issn: 2277-3827 original article homology modeling of a
Post on 19-Dec-2021
3 Views
Preview:
TRANSCRIPT
1 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
ISSN: 2277-3827
Original article
Homology modeling of a unique extracelluar glutaminase free L-asparaginase
from novel marine Actinomycetes 1Senthil Kumar.M*,
2Selvam.K and
3Singaravel.R
1. Dept of Biotechnology, Bharathiar University, Coimbatore, India.
2. Dept of Biotechnology, Dr.NGP college of Arts and Science, Coimbatore, India.
3. Central Institute of Brackishwater Aquaculture (CIBA), Chennai, India.
*Corresponding Email: pearlsen78@gmail.com
Received 15 March 2012; accepted 03 April 2012 Abstract
Molecular modeling provides a mechanistic hypothesis at the molecular level of an unique extracelluar glutaminase free L-asparaginase from novel marine Actinomycetes.The physicochemical characteristics and the 3D models provide a framework
for the purification and characterization of Streptomyces radiopugnans MS1 L-Asparaginase.The Ramachandran plot for the
model was observed as 87.9 percentages of residues is in most favored region that indicate the model is reliable.The energy
value, instability index and RMSD (Root men square deviation) fluctuation of Carbon alpha back bone of the model was
computed that confirms the stability of the model protein. In the present study homology model of L-asparaginase from
Streptomyces radiopugnans MS1 was evaluated and compared it with other reported sources of the enzyme. Ligand binding
studies with both l-asparagine and l-glutamine using the L-asparaginase structure showed interesting results when compared
with E.coli and Erwinia L-asparaginase. The result indicates the possibility of Streptomyces radiopugnans MS1 protein being a
potential alternative to E.coli and Erwinia enzyme.
© 2011 Universal Research Publications. All rights reserved
Keywords: Molecular modeling, Actinomycetes, glutaminase free L-asparaginase, Ligand Binding and Ramachandran plot
Introduction
L-asparaginase is exploited in chemotherapy
schedule in the treatment of malignancies of the lymphoid
system, acute lymhoblastic leukemia and non-Hodgkin‟s
lymphoma [1]. Its anti-malignant activity is allied with the
possessions of exhausting the circulating pool of L-
asparagine by the asparaginase catalytic activity [2].
The use of L-asparaginase in anti-cancer therapy is
based on its ability to cleave L-asparagine, an amino acid
vital for malignant growth, to ammonia and L-aspartic acid in
serum and cerebrospinal fluid. Since malignant growths are incapable to produce endogenous L-asparagine,
malnourishment for this amino acid leads to fatality of these
cells [3].
Based on this, L-asparaginase has also been included
in most contemporary, multi-agent regimens for adult acute
lymphoblastic leukemia.
Broome, while working in Kidd‟s laboratory,
succeeded in 1961 in demonstrating that the antilymphoma
activity in guinea pig sera was due to L-asparaginase [4].
Since production of sufficient quantities of the enzyme from
the guinea pig serum is difficult, the scientific community
was in search for alternative methodologies.
It was a breakthrough when Mashburn and Wriston
in 1964 [5] reported the purification of Escherichia coli L-
asparaginase and demonstrated that its tumoricidal activity
was similar to that of guinea pig sera proving a practical base
for large-scale production of this enzyme for pre-clinical and
clinical studies. Though several Lasparaginases of bacterial
origin have been developed and their potential usage in clinical trials have been studied to prevent the progress of L-
asparagine-dependent tumors, mainly lymphosarcomas, the
success hitherto has been rather limited, and most of the
treatments must be interrupted due to severe side effects and
immunological reactions in the patients.
1. Literature reports indicated that the enzyme
biochemical and kinetic properties vary with the
genetic nature of the microbial strain analyzed [6].
Available online at http://www.urpjournals.com
International Journal of Research in Biotechnology and Biochemistry
Universal Research Publications. All rights reserved
2 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
For example, Erwinia L-asparaginase exhibited
less allergic reactions compared to the E. coli
enzyme. However, Erwinia asparaginase had a
shorter half-life than E. coli [7], suggesting the
need to discover new L-asparaginases that are
serologically different but have similar therapeutic effects.
This may have need of the screening of Marine
samples from various sources for isolation of potential
microbes, which have the ability to produce the desired
enzyme.
