccordingto247Sports* Considered to be the third best player in the talent-rich state of Florida* Has good hands, can consistently make jump shots and has strong rebounding abilities.

2019-20 Game-By-Game Statistics -- Balsa KopriviciaDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 6 0-0 .000 0-0 .000 2-2 1.000 1-1 2 5 0 1 0 0 2N10 at Florida 2-0 6 1-2 .500 0-0 .000 0-0 .000 0-0 0 3 0 0 0 0 0N15 Western Carolina 3-0 11 2-2 1.000 0-0 .000 0-0 .000 1-1 2 3 0 3 1 0 4N20 Chattanooga 4-0 12 5-6 .833 0-0 .000 0-2 .000 3-4 7 1 1 0 1 0 10N23 St. Francis (Pa.) 5-0 20 5-6 .833 0-0 .000 1-3 .222 2-1 3 0 0 0 0 1 11N25 Chicago State 6-0 18 3-4 .750 0-0 .000 4-5 .800 2-5 7 1 1 3 0 1 10N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

57-3Balsa Koprivica helped

lead Montverde Academy toa57-3record

(.950 winning percentage)in his two seasons.

F L O R I D A S T A T E U N I V E R S I T Y

ForwardMalik Osborne#106-9, 215, Redshirt Sophomore, Matteson, Ill.

2019-20* BeginsplayinhisfirstactiveseasonintheSeminoles’rosteraftersittingoutthe2018-19seasonaftertransferring to Florida State from Rice prior to the season* A starter with 2 points and a game-high 9 rebounds in Florida State’s season-opener at Pitt* Totaled 10 points, 4 rebounds and 1 steal in Florida State’s victory at No. 6 Florida in Gainesville* Totaled 6 points, 9 rebounds and 1 blocked shot in Florida State’s victory over Western Carolina* Totaled 10 points and 3 rebounds as a starter in Florida State’s victory over Chattanooga in Tallahassee

2018-19 Season * Satoutthe2018-19seasonaftertransferringfromRicewhereheplayedasafreshmanduringthe2017-18season* TraveledwiththeSeminolestoHartford,Conn.,forthefirsttworoundsofthe2019NCAATournament

2017-18 Season* Averaged9.0points(fourthontheteam),6.5rebounds(second),0.8blockedshots(first)and0.6steals(third), whileshooting.414fromthefield* Ranked third amongst his Owl teammates with 280 points* Rankedfifthontheteamwith223-pointshotsmade* Started27oftheOwls’31games

On Osborne* Graduated from Rich South High School in Illinois in 2016* Averaged10.8points,7.1reboundsand1.6blockedshotsasamemberofthevarsityteamasasenior* Led the Stars to an 18-8 record* EarnedAll-ConferenceFirstTeamandAll-AreaHonorableMentionhonorsin2017* A team leader as Rich South advanced to the second round of the state high school championship tournament* Played in 25 of the Rich South’s 26 games…

Malik Osborne’s Career HighsPTS ........... 22 vs. Marshall (2-15-18)FGM .........7atFIU(2-14-18)...................7vs.Marshall(2-15-18)FGA ..........17vs.Marshall(2-15-18)FG% ......... 1.000 vs. Chicago State (11-25-19)3FGM ....... 3 vs. 5 teams...................Last vs. Saint Francis (11-23-19)3FGA ........ 9 vs. Marshall (2-15-18)3FG% ....... .750vs.WesternKentucky(2-17-18)FTM .......... 9 vs. Charlotte (1-6-18)FTA ........... 11 vs. Charlotte (1-6-18)FT% ......... 1.000 vs. 9 Teams...................Last vs. Western Carolina (11-15-19)OR.............5vs.UNLV(11-20-17)DR ............. 10 vs. Marshall (2-15-18)REBS ........13vs.TexasSanAntonio(12-28-17)................... 13 vs. Marshall (2-15-18)AST ........... 2 vs. 6 teams...................Last at FIU (2-14-18)BLK .......... 4 at Pitt (11-6-19)STL ...........4atStephenF.Austin(12-9-17)MIN ..........36atStephenF.Austin(12-9-17)underlined denotes career high established or tied during 2019-20 season

22Malik Osborne scored his career-high of 22 points against Marshall on Feb.

15, 2018. After transferring to Florida State from Rice he has three years of eligi-

bility remaining

2019-20 Game-By-Game Statistics -- Malik OsborneDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 *atPittsburgh 1-1 23 1-4 .250 0-2 .000 0-0 .000 2-7 9 2 0 1 4 0 2N10 atFlorida 2-2 26 4-7 .571 0-0 .000 2-2 1.000 2-2 4 4 0 0 0 1 10N15 Western Carolina 3-3 15 2-2 1.000 0-0 .000 2-3 .667 4-5 9 2 1 1 1 0 6N20 Chattanooga 4-4 20 4-10 .400 1-3 .333 1-1 1.000 0-3 3 1 2 1 0 0 10N23 St. Francis (Pa.) 5-5 24 3-7 .429 3-5 .600 0-0 .000 1-3 4 2 0 1 2 0 9N25 Chicago State 6-6 15 2-2 1.000 0-0 .000 0-0 .000 2-3 5 1 1 0 0 0 4N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- Nathanael JackDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 3 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 0 0 0 0 0N10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 2-0 14 2-5 .400 2-5 .400 0-0 .000 1-4 5 1 1 1 0 1 6N23 St. Francis (Pa.) 3-0 9 1-5 .200 1-5 .200 0-0 .000 0-1 1 1 2 2 0 0 3N25 Chicago State 4-0 14 4-6 .667 4-6 .667 2-2 1.000 0-1 1 3 2 0 0 0 14N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Nathanael Jack’s Career HighsPTS ........... 14 vs. Chicago State (11-25-19)FGM ......... 4 vs. Chicago State (11-25-19)FGA .......... 6 vs. Chicago State (11-25-19)FG% ......... .667vs.ChicagoState(11-25-19)3FGM ....... 4 vs. Chicago State (11-25-19)3FGA ........ 6 vs. Chicago State (11-25-19)3FG% ....... .667vs.ChicagoState(11-25-19)FTM .......... 2 vs. Chicago State (11-25-19)FTA ........... 2 vs. Chicago State (11-25-19)FT% ......... 1.000 vs. Chicago State (11-25-19)OR............. 1 vs. Chattanooga (11-20-19)DR ............. 4 vs. Chattanooga (11-20-19)REBS ........ 5 vs. Chattanooga (11-20-19)AST ........... 2 vs. Chicago State (11-25-19)................... 2 vs. Saint Francis (11-23-19)BLK ..........STL ........... 1 vs. Chattanooga (11-20-19) MIN .......... 14 vs. Chicago State (11-25-19)................... 14 vs. Chattanooga (11-20-19)underlined denotes career high established or tied during 2019-20 season

#11 Nathanael Jack Guard

6-5, 195, Junior, Mississauga, Ontario, Canada

2019-20 Season* WillbeintheSeminoles’rotationattheguardpositioninhisfirstseasonatFloridaState.* A junior college transfer from Eastern Florida State College which is located in Cocoa, Florida* Totaled 6 points and 5 rebounds in 11 minutes of playing time in the Seminoles’ victory over Chattanooga * Career-high 14 points and 2 assists in Florida State’s victory over Chicago State in Tallahassee

At Eastern Florida State College* Graduated from Eastern Florida State College in 2019 with an Associate’s Degree in General Education.* Helped lead Eastern Florida State College to the Junior College National Championship Tournament in Hutchinson, Kan., in both of his seasons.* TheTitansfinishedasthenationalrunners-upin2018andadvancedtothequarterfinalsin2019.* Led Eastern Florida to two consecutive Mid-Florida Conference Championships in both of his years at the school.

On Jack* Was born in Canada and still considers Canada to be his home.* Chose Florida State over Kansas, Oklahoma, Texas Tech Arizona State and Miami.* Major is Social Science - with a specialization of Social Entrepreneurship and Innovation.

8Nathanael Jack made his ju-nior college career-high of eight3-pointfieldgoalsinEastern Florida State Col-lege’s victory over Chipola College during the 2018-19

season

F L O R I D A S T A T E U N I V E R S I T Y

Justin Lindner’s Career HighsPTS ........... 4 vs. Chicago State (11-25-19)FGM ......... 1 vs. Chicago State (11-25-19)FGA .......... 21vs. Chicago State (11-25-19)...................1 vs. Murray State (3-23-19)...................1vs.SouthernMiss(12-21-17)FG% .........3FGM .......3FGA ........3FG% .......FTM .......... 2 vs. Chicago State (11-25-19)...................2 at Georgia Tech (2-16-19)FTA ........... 2 vs. Chicago State (11-25-19)...................2 at Georgia Tech (2-16-19)...................2 vs. Wake Forest (2-13-19)FT% ......... 1.000 vs. Chicago State (11-25-19) ................... 1.000 at Georgia Tech (2-16-19)OR.............1 vs. Wake Forest (2-13-19)DR .............2 vs. Chicago State (11-25-19)REBS ........2 vs. Chicago State (11-25-19)AST ...........2 vs. Chattanooga (11-20-19)...................2vs.SouthernMiss(12-21-17)BLK ..........STL ........... 1 at Georgia Tech (2-16-19)MIN ..........5 vs. Chattanooga (11-20-19)underlined denotes career high established or tied during 2019-20 season

#12 Justin Lindner Guard

2019-20 Game-By-Game Statistics -- Justin LindnerDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 5 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 2 1 0 0 0N23 St. Francis (Pa.) 2-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 1 0 0 0 0 0N25 Chicago State 3-0 4 1-1 1.000 0-0 .000 2-2 1.000 0-2 2 1 0 2 0 0 4N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

6-1, 180, Redshirt Junior, Memphis, Tennessee

2019-20* One of the Seminoles’ most experienced guards who is in his fourth season as a member of the program* HashelpedtheSeminolesreachtheNCAATournamentinhisfirstthreeseasonsasaSeminole.* Joined the team as a freshman in the fall of 2016.* Career high of 5 minutes of playing time with 2 assists in Florida State’s victory over Chattanooga in Tallahassee* Firstcareerfieldgoalandcareer-high4pointsin4minutesofplayinFloridaState’svictoryoverChicagoState

2018-19 Season* Averaged0.3points,0.7reboundsand0.7assistsasheplayedinacareer-highsevengames.* A member of Florida State’s 2018 NCAA Elite Eight team who is in his third season as a member of the Seminole men’s basketball team.