In this perspective, a bacterial strain belonging to the
Streptomyces radiopugnans MS1 species has been isolated in
our laboratory. Our preliminary investigation indicated that
this strain has the potential to produce extracellular L-
asparaginase. Keeping this in view, in this investigation, we
have studied the antineoplastic activity of this extracellular L-
asparaginase and report that this enzyme has potential for being used as antileukemia drug.
A convenient way to study the function, structure
and mechanism of a gene is to identify homologues
(evolutionary relationships) in model organisms.It is
interesting to identify homologues of L-Asparaginase in
Streptomyces sps. Dynamic programming based alignment
tools such as BLAST and FASTA have been widely used to
provide evidence for homology by matching a new sequence
against a database of previously annotated sequences.
However, these approaches can only detect homologous
proteins that exhibit significant sequence similarity. The availability of web based tools and server
provides an excellent opportunity to characterize the
physiochemical properties of Streptomyces radiopugnans
MS1 L-Asparaginase as well as their primary, secondary and
three dimentional structural properties.The purpose of this
study was primarily to report structural analysis and
characterization of Streptomyces radiopugnans MS1 L-
Asparaginase.
Methodology
Sequence and structure alignment
L-asparaginase gene from Streptomyces radiopugnans MS1 (GenBank: AEC45572 & DBsource
accession no is JF799106) was used as a source sequence,
sequence alignments of its amino acid sequence against
Protein Data Bank [8] were performed by means of the
BLAST algorithm (the used default Blast parameters were: E
cut-off = 10, mask low complexity = yes).More than 70
Sequence alignment shows that the target and the template
(share 31% of sequence identity).
Because protein structures are more conserved than
DNA sequences, detectable levels of sequence similarity
usually imply significant structural similarity. Based on the
significant e-value and alignment among the investigated templates, Streptomyces sps L-asparaginase was selected as a
template to build a model for Streptomyces radiopugnans
MS1 L-Asparaginase. The amino acid sequence of the target
protein, (Streptomyces radiopugnans MS1 L-asparaginase)
was retrieved from NCBI database, a centralized resource
database which provides taxonomic, physicochemical and
molecular information (GenBank: AEC45572 & DB source
accession no is JF799106) and is composed of 322 residues.
The sequence was aligned with all reported sources of L-
asparaginase such as Streptomyces pristinaespiralis ATCC 25486 (NCBI Reference Sequence: ZP_06910947 & DB
source REFSEQ: accession NZ_CM000950) , Strepto-
myces albus J1074 (NCBI Reference Sequence: ZP_
06591693 & DBsource REFSEQ: accession NZ_ DS999645),
Streptomyces sp. SPB78 (NCBI Reference Sequence:
ZP_07273143 & NZ_GG657742 and Strepto-myces sp. AA4
(NCBI Reference Sequence: ZP_ 07283361 & DBsource
REFSEQ: accession NZ_ GG657746).Using “ClustalW” for
determination of homology or similarity [9,10 & 11 ]
(http://www.ebi.ac.uk/Tools/clustalw).
Characterization of Protein Sequenced
Domain region was one of the most important data in protein sequence for identification of domain region from
the sequence “BLOCK” (http://blocks.fhcrc.org) server [12]
and “SMART” tools [13] were used. Other tool like “PRED
TMBB” tool was used to analyze the amino acid positions
where there is in or out position [14]
(http://bioinformatics.biol.uoa.gr/PRED-TMBB).
Prediction of Protein Structure
In first step, secondary structure of the protein was
predicted through “SOPMA” program [15] (Self-Optimized
Prediction Method) and the program determined the role of
individual amino acid forbuilding the secondary structure with their positions [16,17,18,19,20]
(http://npsapbil.ibcp.fr/cgibin/npsaautomat.pl?page=/NPS
A/npsa_sopma.html) and “TMpred”were used to predict
membrane-spanning regions of the protein and their
orientation. (http://www.ch.embnet.org/software/TMPRED -
form.html). In second step, the protein structure was
predicted by homology modeling with two different software
and server “Swiss model” [21, 22 & 23] and “Phyre2”
(http://swissmodel.expasy.org/workspace/index.php ,
http://www.sbg.bio.ic.ac.uk/phyre/index.cgi ).