2017-18 Season* Averaged0.0pointsand0.2reboundsasheplayedinfivegamesinhissecondseasonasaSeminole* Averaged 4.0 points and 1.0 rebound in Florida State’s two-game exhibition season to begin the season* EarnedplayingtimeinaregularseasongameforthefirsttimeinhiscareeragainstFordhamintheJamaicaClassic* Totaled 1 rebound in 2 minutes of playing time in Florida State’s victory over The Citadel on Nov. 24* Earned 1 minute of playing time in Florida State’s victory over Missouri in the NCAA Tournament

2016-17* BecameamemberoftheSeminolemen’sbasketballteamtobeginthe2016-17season* Practiced and traveled with the team but did not play in any games

On Lindner* Graduated from Christian Brothers School in Memphis, Tenn., in 2016* A member of the varsity at Christian Brothers High School as a sophomore, junior and as a senior* Helped Christian Brothers to a 57-3 record (.950 winning percentage) and two state championship tournament appearances during his junior and senior seasons* Averaged 11.0 points, 4.8 assists and 0.9 steals while shooting 53 percent from the field in leading Christian Brothers to a 28-2 record and to the semifinals of the state championship tournament as a junior* Earned All-Region First-Team honors and served as the team captain as a senior

57-3Justin Linder helped

Christian Brothers High School in Memphis to a 57-3recordandtwostatechampionship tournament

appearances as a junior and senior

F L O R I D A S T A T E U N I V E R S I T Y

CenterDominik Olejniczak#157-0, Graduate, Torun, Poland (Pronounced: DOM-A-Nick Ole’-knee-Chuck)

2019-20 Season (at Florida State)* PlayinghisfinalseasonofeligibilityaftertransferringtoFloridaStatefromOleMissasagraduatetransfer.* OnlythethirdgraduatetransferatFloridaStatefollowingthefootstepsofJeffPeterson(2012)andDavidNichols (2019). Both Peterson and Nichols helped lead the Seminoles to the NCAA Tournament.* ComestoFloridaStateafteroneseasonatDrake(2015-16)andtwoseasonsatOleMiss(2017-18and2018-19)* MadehisFloridaStatedebutwith2reboundsin7minutesofplayinFloridaState’swinatFloridainGainesville* Scored his Florida State high of 10 points in the Seminoles’ victory over Chattanooga in Tallahassee

2018-19 Season (At Ole Miss)* Averaged5.3points(seventhontheteam),3.0rebounds(fifth),acareer-highandteam-leading0.9blockedshots (first)andshotateamleading.575fromthefieldasheplayedinall33gamesatOleMiss.* Establishedcareer-highsforgamesplayed(33),gamesstarted(22),assists(23),blockedshots(30),steals(17),minutes played (603) and average minutes played per game (16.3).* Led the Rebels to the NCAA Tournament with a 20-13 overall record and a 10-8 record in SEC play.

2017-18 Season (At Ole Miss)* Averaged 4.3 points (eighth on the team), 2.6 rebounds (sixth) and 0.6 blocked shots (fourth) while playing in all 32 games for the Rebels.* Started11gamesfortheRebelsinhisfirstseasonofeligibilityinOxford.* Shot.531fromthefieldashecontinuedtodisplayhisfieldgoalshootingprowess.

2016-17 (at Ole Miss)* Sat out the season at Ole Miss as a redshirt due to NCAA transfer regulations…practiced but did not travel with the Rebels during the season.

2015-16 Season* Averagedacareer-high6.5points(fourthontheteam),acareer-high4.1rebounds(third)and0.7blockedshots(first) inhelpingDraketoa7-24overallrecord.* Drake is a member of the Missouri Valley Conference.* Played in 30 of the Bulldogs 31 games and averaged 16.4 minutes played per game.* Shotacareer-high.722fromthefieldandwasonly18fieldgoalsmadeshortofestablishingtheDrakeschoolrecord forbestfieldgoalpercentageinasingleseason.

On Olejniczak* OlejniczakisworkingtowardsearninghisMaster’sdegreeinInternationalAffairsatFloridaState.* Named to the National Team of Poland for competition in the FIBA World Cup of Basketball in China on August. 30, 2019.* Polandadvancedtothequarterfinalsandearnedaneighthplacestandingwitha5-3record.* Averaged 1.6 points, 1.4 rebounds and 0.2 assists as he played in six of Poland’s eight games in the tournament.

Dominik Olejniczak’s Career HighsPTS ...........19vs.Loyola(2-17-16)*FGM ......... 9 vs. Missouri State (3-3-16)*FGA ..........13atTexas(1-27-18)**................... 13 vs. Missouri State (3-3-16)*FG% ......... 1.000 vs. 13 Teams...................Last vs. Oklahoma (3-22-19)**3FGM .......3FGA ........3FG% .......FTM .......... 9 vs. Auburn (1-9-19)**FTA ........... 12 vs. Auburn (1-9-19)**FT% ......... 1.000 vs. 16 Teams...................Last vs. Chicago State (11-25-19)***OR.............6 at Auburn (1-9-19)**DR .............11 vs. Simpson College (11-13-15)*REBS ........12 vs. Simpson College (11-13-15)*AST ...........3 vs. Oklahoma (3-22-19)**BLK ..........6vs.Loyola(2-17-16)*STL ........... 3 vs. Chattanooga (12-16-18)**................... 3 at Auburn (1-9-18)**MIN ..........34vs.Loyola(2-27-16)*underlined denotes career high established or tied during 2019-20 season* - Denotes at Drake (2015-16)**-DenotesatOleMiss(2017-18,2018-19)*** - Denotes at Florida State (2019-20)

8Dominik Olejniczak helped lead Poland to an 8th place finishinthe2019FIBA

World Championships. It washisfirsttimeplaying

his national team from Po-land in competition

2019-20 Game-By-Game Statistics -- Dominik OlejniczakDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 atFlorida 1-0 7 0-1 .000 0-1 .000 0-0 .000 1-1 2 2 0 0 0 0 0N15 Western Carolina 2-0 4 0-0 .000 0-0 .000 0-0 .000 0-0 0 2 0 0 0 0 0N20 Chattanooga 3-0 8 5-6 .833 0-0 .000 0-0 .000 2-1 3 1 0 0 0 0 10N23 St. Francis (Pa.) 4-1 13 1-3 .333 0-0 .000 2-2 1.000 4-0 4 2 0 2 1 0 4N25 Chicago State 5-2 16 3-4 .750 0-0 .000 2-2 1.000 1-3 4 2 0 2 2 0 8N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

F L O R I D A S T A T E U N I V E R S I T Y

#20 Travis Light Guard

Travis Light’s Career HighsPTS ...........6vs.SouthernMiss(12-21-17)FGM .........2vs.SouthernMiss(12-21-17)FGA ..........3vs.SouthernMiss(12-21-17)FG% ......... .667vs.SouthernMiss(12-21-17)3FGM .......2vs.SouthernMiss(12-21-17)3FGA ........3vs.SouthernMiss(12-21-17)3FG% ....... .667vs.SouthernMiss(12-21-17)FTM ..........FTA ...........FT% .........OR.............DR .............1vs.TheCitadel(11-24-17)REBS ........1vs.TheCitadel(11-24-17)AST ...........BLK ..........STL ...........MIN ..........4 vs. Chicago State (11-25-19)underlined denotes career high established or tied during 2019-20 season

10.4Travis Light averaged 10.4 points in his only season at IMG Academy during the

2015-16 season

6-5, 175, Redshirt Junior, Vienna, Va.

2019-20 Season* In his fourth season as a member of the Seminole men’s basketball team and at the beginning of the 2019-20 season * Has two years of eligibility remaining* AmemberofthreeNCAATournamentteams–thesecondroundin2017,theEliteEightin2018andtheSweet16 in 2019* Has played in three NCAA Tournament games in his career — two in 2018 (against Missouri and Gonzaga) and one in 2019 (against Murray State)* Made his 2019-20 debut with 3 points in 3 minutes of playing time in Florida State’s victory over Chattanooga

2018-19 Season* Averaged 0.0 points, 0.0 rebounds and 0.2 steals while playing a career-high six games as he helped Florida State reach the NCAA Tournament for the third time in his career.* The Seminoles advanced to the Sweet 16 of the NCAA Tournament for the third time in his career.

2017-18 Season* Averaged1.2pointsand0.2reboundsasheplayedinacareer-highfivegames* Averaged1.5pointsasheearnedplayingtimeinbothofFloridaState’sexhibitiongamesin2017-18* EarnedplayingtimeinaregularseasongameforthefirsttimeinhiscareeragainstFordhamintheJamaicaClassic* Career-highsixpoints--thefirstpointsofhiscareer--inFloridaState’svictoryoverSouthernMiss

2016-17 Season * A redshirt season* Practiced and traveled with the team throughout the year* One of the Seminoles’ top practice players who often emulates the opponent’s best shooter in practice* Helped Florida State to a 26-9 overall record and a 12-6 record in ACC play* TheSeminoles’12-6overallrecordallowedthemtofinishinsecondplaceintheACCstandingsandtiedtheschool record for ACC wins in a single season

On Travis Light* Averaged 10.4 points, 3.6 rebounds and 2.3 assists in 18 games played at IMG Academy in 2016* Graduated from Montverde Academy in 2015* Was a member of the Eagles’ prep team coached by former North Carolina shooting guard Dante Calabria…

2019-20 Game-By-Game Statistics -- Travis LightDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 3 1-1 1.000 1-1 1.000 0-0 .000 0-0 0 0 0 0 0 0 3N23 St. Francis (Pa.) 2-0 1 0-1 .000 0-1 .000 0-0 .000 0-0 0 0 0 0 0 0 0N25 Chicago State 3-0 4 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

F L O R I D A S T A T E U N I V E R S I T Y

GuardM.J. Walker#23

M.J. Walker’s Career HighsPTS ........... 24 at Virginia Tech (1-20-18)FGM ......... 8 vs. LSU (11-23-18)...................8 at Virginia Tech (1-20-18)FGA .......... 16 vs. LSU (11-23-18)FG% ......... .800vs.GeorgeWashington(11-14-17)3FGM .......6atMiami(1-27-19)3FGA ........ 9 vs. LSU (11-23-18)...................9vs.SouthernMiss(12-21-17)3FG% ....... .857atMiami(1-27-19)FTM ..........7vs.Pitt(2-18-18)FTA ........... 8 vs. Pitt (2-18-18)FT% .........1.000vs.17Teams...................Last at Pitt (11-6-19)OR.............3 vs. Canisius (11-19-18)DR .............6 at Virginia Tech (1-20-18)REBS ........6 vs. Murray State (3-23-19)...................6 at Virginia Tech (1-20-18)AST ...........5atMiami(1-27-19)...................5 vs. Duke (1-12-19)STL ........... 3 vs. LSU (11-23-18)...................3 vs. Michigan (3-24-18)BLK .......... 2 at Boston College (1-20-19)MIN ..........42 vs. LSU (11-23-18)underlined denotes career high established or tied during 2018-19 season

6-5, 213, Junior, Jonesboro, Ga.

2019-20* AteamcaptainasnamedbyHeadCoachLeonardHamiltonandhisstaff.* A starter in the Seminoles’ backcourt for the second consecutive season* A member of two NCAA Tournament teams -- the Elite Eight in 2018 and the Sweet 16 in 2019* Totaled 12 points, 3 rebounds, 1 assist and 1 steal in Florida State’s victory over No. 6 Florida in Gainesville* Totaled18points(17inthesecondhalf)alongwith4reboundsand2assistsinFloridaState’swinoverW.Carolina

2018-19 Season* Averagedacareer-high7.5points(fourthontheteam),acareer-high2.2rebounds(seventh),acareer-high1.6assists (fourth) and a career-high 0.8 steals (second) while making a career-high 44 3-point shots (second)* Shotacareer-high.759fromthefreethrowlineandmadeacareer-high49freethrows* HelpedleadtheSeminolestoa29-8overallrecord,a13-3markintheACC,toafourthplacefinishintheACCstand ings, Florida State’s appearance in the ACC Tournament Championship for the third time in school history and to the Sweet 16 of the NCAA Tournament for the second consecutive season

2017-18 Season* Averaged7.0points(seventh)and1.7rebounds(ninth)whilemaking413-pointshots(fourth)in35games* Career-high24pointson8madefieldgoalsand4made3-pointfieldgoalsinFloridaState’swinoverVirginiaTech* Totaled14pointsinhisfirstcareerstartinFloridaState’s88-75victoryoverPittinTallahasseeonFeb.18* Totaled 12 points, 3 rebounds and 2 assists in his career debut against George Washington on Nov. 14* Scored 15 points to go along with 2 assists and 1 steal in Florida State’s victory over Southern Miss on Dec. 21* Scoredateam-high22pointson5made3-pointfieldgoalsinFloridaState’svictoryoverColoradoState

On Walker* GraduatedfromJonesboroHighSchoolin2017* Namedthe6APlayeroftheYearintheStateofGeorgiabytheAtlantaJournal-Constitutionasheaveraged27.8 points, 6.5 rebounds and 2.4 assists as a senior* Led Jonesboro to a 23-6 overall record as a senior* Named to the USA Today All-USA Second-Team in 2016

3M.J. Walker received three scholarshipofferstoplay

football at Clemson, Miami (Fla.) and Michigan. He

was a free safety and a wide receiver as a high school

football star

2019-20 Game-By-Game Statistics -- M.J. WalkerDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-1 16 0-4 .000 0-2 .000 4-4 1.000 0-5 5 4 0 0 0 0 4N10 at Florida 2-2 32 3-10 .300 1-5 .200 5-6 .833 0-3 3 1 1 2 1 1 12N15 Western Carolina 3-3 26 5-11 .455 3-6 .500 5-7 .714 0-4 4 3 2 1 1 0 18N20 Chattanooga DNPN23 St. Francis (Pa.) DNPN25 Chicago State DNPN29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

F L O R I D A S T A T E U N I V E R S I T Y

#24 Devin Vassell Guard/ Forward

Devin Vassell’s Career HighsPTS ..........17vs.Chattanooga(11-20-19)FGM ........6 vs. 4 teams..................Last vs. Chicago State (11-25-19)FGA .........15 at Florida (11-10-19)FG% .........857vs.ChicagoState(11-25-19)...................857atPitt(11-6-19)3FGM ......4 vs. Virginia Tech (3-14-19)3FGA .......7vs.VirginiaTech(3-14-19)3FG% ......1.000 at Pitt (11-6-19)..................1.000 vs. Notre Dame (2-15-19)..................1.000 vs. UAB (11-22-18)FTM .........4 at Virginia (1-5-19)..................4vs.SoutheastMissouri(12-17-18)FTA ..........6 at Virginia (1-5-19)..................6vs.SoutheastMissouri(12-17-18)FT% ........1.000 vs. 4 teams..................Last vs. Chattanooga (11-20-19)OR............5 vs. Chattanooga (11-20-19)DR ............6 vs. Duke (3-16-19)..................6 vs. Notre Dame (2-15-19)REBS .......8 vs. Chattanooga (11-20-19)AST ..........3 vs. North Florida (12-19-18)BLK .........2 vs. Chattanooga (11-20-19)..................2 vs. Duke (3-16-19)STL ..........3 vs. Chicago State (11-25-19)..................3 vs. Canisius (11-19-18)MIN .........34 at Florida (11-101-19)underlined denotes career high established or tied during the 2019-20 season

4Devin Vassell made a

career-high43-pointfieldgoals against Virginia Tech inthequarterfinalsofthe2019 ACC Tournament

-- including one that tied the game with 4 seconds remaing in regulation.

6-6, 180, Sophomore, Suwanee, Ga. (Pronounced Dev-In Va-Sell)

2019-20 Season* One of the Seminoles’ toughest defenders who utilizes his athleticism and incredible wingspan to lockdown some of the top players in the nation.* Takes advantage of his incredible wing-span (measured at 6-9 1/4), his height (6-5) and his leaping ability on bothoffenseanddefense.* Totaled 14 points, 2 rebounds and 1 assist in Florida State’s season opener at Pitt* Scored 13 points, pulled down 6 rebounds and added 2 steals in Florida State’s victory over No. 6 Florida* Totaled 10 points, 5 rebounds and 2 assists in Florida State’s victory over Western Carolina

2018-19 Season* Averaged4.5points(ninthontheteam)and1.5rebounds(10th)whileplayingin33ofFloridaState’s37games.* Averaged10.7minutesplayedpergameinleadingtheSeminolestotheSweet16oftheNCAATournamentinhis firstseasonasaSeminole* Shotateam-leading.419fromthe3-pointline–hefinishedastheonlySeminoletoshoot40percentorbetterfrom the 3-point line -- led the ACC’s freshmen with his .419 3-point shooting percentage – he was one of only two fresh men in the ACC (also Isaiah Wilkins of Virginia Tech) to shoot 40 percent or better from the 3-point line with 50 or more attempts during the 2018-19 season. * Career-high 16 points, 4 rebounds, 1 assist and 1 steal in Florida State’s 85-68 win over Southeast Missouri

On Vassell * Florida State’s lone scholarship freshman in the 2018 recruiting class* AneffectiverebounderanddefenderwhofitsintoFloridaState’steamdefensivephilosophywell* A talented scorer who can shoot well from long range and who has the athleticism to drive to the basket* Saidtohaveafeatherytouchfromtheoutsideandtheabilitytooperatewellintraffic* Has explosive athleticism, a high basketball IQ and relentless energy on the court

2019-20 Game-By-Game Statistics -- Devin VassellDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 *atPittsburgh 1-1 21 6-7 .857 2-2 1.000 0-0 .000 2-0 2 2 1 1 0 0 14N10 at Florida 2-2 34 6-15 .400 1-3 .333 0-1 .000 2-4 6 1 0 0 1 2 13N15 Western Carolina 3-3 32 4-9 .444 0-3 .000 2-4 .500 1-4 5 2 2 1 1 0 10N20 Chattanooga 4-4 26 6-10 .600 3-5 .600 2-2 1.000 3-5 8 1 1 1 2 1 17N23 St. Francis (Pa.) 5-5 17 2-4 .500 0-0 .000 0-0 .000 0-1 1 4 1 0 0 1 4N25 Chicago State 6-6 13 6-7 .857 1-2 .500 3-4 .750 2-0 2 0 1 1 0 3 16N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

F L O R I D A S T A T E U N I V E R S I T Y

#30 Harrison Prieto Forward

Harrison Prieto’s Career HighsPTS ..........2 vs. Chattanooga (11-20-19)..................2 vs. Murray State (3-23-19)..................2 at Georgia Tech (2-16-19)..................2 vs. Wake Forest (2-13-19)..................2 at Syracuse (2-5-19)..................2vs.SouthernMiss(12-21-17)FGM ........1 vs. Chattanooga (11-20-19)..................1 vs. Murray State (3-23-19)..................1 at Georgia Tech (2-16-19)..................1 vs. Wake Forest (2-13-19)..................1 at Syracuse (2-5-19)..................1vs.SouthernMiss(12-21-17)FGA .........2 vs. Saint Francis (11-23-19)..................2 vs. Murray State (3-23-19)..................2 at Georgia Tech (2-16-19)..................2vs.SouthernMiss(12-21-17)FG% .........500vs.SouthernMiss(12-21-17)FTM .........FTA ..........2 vs. Chicago State (11-25-19)FT% ........OR............2 vs. Murray State (3-23-19)DR ............2 vs. Murray State (3-23-19)..................2 vs. Wake Forest (2-13-19)REBS .......4 vs. Murray State (3-23-19)AST ..........1vs.SouthernMiss(12-21-17)BLK .........STL ..........MIN .........6 vs. Chicago State (11-25-19)underlined denotes career high established or tied during 2019-20 season

206Harrison Prieto blocked 206

shots during his four-year varsity career at St. Paul’s High School in Covington,

La.

2019-20 Game-By-Game Statistics -- Harrison PrietoDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 5 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 0 0 0 0 0N10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 2-0 3 1-1 1.000 0-0 .000 0-0 .000 0-1 1 0 0 0 0 0 2N23 St. Francis (Pa.) 3-0 2 0-2 .000 0-1 .000 0-0 .000 0-0 0 1 0 0 0 0 0N25 Chicago State 4-0 6 0-0 .000 0-0 .000 0-2 .000 1-1 2 1 0 0 0 0 0N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

6-8, 230, Redshirt-Junior, Mandeville, La.

2019-20 Season* AteamcaptainasnamedbyHeadCoachLeonardHamiltonandhisstaff.* Continues to earn an expanded role as a member of the Seminoles’ frontcourt rotation as he has developed into a valuable reserve for the Seminoles.* His growing importance to the Seminoles was evident during the 2018-19 season as he played in a career-high nine games,acareer-highfiveACCgamesandinFloridaState’svictoryoverMurrayStateintheNCAATournament.