Characterization of Structure The amino acid composition of the L-asparaginase was
computed using the PEPSTATS analysis toll [24]
( http://mobyle.pasteur.fr/data/jobs/pepstats ).The physico
chemical parameters such as the molecular weight, isoelectric
point(pI), extinction coefficient,half –life,aliphatic index,
amino acid property, instability index and Grand Average
Hydropathy (GRAVY) were calculated using the ProtParam
tool of the Expasy proteomics server.Secondary structure
elements predication was performed using the network
protein sequence analysis server and the Secondary Structural
Content Prediction (SSCP) server [25 & 26].The 3-D models
of L-asparaginase was constructed using the protein structure homology model building program SWISS-MODEL with
energy minimization parameters .The modeled tertiary
structure [27,28 ] were built on the basis of the sequence
3 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
“Figure:1, CLUSTAL 2.1 multiple sequence alignment of
L-Asparaginase Sequences.Single fully conserved residues
are represented by (*), deleted region(-),conservation of
strong and weak groups is denoted by (:) and (.),
respectively”.
homology with the high –resolution crystal structure of the
Streptomyces asparaginase enzymes.
Evaluation and validation of refined model
To obtain an accurate homology model, it is very
important that appropriate steps are built into the process to
assess the quality of the model. Therefore, accuracy of the
predicted models were subjected through a series of tests.
Stereochemical quality were evaluated using Ramachandran
plots obtained from the RAMPAGE server [29] & protein
structure validation suite (PSVS) and amino acid
environment was assessed using PROCHECK [30,31]
,WHAT_CHECK ,PROVE Verify 3D [32] and Errat [33] from the UCLA-DOE server [34] (http://nihserver.mbi.ucla.
edu). “ProSA” (https://prosa.services.came.sbg.ac.at/ prosa.
php ). While ProSA is a tool widely used to check 3D models
of protein structures for potential errors [35] and the
WHATIF server (http://swift.cmbi.ru.nl/servers/html/index.
html) validated structure scale and symmetry, atom
coordination, nomenclature, geometric, accessibility,
bumping, 3-D database, B-factor and hydrogen bond [36].
Comparison of protein models:
“Topmatch” tool was used for determination of the
superposition and structure alignment [37].Given a pair of protein structures, “TopMatch” calculates a list of alignments
ordered by structural similarity. The corresponding
superposition can be explored in a 3D molecule viewer.
(http://topmatch.services.came.sbg.ac.at/topmatch.html ).
“Figure: 2, The graphical view of the amino acids
position.A,B & C”.
Ligand binding sites analysis
The top ranking model of L-Asparginase has been
submitted to the 3DLigandSite server (http://www.sbg.bio.
ic.ac.uk/3dligandsite) [38] to predict potential binding sites.
Docking of substrates to L-Asparaginase
The L-Asparaginase normal substrate was L-Asparagine.In order to validate the active site architecture of
the Streptomyces radiopugnans MS1 L-asparaginase model
and examine its possible mode of interaction with the ligand,
the L-Asparagine substrate was docked within the
asparaginase homology model using the HEX v.6.3 [39]
docking environment at its default parameters. Hex is a tool
for macromolecule docking and it can superpose pairs of
molecules using only knowledge of their 3D shapes. Further,
it is one of the few docking tools having in built graphic
viewer [40, 41, 42 & 43]. This tool has been used in some
earlier studies demonstrating ligand- protein interaction. The
approach was to use blind docking since it has been recommended for acquiring good results in prediction of
substrate binding site [44] Correlation type and post-
processing output for receptor and ligand were kept based on
shape, electrostatic potential and minimization of molecular
mechanics (MM). Docking was carried out at full rotation
4 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
“Figure:3 Secondary structure of the l-asparaginase sequence through SOPMA”.
allowing full flexibility for the ligand while keeping receptor
position fixed in space [45].Docking parameters involved
Fourier transformation, steric scan, final search for ligand
binding site and refinement of the complex. Visualization
The results of the computational structure of Streptomyces
radiopugnans MS1 L-Asparaginase and its characterization
and validation by the various softwares and servers were
visualized by using softwares like “Phyre2” (http://www.sbg.
bio.ic.ac.uk /phyre2) “PyMOL” (http://pymol. sourceforge. net/) and “Chimera” (http://www.cgl.ucsf. edu/chim era/).
Result
Characterization of Protein Sequence
The multiple alignment result showed significant
homology was found with Streptomyces radiopugnans MS1
and homology with Streptomyces sps .The multiple
alignment score was showed that they are very close to each
other ranging from 50 to 79 % as shown in Table 1.Figure 1
shows the result of the multiple sequence alignment of the
mentioned organisms using CLUSTALW program.The
multiple sequence alignment also reveled that there are
stretches of amino acids that are exclusive to Streptomyces sps L-asparaginase.