2018-19 Season* Averaged0.9pointsand0.9reboundsandshot.667fromthefieldwhileplayinginacareer-highninegames.* Tiedhiscareer-highwithtwopointsinfourdifferentgamesasaredshirtsophomore–atSyracuse,againstWakeForest at home, at Georgia Tech and against Murray State in the NCAA Tournament.* A happy homecoming with 1 rebound in 4 minutes of play in Florida State’s victory over Tulane in New Orleans* First career ACC basket in Florida State’s victory over Syracuse in the Carrier Dome.* Totaled 2 points and a career-high 4 rebounds in Florida State’s 90-62 win over Murray State in the ACC Tournament.

2017-18* Averaged1.0pointand0.0reboundsintwogamesplayedduringthe2017-18season.* EarnedplayingtimeforthefirsttimeinhiscareerinFloridaState’svictoryoverTheCitadelonNov.24.* Totaled 2 points in 3 minutes of playing time in Florida State’s victory over Southern Miss on Dec. 21.

2016-17 Season* Practiced and traveled with the team throughout the year.* One of the Seminoles’ top practice players who often emulates the opponent’s best shooter in practice.* Helped Florida State to a 26-9 overall record and a 12-6 record in ACC play.

On Prieto* Graduated from St. Paul’s School in Covington, La., in 2016.* Totaled1,178careerpoints,736careerreboundsand206careerblockedshotsasafour-yearmemberofthe St. Paul’s varsity.* Team captain and St. Paul’s Player of the Year as a senior.* Earned the Jimmy Dunn award in 2016 as Most Outstanding Athlete.

F L O R I D A S T A T E U N I V E R S I T Y

#31 Wyatt Wilkes

Wyatt Wilkes’ Career HighsPTS ........... 14 vs. Saint Francis (11-23-19)FGM ......... 5 vs. Saint Francis (11-23-19)FGA ..........7vs.ChicagoState(11-25-19)...................7vs.SaintFrancis(11-23-19)FG% ......... 1.000 vs. Canisius (11-19-18)...................1.000vs.GeorgeWashington(11-14-17)3FGM ....... 3 vs. Saint Francis (11-23-19)3FGA ........7vs.ChicagoState(11-25-19)3FG% ....... 1.000 vs. Canisius (11-19-18)FTM .......... 2 vs. Chicago State (11-25-19)...................2 at Virginia (1-5-19)FTA ........... 3 at Virginia (1-5-19)FT% ......... 1.000 vs. Chicago State (11-25-19)OR.............1 vs. 10 Teams ...................Last vs. Chicago State (11-25-19)DR .............3vs.TheCitadel(11-24-17)REBS ........4vs.TheCitadel(11-24-17)AST ...........2 vs. Chicago State (11-25-19)...................2vs.Loyola(Md.)(12-6-17)BLK .......... 1 vs. Murray State (3-23-19)...................1vs.SouthernMiss(12-21-17)...................1vs.TheCitadel(11-24-17)STL ........... 1 vs. 6 teams...................Last vs. Chicago State (11-25-19)MIN ..........18 vs. Chicago State (11-25-19)underlined denotes career high established or tied during 2019-20 season

6-8, 220, Redshirt Sophomore, Orlando, Fla.

2019-20 Season* One of the Seminoles’ hardest workers who has been a member of two NCAA Tournament teams.* Helped the Seminoles to the Elite Eight of the 2018 NCAA Tournament and to the Sweet 16 of the 2019 NCAA Tournament.* HashelpedFloridaStatetoanaverageof26winsinthefirsttwoseasonsofhiscareer.* Astarterforthefirsttimewith5pointsand2reboundsinFloridaState’svictoryoverChattanooga* A career-high 14 points and 2 rebounds in a career-high 16 minutes of play in Florida State’s win over Saint Francis* Totaled 8 points, 3 rebounds and 2 assists in Florida State’s victory over Chicago State in Tallahassee

2018-19 Season* Averaged1.5pointsand0.7reboundsasheplayedinacareer-high15gamesasaredshirtfreshman.* Earned increased throughout the season as compared to his freshman season when he played in only six game.* FloridaStatefinishedhissecondseasonwitha29-8overallrecord,a13-5ACCrecord,afourthplacefinishinthe ACC standings and an appearance in the Sweet 16 of the NCAA Tournament.

2017-18 Season* A redshirt season after an ankle injury limited him to just six games during his true freshman season.* Averaged0.7pointsand1.5reboundswhileappearinginsixgamesduringhisfirstseasonasaSeminole.* Totaled 2 points in his career debut against George Washington on Nov. 14.* Totaled 4 rebounds and 1 blocked shot in 8 minutes of play in Florida State’s victory over The Citadel on Nov. 24.

On Wilkes* GraduatedfromWinterParkHighSchoolin2017.* Earned All-State Class 8A Second Team honors as a senior.* All-Area First Team selection in 2015 and 2016 by the Orlando Sentinel.* Averaged17.4points,9.5reboundsand4.5assistspergameinhisseniorseason. 1,474

WyattWilkesscored1,474career points, was a

member of the Winter Park varsity for four seasons and averagedindoublefigurescoring in three of his four

seasons on the varsity

Forward

2019-20 Game-By-Game Statistics -- Wyatt WilkesDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 8 0-1 .000 0-1 .000 0-0 .000 1-1 2 0 1 0 0 1 0N10 at Florida 2-0 6 0-1 000 0-1 .000 0-0 .000 0-0 0 1 1 0 0 0 0N15 Western Carolina 3-0 2 0-1 .000 0-1 .000 0-0 .000 0-0 0 1 0 0 0 0 0N20 Chattanooga 4-1 15 2-5 .400 1-4 .250 0-0 .000 1-1 2 0 0 1 0 1 5N23 St. Francis (Pa.) 5-1 16 5-7 .714 3-5 .600 1-1 1.000 1-1 2 1 0 1 0 0 14N25 Chicago State 6-1 18 2-7 .286 2-7 .286 2-2 1.000 1-2 3 2 2 0 1 1 8N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

F L O R I D A S T A T E U N I V E R S I T Y

Will Miles’ Career HighsPTS ..........2 vs. Saint Francis (11-23-19)FGM ........1 vs. Saint Francis (11-23-19)FGA .........2 vs. Chattanooga (11-20-19)..................2 vs. Murray State (3-23-19)FG% ........1.000 vs. Saint Francis (11-23-19)3FGM ......3FGA .......1 vs. Murray State (3-23-19)..................1vs.SouthernMiss(12-21-17)..................1vs.TheCitadel(11-24-17)3FG% ......FTM .........1 vs. Wake Forest (2-13-19)FTA ..........2 vs. Wake Forest (2-13-19)FT% .........500 vs. Wake Forest (2-13-19)OR............1 vs. Saint Francis (11-23-19)DR ............1 at Georgia Tech (2-16-19)..................1vs.SouthernMiss(12-21-17)REBS .......1 vs. Saint Francis (11-23-19)..................1 at Georgia Tech (2-16-19)..................1vs.SouthernMiss(12-21-17)ASTS........1 vs. Chattanooga (11-20-19)STL ..........1 vs. Wake Forest (2-13-19)MIN .........4 vs. Chicago State (11-25-19)underlined denotes career high established or tied during 2019-20 season

13.7WillMilesaveraged13.7points in 30 games as a

senior at Trinity Prep as a senior in 2016. He led the Saints to a 24-6 record and

to the Class 4A regional finals

6-6, 220, Redshirt Junior, Orlando, Fla.

2019-20* AmemberofthreeNCAATournamentteamsinhisfirstthreeseasonsasamemberofthemen’sbasketballteamat Florida State.* Helped the Seminoles to the Elite Eight of the 2018 NCAA Tournament, the Sweet 16 of the 2019 NCAA Tournament andtotheSecondRoundofthe2017NCAATournament.* In his third season as a member of the basketball team at Florida State.* Missedhisentirefirstseason(2017-18)withabackinjury.* Made his 2019-20 debut with 1 assist in 3 minutes played in Florida State’s victory over Chattanooga

2018-19 Season* Averaged 0.2 points and 0.2 rebounds as he played in a career-high six games in his third season as a member of the Florida State Men’s Basketball team.* Playedinacareer-highsixgamesandscoredthefirstpointofhiscareerasaredshirtsophomore.* Played in a career-high three ACC games.* Earned 2 minutes of playing time in Florida State’s 90-62 win over Murray State in the NCAA Tournament.

2017-18 Season* Averaged0.0pointsand0.3reboundsinthreegamesduringthe2017-18season.* Averaged2.0pointsasheearnedplayingtimeinbothoftheSeminoles’exhibitiongamestobeginthe2017-18season.* EarnedplayingtimeinaregularseasongameforthefirsttimeinhiscareeragainstFordhamintheJamaicaClassic.

2016-17 Season* JoinedtheSeminolemen’sbasketballteamforthe2016-17season.* Aredshirtseasonin2016-17.

On Will Miles* A third generation family member who is the fourth member of his family to play basketball at Florida State.* His father, an uncle and his grandfather all played basketball at Florida State.

Guard#33 Will Miles

2019-20 Game-By-Game Statistics -- Will MilesDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 3 0-2 .000 0-0 .000 0-0 .000 0-0 0 0 1 0 0 0 0N23 St. Francis (Pa.) 2-0 1 1-1 1.000 0-0 .000 0-0 .000 1-0 1 0 0 0 0 0 2N25 Chicago State 3-0 4 0-0 .000 0-0 .000 0-0 .000 0-0 0 2 0 1 0 0 0N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

F L O R I D A S T A T E U N I V E R S I T Y

Cleveland Yates

2019-20 Game-By-Game Statistics -- Cleveland YatesDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N23 St. Francis (Pa.) 2-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N25 Chicago State 3-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Cleveland Yates’ Career HighsPTS ...........FGM .........FGA ..........FG% .........3FGM .......3FGA ........3FG% .......FTM ..........FTA ...........FT% .........OR.............DR .............REBS ........AST ...........BLK ..........STL ...........MIN ..........1 vs. Chicago State (11-25-19)................... 1 vs. Saint Francis (11-23-19)...................1 vs. Chattanooga (11-20-19)underlined denotes career high established or tied during 2019-20

#42 Guard6-2, 214, Freshman, Memphis, Tenn.

2019-20* Joined the team in the fall of 2019* Made his collegiate debut in Florida State’s victory over Chattanooga on Nov. 20

On Cleveland Yates* Began playing basketball in the second grade…played for M33M and Mike Miller in AAU Basketball* Has been nationally recognized for his leadership and community service* Was chosen by the National Civil Rights Museum to Co-Host the Freedom Award Student Forum honoring former Vice President Joe Biden, Rev. Jesse Jackson and Philanthropist Pitt Hyde in 2018* Cleveland and his parents launched the Kidz Do Pozitive Thingz TV Show when he was only nine years old. He served as host, musician and producer

2019Cleveland Yates led BriarcliffAcademyto

the Tennessee State High School Championship in

2019

F L O R I D A S T A T E U N I V E R S I T Y

Ty Hands’ Career HighsPTS ...........FGM .........FGA ..........FG% .........3FGM .......3FGA ........3FG% .......FTM ..........FTA ...........FT% .........OR.............DR .............REBS ........AST ...........BLK ..........STL ...........MIN ..........underlined denotes career high established or tied during 2019-20 season

6-5, 180, Redshirt-Freshman, Palm Beach Lakes, Fla.

2019-20 Season* In his second season as a member of the Seminole men’s basketball team.* Hasfouryearsofeligibilityremainingbeginningwiththe2019-20seasonaftersufferingakneeinjurypriortothestart of the 2019-20 season.* Because of the injury, he took a redshirt season and has worked to get himself back into the Seminoles’ rotation for his second season at Florida State.* A member of the Seminoles’ NCAA Tournament Sweet 16 Team in 2019.

2018-19 Season* A redshirt season after undergoing surgery for a torn ACL in his right knee.* Underwent successful surgery on August 22, 2018.* Traveled to many of Florida State’s games and practiced with the team while rehabilitating his knee.

On Hands* Ty and his younger brother, Tre, are the sons of two FSU alum, Tera and Lorenzo Hands, a former Seminole star and four-year letterman at Florida State from 1988 to 1993.* Lorenzo was a member of four NCAA Tournament teams including Florida State’s 1993 Elite Eight team.* Afour-yearlettermanofthevarsitybasketballandtrackandfieldteamsatPalmBeachLakes.* Served as the team captain during his junior and senior seasons.* A member of the Palm Beach County Fab Five Team as a senior.

2019-20 Game-By-Game Statistics -- Ty HandsDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga DNPN23 St. Francis (Pa.) DNPN25 Chicago State DNPN29 vs. Tennessee N30 vs. Purdue/VCU D3 at Indiana D8 * Clemson D17 North Florida D21 vs. USF D28 North Alabama D31 * Georgia Tech J4 * at Louisville J8 * at Wake Forest J15 * Virginia J18 * at Miami J25 * Notre Dame J28 * at Virginia F1 * at Virginia Tech F3 * North Carolina F8 * Miami F10 * at Duke F15 * Syracuse F18 * Pittsburgh F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Ty Hands#44 Guard

14.7/5.4TyHandsaveraged4.7

points and 5.4 rbounds as a senior captain at Palm

Beach Lakes High School duringthe2017-18season

Exhibition 1 -- Florida State 95,Barry 66

TALLAHASSEE, Fla. – Florida State’s exhibition opener provided a glimpse of what lies ahead for the Seminoles – both in the upcoming season and beyond. It also showed coach Leonard Hamilton a few things he’d like for his team to tighten up between now and the Seminoles’ season opener on November 6. So, in that sense, it was a near-perfect evening for FSU, which got 19 points and five assists from senior Trent Forrest in a 95-66 victory over Barry University at the Donald L. Tucker Center. Forrest, the central figure for an FSU team that lost its top two scorers from a year ago, was one of six Seminoles to finish in double-figures. Anthony Polite added 18 – including 16 in the second half – while RaiQuan Gray (10 points) and newcomers Patrick Williams (12, nine rebounds), Nathanael Jack (10), Dominik Olejniczak (10 points, seven rebounds) and Malik Osborne (seven points, seven boards) all enjoyed productive outings.

Florida State 95, Barry University 66Donald L. Tucker Center

Oct. 22, 2019Barry Min FG 3FG FT O-D Reb F A T B S Pts.Walshe 21 0-3 0-2 6-8 0-1 1 2 0 1 0 0 6Moya 17 2-7 1-5 0-1 0-3 3 1 2 3 0 1 5Birts 20 1-4 1-1 4-4 3-2 5 2 0 4 1 1 7Allende 17 0-5 0-3 0-0 0-2 2 1 1 0 0 0 0Dolven 24 1-4 0-0 1-3 2-3 5 4 1 2 0 0 3Perez 21 4-8 0-1 0-0 0-0 0 4 1 2 0 2 8Sheffield 7 2-3 2-2 0-0 1-2 3 0 2 0 0 0 6Marcinekvisius 3 0-0 0-0 01 0-1 0 0 0 0 0 0 0Kakar 18 4-8 2-4 2-2 2-1 3 1 0 4 0 0 12Scerbinskis 26 4-7 4-5 2-3 1-1 2 2 0 1 1 1 14Mikyska 9 0-0 0-0 0-0 1-0 1 2 0 2 0 0 0Dean 9 0-6 0-0 0-0 0-1 1 1 1 3 0 1 0Mejia 8 1-5 1-4 2-2 0-0 0 1 0 0 0 0 5Team 0-4 4 Totals 200 19-60 11-27 17-24 10-20 30 21 8 22 2 6 66

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 26 4-6 2-3 0-1 0-4 4 2 4 4 0 4 10Polite 22 7-9 3-4 1-1 0-2 2 3 0 0 1 3 18Forrest 21 7-10 0-1 5-6 1-2 3 1 5 3 1 1 19Williams 18 5-10 0-3 2-2 1-8 9 2 0 3 1 0 12Olejniczak 16 5-5 0-0 0-0 2-3 5 1 0 2 0 0 10Osborne 26 2-8 0-3 3-4 4-3 7 3 0 2 2 1 7Jack 24 3-12 3-13 1-2 4-3 7 4 0 1 0 0 10Lindner 16 0-0 0-0 0-2 0-1 1 2 3 2 0 0 0Prieto 5 0-1 0-0 1-2 1-0 1 1 0 2 0 0 1Wilkes 18 3-9 2-7 0-0 2-4 6 2 0 1 0 0 8Light 3 0-0 0-0 0-0 0-0 0 0 0 1 0 0 0Miles 5 0-0 0-0 0-0 1-2 3 2 0 0 0 0 0Team 0-3 3 Totals 200 36-70 10-31 13-20 16-35 51 23 12 22 5 9 95 FG% - Barry, .317, Florida State, .514. 3FG% - Barry, .407, Florida State, .323. FT% - Barry, .708. Florida State, .650. Technical Fouls: Barry -- None. Florida State -- None. Referees - Ray Styons, Les Jones, Anthony Burris

Barry 21 45 - 66Florida State 27 58 - 95

Exhibition 2 -- Florida State 84, Columbus State 54

TALLAHASSEE, Fla. – - In its final exhibition game before regular season play begins at Pittsburgh, Florida State earned an 84-54 victory over Columbus State at the Donald L. Tucker Civic Center. Sophomore Devin Vassell led three Seminoles in double figures with 18 points. Also in double figures were Anthony Polite with 16 points and freshman Patrick Williams with 10. The game saw some familiar faces returning to the court after missing Florida State’s exhibition victory over Barry. Both M.J. Walker and Devin Vassell made their highly anticipated season debuts and came back with a vengeance. Walker, who started and played nine first half minutes, totaled six points on two made 3-point shots. Vassell totaled 18 points (three-of-three three-pointers) and finished with six rebounds.

Florida State 84, Columbus StateDonald L. Tucker Center

Nov. 1, 2019Columbus Min FG 3FG FT O-D Reb F A T B S Pts.Thomas 19 0-5 0-3 0-0 0-1 1 1 1 2 0 2 0Givens 21 6-12 2-7 2-3 0-1 1 0 1 7 0 1 16Taylor 21 2-7 0-4 0-0 0-1 1 1 2 1 0 0 4Paulding 23 0-1 0-0 0-2 0-3 3 0 0 0 3 0 0Moore 24 2-3 0-0 2-4 0-2 2 0 1 1 0 3 6Horton, L 26 5-13 1-6 4-2 1-2 3 2 2 3 0 0 15Preston 16 2-3 0-0 1-0 1-4 5 1 1 0 0 0 5Porter-Wilson 14 1-3 0-0 0-0 1-1 2 2 2 0 0 0 2Horton, C. 8 1-3 1-3 0-0 0-0 0 2 0 0 0 0 3David, Jr. 6 0-3 0-2 0-0 0-1 1 0 0 2 0 0 0Ivey 4 1-2 1-2 0-0 0-0 0 1 0 0 0 0 3Jedenski 4 0-1 0-1 0-0 0-0 0 0 0 0 0 0 0Jones 2 0-0 0-0 0-0 0-0 0 0 0 1 0 0 0Kemp 2 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Gaines 2 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 0-0 2 Totals 200 20-56 5-28 9-13 3-18 21 10 10 17 3 6 54

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 20 1-4 0-0 2-2 2-6 7 0 3 3 0 3 4Forrest 28 1-5 0-2 0-0 0-3 3 2 7 2 0 2 2Osborne 20 3-11 0-0 1-1 2-6 10 0 0 1 0 0 7Walker 10 2-6 2-6 0-0 1-0 1 2 0 2 0 0 6Vassell 23 7-9 3-3 1-1 1-5 6 2 0 2 2 0 18Williams 23 5-11 0-2 0-0 3-1 4 1 1 3 0 1 10Koprivica 19 4-5 0-0 0-0 5-6 11 3 1 2 0 0 8Polite 25 5-9 2-4 4-4 0-1 1 2 2 2 0 3 16Jack 15 2-8 1-6 0-0 1-0 1 0 3 2 0 1 5Wilkes 14 2-5 1-3 1-2 4-2 6 0 1 0 0 1 6Lindner 2 1-1 0-0 0-0 0-0 0 0 0 0 0 0 2Light 2 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Prieto 2 0-0 0-0 0-0 0-1 1 0 0 1 0 0 0Team 2-3 5 Totals 200 33-74 9-26 9-10 22-34 56 12 18 20 2 11 84

FG% - Columbis Sate, .357, Florida State, .446. 3FG% - Columbus State, .179, Florida State, .346. FT% - Collumbus State, .692. Florida State, .900. Technical Fouls: Columbus State -- None. Florida State -- None. Referees - Leee Cassell, Jemel Spearman, Kellen Milner

Columbus State 29 55 - 54Florida State 41 43 - 84

Game 1 -- Pitt 63, Florida State 61

PITTSBURGH, Pa. – Reserves Ryan Murphy and TerrellBrown scored 13 points to lead Pitt to a 63-61 win over FloridaState in the season opener for both tems. The Panthers wondespite shooting just 31 percent (16 of 51) from the fi eld.Pitt survived by getting into the lane relentlessly against thebigger Seminoles, an approach that helped them outscoreFlorida State 22-13 at the free throw line. Senior guard TrentForrest led Florida State with 19 points. Devin Vassell added14 but the Seminoles couldn’t survive 14 turnovers and 27fouls. RaiQuan Gray, Malik Osborne and Balsa Koprivica allfouled out for Florida State. Florida State went up 40-31 on alayup by Osborne with 13:37 to play. The Panthers, however,responded. The Seminoles had a chance to tie it at the endof regulation but Patrick Williams missed a jumper with twoseconds to go. Anthony Polite grabbed the off ensive reboundbut couldn’t get a shot off before the buzzer. Florida Stateshot 40 percent (21 of 53) from the fl oor.