Block analysis indicated that there were six blocks
found which was of L-asparaginase II family at positions like
13-52, 53-82,122-166,206-239,246-296 and 302-322 its
block sequence were PVLAEVVRSGFTEGHHRGSLVLL A
ADGSVDLALGDPAAP, FPRSSNKPMQAAAIL RAGL E
LSGERLALAA, AEAYLAAGRVREPLTMNCSGKH A A
MLAVCVRNGWDTATYLDPAHP, AFRAFVTAEPG SA
ERRVADAMRAHPEYVAGTRRP, EVPGTLSKMGAE A
VQAVALADGRALAFKIDDGSTRALGPVLARALELLGV
D & RIGRAPLLGGAEEVGRIRAAF respectively. Further analysis with “SMART” tool indicated that
there was one domain present in the sequence between 15 and
321 with an E-value 4.70e-102. The identification of conserved
domains from the sequence was done through “Motif Scan”.
The results indicate that amino acids from 15-321were highly
conserved for L-asparaginase II family.
“PRED TMBB” tool was used to analyze the amino acid
positions showed that 65-75 and 90-102 amino acids were in
Trans membrane, where 1-64 and 103-322 amino acid were
in inner membrane and 76-89 amino acid were
“Figure:4 TM pred output for L-Asparaginase enzyme.”
present in outer membrane (Figure 2). Sequence scored a value of 2.835, which is lower than the threshold value of
2.965. The difference between the value and the threshold
indicates the possibility of the protein being an outer
membrane protein.
Prediction of Protein Structure
The result obtained from “SOPMA” is presented in
the form of graphics (Figure 3). The tool described that about
39.75 % of amino acids presented in Alpha helix, 10.25% of
amino acids in beta turn, 36.02% of amino acids in random
coil, 13.98% of amino acids in extended strand and rest of all
amino acids in bridge and turn (Figure-3). “TMpred” suggestions are purely speculative and
should be used with extreme caution since they are based on
the assumption that all transmembrane helices have been
found.In most cases, the Correspondence Table-3 shown or
the prediction plot (Figure-4) that is also created should be
used for the topology assignment of unknown proteins.
2 possible models considered, only significant TM-
segments used
-----> STRONGLY preferred model: N-terminus outside
1 strong transmembrane helices, total score: 1238
# from to length score orientation 1 183 204 (22) 1238 o-i
------> alternative model 1 strong transmembrane helices, total score: 922
# from to length score orientation1 185 204 (20) 922 i-o
The homology model was builted from sequence of
L-asparaginase from Streptomyces radiopugnans MS1and as
per multiple alignment result Strptomyces l-asparaginase
used as a template structure. The homology modelling was
done through the swissmodel server and phyre2 were founded
as the best server among of all others software or server. The
predicted structure quality was good through different
software as compared with others.Figure 5 & 6 showed the
structure obtained through “swiss model workspace server” and “Phyre 2”respectively.
5 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
“Figure: 5, Swiss model workspace reports.”
“Figure :6, Secondary structure and disorder prediction by
Phyre2”.
Characterization of Structure:
The amino acid composition of the L-asparaginase
was showed in table table: 3 (A) and (B).The sequence of L-
Asparaginase was analyzed by the computer program
Protparam in order to find the physical and chemical
properties. (Table: 4)
Evaluation and validation of refined model
The model generated by the above method was
subjected to validation using the following softwares: I)
Ramachandran Plot using RAMPAGE server: The
Ramachandran plot for the modeled structure showed 87.9%
of the residues in the most favored region, 6.4 % in the additional allowed region, and 5.8% in the generally allowed
region and no residues in the unfavorable region (Figure-7)
and Ramachandran Plot Statistics from Richardson's lab
(Figure-8).
“ProSA” tool graph showed all over model quality
of the structure and the location of the z-score for the
structure. The value, -1.39, was in the range of native
conformation. It also represents the point of the structure
which was within a range which was determined by X-ray
and NMR studies (Figure 9 A & B).
The root mean square deviation (RMSD) score was calculated using the sequence identity and gaps in the
alignment displaying RMSD for bond anglees 4.6o, bond
“Figure :7, Ramachandran plot values showing number of
residues in favoured, allowed and outlier region”.
“Figure:8, Residue Plot of Ramachandran anlysis(based on
data from Richardson Lab's Molprobity”.
lengths 0.026 Å ,RMS Z-score : 1.951 and RMS-deviation in
bond distances: 0.026.zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz
Validation report of WHATIF server described that all over
6 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
“Figure:9 A, Overall model quality--“ProSA” tool graph”.