Pitt 63, Florida State 61Petersen Events Center

Nov. 6, 2019Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 27 3-6 0-2 1-2 2-1 3 5 2 1 0 0 7Osborne 23 1-4 0-2 0-0 2-7 9 5 0 1 4 0 2Forrest 39 8-16 1-3 2-3 0-2 2 2 2 5 1 2 19Walker 16 0-4 0-2 4-4 0-5 5 4 0 0 0 0 4Vassell 21 6-7 2-2 0-0 2-0 2 2 1 1 0 0 14Polite 25 2-10 2-6 2-2 1-3 4 3 0 3 0 1 8Williams 27 1-5 1-2 2-2 0-2 2 1 0 1 1 0 5Koprivica 6 0-0 0-2 2-2 1-0 1 5 0 1 0 0 2Wilkes 8 0-1 0-0 0-0 1-1 2 0 1 0 0 1 0Jack 3 0-0 0-0 0-0 0-1 1 0 0 0 0 0 0Prieto 5 0-0 0-0 0-0 0-1 1 0 0 0 0 0 0Team 1-2 3 Totals 200 21-53 6-20 13-15 10-25 35 27 6 14 6 4 61

Pitt Min FG 3FG FT O-D Reb F A T B S Pts.Hamilton 18 2-2 0-0 2-3 3-0 3 1 0 0 0 0 6Drumgoole, Jr. 20 0-4 0-3 0-0 0-1 1 1 1 2 0 1 0Johnson 38 3-11 2-4 5-8 0-6 6 3 1 2 0 2 13McGowens 34 2-6 2-5 4-6 1-6 7 4 5 6 0 1 10Toney 13 0-7 0-3 0-0 2-0 2 1 1 0 0 1 0Browne 22 4-5 0-0 5-6 2-1 3 2 0 0 0 0 13Murphey 31 3-7 3-6 4-4 1-3 4 1 3 2 0 0 13Champagnie 23 2-9 2-5 2-4 2-4 6 3 0 0 0 0 8Team 2-3 5 1 Totals 200 16-51 9-26 22-31 13-24 37 16 11 13 0 5 63 FG% - Florida State, .396, Pitt, .314. 3FG% - Florida State, .300, Pitt, .346. FT% - Florida State, .867. Pitt, .710. Technical Fouls: Florida State -- Walker. Pitt -- Champagnie. Referees - Ted Valentine, Mike Stephens, Tony Henderson

Florida State 25 36 - 61Pitt 25 38 - 63

Game 2 -- Florida State 63, Florida 51

GAINESVILLE, Fla. – Devin Vassell scored 13 points, M.J. Walker added 12 and Florida State upset No. 6 Florida 63-51 on Sunday, extending its series winning streak to six. The Seminoles (1-1) avoided their first 0-2 start since 2000 thanks to suffocating defense that forced the rival Gators (1-1) into 16 turnovers and a woeful shooting performance. Florida was 14 of 50 from the field, including 4 of 22 from 3-point range. A sellout crowd witnessed FSU take over late in the first half and really seize control after the break. The Gators went 10 minutes with just one field goal -- a dunk on an inbound play -- as Florida State pulled ahead 38-25 in the opening minutes of the second half. The ‘Noles went up by 14 on Anthony Polite’s 3-pointer with 9:31 to play. The Seminoles made 11 of their first 20 shots in the second half. They also finished with five blocked shots and eight steals.

Florida State 63, Florida 61Exactech Arena at Stephen C. O’Connell Center

Nov. 10, 2019Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 24 1-5 1-3 4-6 0-5 5 1 2 1 0 1 7Osborne 26 4-7 0-0 2-2 2-2 4 4 0 0 0 1 10Forrest 31 1-7 1-3 5-6 3-5 8 1 7 4 0 1 8Walker 32 3-10 1-5 5-6 0-3 3 1 1 2 0 1 12Vassell 34 6-15 1-3 0-1 2-4 6 1 0 0 1 2 14Polite 18 2-3 1-1 2-2 0-2 2 1 0 1 1 1 7Williams 16 2-4 0-1 0-0 1-4 5 2 0 1 3 1 4Kaprovica 6 1-2 0-0 0-0 0-0 0 3 0 0 0 0 2Olejniczak 7 0-1 0-0 0-0 1-1 2 2 0 0 0 0 0Wilkes 6 0-1 0-1 0-0 0-1 0 1 1 0 0 0 0Team 2-1 3 Totals 200 20-55 5-17 18-23 11-26 37 17 11 9 5 8 63

Florida Min FG 3FG FT O-D Reb F A T B S Pts.Johnson 30 8-12 1-2 2-2 1-3 4 2 0 4 0 0 19Blacksher 35 0-5 0-2 10-14 4-9 13 4 2 1 1 2 10Mann 23 1-6 1-4 2-2 0-2 2 4 0 1 0 0 5Nembhard 38 2-7 2-5 0-0 0-5 5 1 3 4 0 0 6Locke 30 1-11 0-7 0-0 0-3 3 1 1 2 0 0 2Lewis 22 0-4 0-2 4-4 1-0 1 3 0 1 3 1 4Payne 4 2-4 0-0 1-2 2-2 4 2 0 0 0 0 5Glover 6 0-1 0-0 0-0 0-0 0 1 0 0 0 0 0Jitoboh 2 0-0 0-0 0-0 0-0 0 1 0 0 0 0 0Team 5-2 7 3 Totals 200 14-50 4-22 19-26 13-26 39 19 6 16 4 3 51 FG% - Florida State, .364, Florida, .280. 3FG% - Florida State, .294, Florida, .182. FT% - Florida State, .783. Florida, .791. Technical Fouls: Florida State -- None. Florida -- None. Referees - Doug Shows, Tony Greene, Mike Eades

Florida State 25 38 - 63Florida 21 30 - 51

Game 3 -- Florida State 79, Western Carolina 74

TALLAHASSEE, Fla. – Freshman Patrick Williams and junior M.J. Walker each scored 18 points and Florida State rallied to top Western Carolina 79-74 in the Seminoles’ home opener. Forrest had 16 points for the Seminoles who trailed 41-24 with 3:41 left before halftime. Florida State gradually chipped away at the lead, going ahead for good with 45 seconds left in the second half as Williams made a layup. Mason Faulkner scored 21 points, including 12 in the first half, as WCU took a commanding early lead. The Catamounts made 7 of 14 3-pointers in the first half but cooled off and was just 2 of 9 in the second half. After Williams made a pair of free throws to give Florida State a 77-74 lead, Faulkner missed a long jumper with three seconds left as he hoped to make the shot and draw the foul in an attempt to tie it up and send the game to overtime. Florida State won its home opener, securing a 33rd straight nonconference victory at the Donald L. Tucker Center.

Florida State 79, Western Carolina 74Donald L. Tucker Center

Nov. 15, 2019W. Car. Min FG 3FG FT O-D Reb F A T B S Pts.Dotson 27 5-11 0-0 1-2 2-6 8 3 0 2 0 1 11Steger 31 3-8 1-4 2-3 2-3 5 5 1 3 0 3 9Halvorsen 36 3-8 3-6 0-0 0-2 2 1 2 1 0 0 9Faulkner 37 6-15 2-6 7-7 2-2 4 1 7 3 0 1 21Gibson 33 6-10 3-5 0-0 0-1 1 4 0 3 0 0 15McCray 13 2-4 0-1 0-0 0-1 1 3 0 0 0 0 4Cork 8 1-1 0-0 1-2 0-0 0 4 0 1 1 0 3Myers 5 0-1 0-1 0-0 1-2 3 0 0 0 0 0 0Sledd 5 1-2 0-0 0-0 1-0 1 1 0 0 0 0 2Harris 4 0-0 0-0 0-0 0-1 1 0 0 0 0 0 0Team 2-3 5 1 Totals 200 27-60 9-23 11-14 10-21 31 22 10 14 1 5 74

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 17 1-4 0-1 2-2 1-1 2 1 1 2 1 0 4Osborne 25 2-2 0-0 2-3 4-5 9 2 1 1 1 0 6Forrest 32 5-14 1-3 5-5 1-1 2 4 2 1 0 1 16Walker 26 5-11 3-6 5-7 0-4 4 3 2 1 1 0 18Vassell 32 4-9 0-3 2-4 1-4 5 2 2 1 1 0 10Evans 3 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Polite 24 1-4 1-4 0-0 0-2 2 0 1 2 1 2 3Williams 22 5-8 1-2 7-7 1-3 4 0 1 2 0 0 18Koprovica 10 2-2 0-0 0-0 1-1 2 3 0 3 1 0 4Wilkes 2 0-1 0-1 0-0 0-0 0 1 0 0 0 0 0Olenniczak 4 0-0 0-0 0-0 0-0 0 2 0 1 0 0 0Team 0-2 2 Totals 200 25-55 6-20 23-28 9-23 32 18 10 14 6 3 79 FG% - Western Carolina, .450, Florida State, .455. 3FG% - Western Carolina, .391, Florida State, .300. FT% - Western Carolina, .786. Floirida State, .821. Technical Fouls: Western Carolina -- None. Florida State -- None. Referees - Mark Schnur, Lamar Simpson, Jermey Mosier

Western Carolina 43 31 - 74Florida State 36 43 - 79

Game 4 -- Florida State 89, Chattanooga 53

TALLAHASSEE, Fla. – Devin Vassell scored a career-high 17 points and pulled down a career-high eight rebounds while Patrick Williams added 16 points as Florida State cruised to an 89-53 rout of Chattanooga. Ole Miss graduate transfer Dominik Olejniczak scored his first points at Florida State, going five for six from the floor for 10 points and grabbed three rebounds. The Seminoles shot 34 of 65 (52.3%) from the floor. David Jean-Baptiste had 15 points for Chattanooga. Rod Johnson had 11 points and six rebounds for the Mocs, who shot 23 of 59 (39%).

Florida State 89, Chattanooga 53Donald L. Tucker Center

Nov. 20, 2019UTC Min FG 3FG FT O-D Reb F A T B S Pts.Johnson 25 5-13 1-6 0-0 1-5 6 0 1 1 1 0 11Vila 26 4-6 0-0 0-0 0-2 2 2 1 0 2 0 8Ryan 25 3-6 3-6 1-2 1-1 2 4 0 2 1 1 10Jean-Baptiste 28 7-13 0-4 1-4 0-4 4 0 1 5 0 0 15Commander 30 1-6 0-2 0-0 0-2 2 2 3 0 0 1 2Scott 14 0-2 0-0 0-0 1-1 2 3 1 2 0 0 0Doomes 12 1-3 0-1 0-0 1-3 4 3 0 3 0 0 2Caldwell 11 0-2 0-2 0-0 0-1 1 0 1 0 0 0 0Brown 11 0-0 0-0 0-0 0-3 3 0 0 0 1 1 0Ledford 10 1-4 0-2 0-0 2-0 2 2 0 3 0 0 2Obidiebube 4 0-3 0-0 0-0 2-0 2 1 0 0 0 1 0Tostado 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Smith 1 1-1 1-1 0-0 0-0 0 0 0 0 0 0 3Team 0-0 0 Totals 200 23-59 5-24 2-6 8-22 30 17 8 16 5 4 53

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Osborne 20 4-10 1-3 1-1 0-3 3 1 2 1 0 0 10Wilkes 15 2-5 1-4 0-0 1-1 2 0 0 1 0 1 5Polite 25 0-4 0-3 1-2 0-2 2 1 0 1 0 0 1Forrest 30 2-4 0-1 1-2 0-4 4 1 7 4 2 1 5Vassell 26 6-10 3-5 2-2 3-5 8 1 1 1 2 1 17Evans 14 0-1 0-0 4-6 0-0 0 0 2 1 0 4 4Williams 20 6-10 2-3 2-2 1-2 3 0 3 0 0 2 16Koprivica 12 5-6 0-0 0-2 3-4 7 1 1 0 1 0 10Jack 14 2-5 2-5 0-0 1-4 5 1 1 1 0 1 6Olejniczak 8 5-6 0-0 0-0 2-1 3 1 0 0 0 0 10Lindner 5 0-0 0-0 0-0 0-1 1 0 2 1 0 0 0Light 3 1-1 1-1 0-0 0-0 0 0 0 0 0 0 3Prieto 3 1-1 0-0 0-0 0-1 1 0 0 0 0 0 2Miles 3 0-2 0-0 0-0 0-0 0 0 1 0 0 0 0Yates 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 0-2 2 Totals 200 34-65 10-25 11-17 11-30 41 7 20 11 5 10 89 FG% - Chattanooga, .390, Florida State, .523. 3FG% - Chattanooga, .208, Florida State, .400. FT% - Chattanooga, .333. Floirida State, .647. Technical Fouls: Chattanooga -- None. Florida State -- None. Referees - Ted Valentine, Brian Dorsey, Joff Pon

Chattanooga 29 24 - 53Florida State 41 48 - 89

Game 5 -- Florida State 80, Saint Francis 65

TALLAHASSEE, Fla. – Wyatt Wilkes scored a career-high 14 points while Trent Forrest added 13 points and five re-bounds as Florida State defeated Saint Francis (Pa.) 80-65. A redshirt sophomore, Wilkes had scored just five points in four games this season before turning in an unexpected five of seven performance from the floor against the Red Flash. Wilkes also knocked down 3-of-5 3-pointers. Myles Thompson scored a career-high 23 points, knocking down 9 of 12 shots for Saint Francis. Thompson came into the game averaging eight points. Forrest was 7 of 7 at the free-throw line as the Seminoles continued to impress by going 15 of 17 at the charity stripe. Florida State came into the game as the only ACC team shooting better than 75 percent from the free-throw line. Freshman center Balsa Koprivica has had back-to-back double-digit scoring games, finishing with 11 points on 5 of 6 shooting versus the Red Flash. Florida State won its 35th straight non-conference home game, a streak that dates nearly five years.

Florida State 80, Saint Francis (Pa.) 65Donald L. Tucker Center

Nov. 23, 2019SFU Min FG 3FG FT O-D Reb F A T B S Pts.Thompson 31 9-12 4-5 1-1 0-4 4 1 0 3 0 1 23Kuzavas 19 0-2 0-0 0-0 1-1 2 4 0 1 1 0 0Meredith 28 1-8 1-6 0-0 0-1 1 2 2 3 0 0 3Gaskins 24 2-3 1-2 2-2 0-2 2 3 1 2 0 2 7Braxton 35 2-9 1-4 8-8 1-4 5 2 3 5 0 1 13Stewart 24 5-15 2-4 2-2 2-2 4 0 1 2 1 2 14Flagg 16 0-1 0-0 0-0 0-0 0 3 0 1 1 1 0Dixon-Conver 13 0-2 0-0 0-0 1-1 2 1 1 4 0 1 0Laskey 4 0-1 0-1 0-0 0-1 1 2 0 0 0 0 0Ikediashi 2 0-0 0-0 3-4 1-1 2 1 0 0 0 0 3Labriola 2 0-0 0-0 0-0 1-0 1 0 1 0 0 0 0Henry 1 1-1 0-0 0-0 0-0 0 0 0 0 0 0 2Team 3-0 3 Totals 200 20-54 9-22 16-17 10-17 27 19 9 21 3 8 65

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Osborne 24 3-7 3-5 0-0 1-3 4 2 0 1 2 0 9Olejniczak 13 1-3 0-0 2-2 4-0 4 2 0 2 1 0 4Polite 29 3-6 2-4 0-0 1-6 7 0 2 5 1 5 8Forrest 26 3-7 0-1 7-7 1-4 5 1 4 3 0 2 13Vassell 17 2-4 0-0 0-0 0-1 1 4 1 0 0 1 4Williams 22 2-6 0-2 2-2 1-4 5 1 1 5 1 1 6Koprivica 22 5-6 0-0 1-3 2-1 3 0 0 0 0 2 11Evans 17 2-5 0-1 2-2 1-1 2 1 5 0 0 0 6Wilkes 16 5-7 3-5 1-1 1-1 2 1 0 1 0 0 14Jack 9 1-5 1-5 0-0 0-1 1 1 2 2 0 0 3Prieto 2 0-2 0-1 0-0 0-0 0 1 0 0 0 0 0Lindner 1 0-0 0-0 0-0 0-0 0 1 0 0 0 0 0Light 1 0-1 0-1 0-0 0-0 0 0 0 0 0 0 0Miles 1 1-1 0-0 0-0 1-0 0 0 0 0 0 0 2Yates 1 0-0 0-0 0-0 0-0 1 0 0 0 0 0 0Team 2-1 3 Totals 200 28-60 9-25 15-17 15-23 38 15 15 19 5 11 80 FG% - Saint Francis, .370, Florida State, .467. 3FG% - Saint Francis, .409, Florida State, .360. FT% - Saint Francis, .941. Floirida State, .882. Technical Fouls: Saint Francis -- None. Florida State -- None. Referees - Mike Roberts, Jerry Heater, Warl Walton

Saint Francis 36 29 - 65Florida State 48 32 - 80

Game 6 -- Florida State 113, Chicago State 56

TALLAHASSEE, Fla. – Devin Vassell and Patrick Williams scored 16 points apiece as Florida State had its best shoot-ing night of the year in a 113-56 win over Chicago State. Nathanael Jack added 14 points for the Seminoles, who shot 73.3% in the first half as they took a 65-29 lead at the break. Andrew Lewis scored 18 points for Chicago State (3-4). Trent Forrest scored 12 points for Florida State, which finished 38 of 58 (65.5%) from the floor. Balsa Koprivica and RaiQuan Gray each had seven rebounds for Florida State, which won the rebounding battle 43-20. This was the first time the Seminoles scored 100 points in regulation since a 113-78 win over The Citadel on Nov. 24, 2017. Twelve Semi-noles scored points in one of the more dominating victories in school history. Florida State’s 57-point margin of victory was just outside the top five in school history.

Florida State 113, Chicago State 56Donald L. Tucker Center

Nov. 25, 2019Chi. St. Min FG 3FG FT O-D Reb F A T B S Pts.Jones 17 0-3 0-1 2-2 1-0 1 5 0 2 0 2 2Colley 26 3-8 0-1 0-4 1-1 2 4 0 1 0 1 6Hunt 31 5-6 0-0 0-1 2-2 5 2 0 3 0 1 10lewis 26 5-13 2-3 6-7 0-2 2 2 0 3 0 1 18Johnson 27 3-10 1-5 2-2 1-2 3 2 0 7 0 2 9Gholizadeh 25 2-7 0-2 4-0 2-1 3 2 2 2 0 0 8Bigirumwami 21 0-1 0-0 0-0 1-0 1 3 1 2 0 2 0Johnson 14 0-1 0-1 1-2 0-0 0 0 0 1 0 0 1Whitehead 13 1-3 0-1 0-0 1-0 1 1 0 1 0 0 2Team 1-1 2 Totals 200 19-52 3-14 15-26 11-9 20 21 3 22 0 9 56

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Osborne 15 2-2 0-0 0-0 2-3 5 1 1 0 0 0 4Olejinczak 16 3-4 0-0 2-2 1-3 4 2 0 2 2 0 8Polite 15 3-4 1-1 2-2 2-2 4 0 5 0 0 3 9Forrest 15 5-8 2-2 0-0 0-2 2 0 6 2 0 3 12Vassell 13 6-7 1-2 3-4 2-0 2 0 1 1 0 3 16Evans 22 2-4 0-2 2-2 0-0 0 3 2 2 0 1 6Gray 16 1-3 0-2 4-4 2-5 7 3 1 3 0 1 6Williams 20 6-8 0-1 4-4 1-2 3 3 1 1 0 1 16Koprivica 18 3-4 0-0 4-5 2-5 7 1 0 2 0 0 10Wilkes 19 2-7 2-0 2-2 1-2 3 2 2 0 1 1 8Jack 15 4-6 4-7 2-2 0-1 1 3 2 0 0 0 14Prieto 16 0-0 0-6 0-2 1-1 2 1 0 0 0 0 0Lindner 4 1-1 0-0 2-2 0-2 2 1 0 2 0 0 4Light 4 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Miles 4 0-0 0-0 0-0 0-0 0 2 0 1 0 0 0Yates 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 0-1 1 Totals 200 38-58 10-23 27-31 14-29 43 23 21 16 13 3 113

FG% - Chicago State, .365, Florida State, .655. 3FG% - Chicago State, .214, Florida State, .435. FT% - Chicago State, .577. Floirida State, .871. Technical Fouls: Chicago State -- None. Florida State -- None. Referees - Bert Smith, Raymie Styons, Clarence Armstrong

Chicago State 29 27 - 56Florida State 65 48 - 113

Chipley Blacktop Courts, Family Hoop Roots Shape Forrest By Bob Thomas Florida State Associate Sports Information Director Thirty miles separate the Florida Panhandle towns of Chipley and Malone; roughly twice the distance between New York City and Newark, N.J., where the 11th-ranked Florida State men’s basketball team meets UConn in Saturday’s Never Forget Tribute Classic at the Prudential Center. The disparate connection between those locales is Florida State junior point guard Trent Forrest, whose love and acumen for the game was nurtured and honed on the blacktop courts in rural North Florida. The height of the rims and passion for basketball are the lone common links between the asphalt courts at Chipley’s old Roulhac Middle School - where Forrest tagged along with his older brother Trey for pick-up games - and places like Harlem’s legendary Rucker Park. “There were 15-20 guys out there,” Forrest said, recounting his formative basketball days. “I was the only young kid out there and my brother would let me play. I was just trying to stay on the court and win as many games as I could. If I was on the opposite team of my brother, he would always push me. If the game was close, he’d try to get the team to give me the ball so they could force pressure on me to try and get a turnover. That’s where it all started, playing with older guys… “We would play from the time I got off the bus until dark.” Those days on the courts at old Roulhac were instrumental in the development of the 6-foot-4 Seminole guard with the Swiss Army Knife skill-set. Forrest is averaging 10.4 points, 4.9 rebounds and 3.6 assists. He leads the 7-1 Noles in steals (14) and free throw percentage (.893), and ranks second in field goal percentage (.509) among the regulars. Genealogy and geography have also played a role in Forrest’s development. The apple did not fall far from the tree, as the basketball roots run deep on both sides of the Forrest family. His father, Lester Forrest, was an all-state player at Malone High in Jackson County, Florida, which borders the Washington County seat of Chipley to the east. He went on to play at Chipola Junior College before joining the military. Trent’s mother, Barbara Lee – a pastor today in Chipley and a constant presence at his FSU games - also played basketball at Chipola. There are few places in Florida more passionate about high school basketball, than the small towns throughout the Panhandle. Standing room only, Friday night crowds have been the norm for decades at places such as Malone, Chipley, Grand Ridge, Marianna, Cottondale, Graceville, Paxton and Laurel Hill. “My kids were pretty much born into a basketball kind of family,” said Lester Forrest. “Basketball was king in Malone back in the 80s and 90s because you really didn’t have anything else to do unless you liked to hunt or fish…The fans loved the game, and basketball history was really high in Malone.” Malone High has produced 14 state titles; second only in Florida high school history to the 18 of Miami Senior. Lester Forrest won one as a junior in 1981, and his “baby brother” Derrick was a freshman when the Tigers won another in 1983 under legendary coach Marvin Lassiter. After two years at Chipola, Derrick went on to star at Clemson alongside future NBA standouts Elden Campbell and Dale Davis, after helping those Tigers to their only ACC regular season title in 1990. Malone kept winning, rolling off a state-record five straight (1994-1998) under coaches John Ellerbee and Matt Anderson.

Chipley was often in Malone’s championship path, and despite unprecedented success during coach Rickey McCullogh’s 20-plus seasons at the helm, didn’t win its first state title until 2012 under Joel Orlando. They doubled that total with Trent leading the way, claiming the 2015 and 2016 crowns – one under Orlando and the last under Mike Gates - after watching Malone cut down the nets in 2014. “With Trent’s two state championship titles in 1A, and my contribution of one and the rest of his cousins in Jackson County at Malone…we’ve won nine state championships,” Lester Forrest said, proudly. “Trent had an opportunity to see that from both spectrums, from Malone and then at Chipley. Being in that environment he took on that mentality.” Basketball Hall of Fame center Artis Gilmore may be the biggest star out of Chipley, but he wasn’t alone. Former FSU and NFL tailback Amp Lee starred on the court, as did Tony Davis, who went on to play tailback at the University of Florida. Trent is related to both Lee and Davis, who was the school’s all-time leading scorer, until Trent shattered his record during a four-year varsity career. Alex Hamilton, Trent’s godbrother, was the linchpin on the 2012 state title team and enjoyed a strong collegiate career. In addition to his job managing and maintain Gilmore Park for the city’s recreation department, Lester Forrest was building up the youth basketball program, which coincided nicely with his sons’ interests and served them well as they moved on to Chipley High. Trent’s earliest memories of Chipley High basketball included going to watch his brother Trey’s games. “I was probably six or seven,” Trent said. “After they would play, I have a goal at home and I would always try and emulate the things they would do in games.” Sometimes he wouldn’t wait to get home. “When his brother would be playing, at halftime and after the games were over, while the little kids would be playing around on the court trying to shoot, Trent would be doing basketball drills,” Lester said. “The adults would be like, ‘Look at that little guy. He’s pretty advanced.’” And Trent Forrest kept improving. By the time he was done at Chipley he had scored 3,103 points, won two state titles and become a polished product when it came to end-game decision-making and execution. Competing in travel basketball, as a youngster with the Lynn Haven Wildcats, and later, on the AAU circuit with the Alabama Challenge and Georgia Stars, further sharpened those skills. “In AAU I kind of got exposed to just how good people really are outside the area I’m from,” Trent said. “In this area I was the best player, but when I got exposed to AAU I was like, ‘Wow, there are a lot of other people out here that were better than me, or had the same talent.’… “At the same time, I learned how to play the right way. That has helped me be able to mesh if I was playing with guys better than me.” Coach Leonard Hamilton’s Seminoles have been the beneficiaries. “He’s an unselfish player,” Hamilton said. “He impacts the game in a lot of ways, even if he’s not scoring. He moves the ball. He makes good decisions. He defends well. He talks to his teammates and communicates well. He’s a very valuable asset.” Hamilton’s comments came after the Noles’ recent 73-72 win over Purdue on Forrest’s game-winning runner with five seconds remaining, off a play designed for him to either take or create the final shot.

“In games like these, I want to be able to affect it in whatever way I can, whether that’s playing defense, scoring; just making the right plays,” Forrest said. The decisive basket came in the middle of a 16-second, end-game sequence, sandwiched around a pair of Forrest steals; the first with the Noles trailing by 1 to set up the go-ahead possession, and the second, of a desperation pass as the horn sounded. It certainly didn’t surprise Florida State associate head coach Stan Jones, who in the recruiting process watched Forrest guide the star-laden Georgia Stars to 24 straight wins on the July travel circuit, including the Peach Jam and Las Vegas Classic titles. “I’m not sure anyone has done that,” Jones said. “He was just able to hold a team together, figure out what the team needed and when it was time to win, he makes winning basketball plays. It was not just that play the other night against Purdue. He’s made an awful lot of big plays, like the shot the other night and the pass to PJ Savoy in the Xavier [NCAA Tournament] game last year… “The character of that young man is very, very high and I think it reveals itself when the pressure is highest.” The folks from Chipley are accustomed to seeing one of their favorite sons deliver in similar fashion. Many were in the stands at the Lakeland Center for the 2016 Florida 1A state semifinal game against Hamilton County. Trent Forrest remembers it as perhaps the first time he delivered with the game on the line. His Chipley Tigers trailed by eight with roughly a minute to play. “I had a couple free throws late in the game against Hamilton County when they were trying to shorten the game,” Forrest said, humbly down-playing his vastly more significant contributions. “One play in particular that kind of blew my mind when he hit a 3-pointer,” Lester Forrest recounted. “The ball was taken out on the side around half court. He ran and retrieved the ball and reversed, spun opposite of the way he was going, got to the top of the key and hit a fall-away 3-pointer that was really huge in that game.” Then came the game-sealing free throws. He scored 26 points in the state final, a 65-38 shellacking of Panhandle rival Paxton, as the Tigers rallied from a 28-26 halftime deficit. Forrest locked down Paxton star Zach Varnum in the second half after requesting the defensive assignment at intermission. “You live for those moments,” Trent Forrest said. “It just shows a lot of what you’re made of and I feel like if you’re a basketball player you want to be in those situations.” Like his FSU coaches and teammates, Forrest’s friends and family in Chipley have a great appreciation for the person and player he has become. That was evident on his senior night three years ago, when the fire marshal and police were forced to lock down the overflow gymnasium for his final home game, much to Jones’ chagrin. “I started to panic as I tried to find somebody so I could talk my way into the building, because there was that much enthusiasm around the program and Trent’s career there,” said Jones, who had hoped to surprise the recent Seminole signee in person. Jones eventually got inside, but Forrest was helped off the floor late in the game after bumping knees with another player. “It bothered him pretty bad and so they decided to take him to the emergency room after the game to get it checked,” Jones added. “I went over there with him and when he came out from his exam, they should have sold tickets. There were that many people in the emergency waiting room to make sure he was okay.”

Chipley remains as proud of Trent Forrest today, as he is appreciative for the people and places who have been essential to his development as a person and player. There are two things he has taken from those formative years and applied to his success on and off the court at Florida State. “The pureness of the game, and the dream,” Trent Forrest said. “In small towns there’s really not the politics you might see in the big city. People are just playing for the love of the game, honestly. That’s helped me get here now; the love of the game and desire to get better. “If you ask people where Chipley is, they don’t know. That’s one thing I’ve taken with me since I’ve left – it’s to always remember home, and you can do whatever you really want to set your mind to.”

top related