“Figure:9 B, Local model quality-“ProSA” tool graph”.
“Figure: 10, Errat plot for Streptomyces radiopugnans MS1 L-Asparaginase model. Black bars show the misfolded region
located distantly from the active site, gray bars demonstrate
the error region between 95% and 99%, white bars indicate
the region having less error rate for protein folding.
Expressed as the percentage of the protein for which the
calculated error value falls below the 95% rejection limit,
good high resolution structure generally produce values
around 95% or higher. For lower resolution (2.5 to 3A) the
average over all quality factor is around 91%”.
the structure was alright with negligible error. The tool
validated structure scale and symmetry, atom coordination,
nomenclature, geometry, accessibility, bumping, 3-D
database, B-factor and hydrogen bond. Mostly in all
parameters reports were alright and Z score was obtained
within range. Errat plot assesses the arrangement of different types
of atoms with respect to each other in protein models (Fig.
10). Errat is a sensitive technique, which is good for
identifying incorrectly-folded regions in preliminary protein
models. ERRAT is a so-called „„overall quality factor‟‟ for
non-bonded atomic interactions, and higher scores mean
higher quality22. In the current case, the ERRAT score for
the model is 25.641.
L-asparaginase was validated with Phyre2 177
residues (55% of your sequence) have been modelled with
96.6% confidence by the single highest scoring template
(Figuer 11).
Comparison of the structure of L-asparaginase From the time when the alignment results of
Streptomyces radiopugnans MS1 Lasparaginase showed
homology to Streptomyces pristinaespiralis ATCC 25486
[46] L-asparaginase II. The structure of L-asparaginase was
superposed with the Streptomyces pristinaespiralis ATCC
25486 (Sippl 2008). L-asparaginase II, which showed that in
10 residues pairs that were structurally equivalent the
identities of the overall structure were around 84% (Figure
12).
Binding site analysis of L-Asparaginase Once final model was build and validated, the
possible binding sites of L-Asparaginase were searched using
Phyre2 server [47] .Eight different Ligand cluster were
identified and predicted binding aminoacid were Ala (158), Thr (159),Met (254),Gly (255),Ala (256).Table:5 (A & B)
,Figure 13 and Hetrogens present in predicated Binding site
(SUC and CFX) Table (5 C).
Docking For docking, the ligand structure were obtained from the
PubChem database.33 In order to investigate the substrates
binding with the enzyme, we attempted to dock L-Glutamine
and L-Asparagine and to L-Asparaginase enzyme model of
Escherichia coli str. K-12 substr. MG1655, Pectobacterium
atrosepticum SCRI1043 and Streptomyces pristinaespiralis
ATCC 25486. The top docking solutions of 3000 inter action
results for each ligand was selected. This result confirms that
the most preferred substrate for Streptomyces radiopugnans MS1 is the L-Asparagine. Since its binding energy is the
smallest one (Table-6).
DISCUSSION In the current study, the L-asparaginase protein was
evaluated from gene to protein. The homology modelling was
done through the http://www.ebi.ac.uk/Tools/clustalw, which
was found as the best.
Software among of all other software or server. The
7 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
“Figure:11, Model validated by Phyre2”.
“Figure:12, Comparison of protein models by Topmatch
tool”.
structure obtained through computation was validated
through Phyre2, ProSA, Verfy 3D and Errat.The structure
was naturally stable with low energy value. In WHATIF
report, validation of the structure of L-asparaginase was OK.
In structure scale and symmetry, atom coordination,
nomenclature, geometric, accessibility, bumping, 3-D
database, B-factor and hydrogen bond, mostly in all parameters reports were ok with getting the Z score within
the range. The predicted structure was superposing with
reported sources and up to 79% homology was found with
Strptomyces L-Asparaginase. The result showed that the
predicated structure might be a favorable protein for human
for the treatment of ALL.
“Figure:13, Structural view of predicated potential binding
sites by 3DLigandSite server”.
“Figure:14, Validate the active site architecture of the
Streptomyces radiopugnans MS1 L-asparaginase model with
L-Asparagine”.
The ligand efficiency was one of the major points in structure
characterization. The model which was obtained from
computational method also gives a favorable binding
efficiency with the L-asparagine. The active site was found
different eight places on the model, among these; one was
ideally efficient against the substrate with gives lowest
energy value for docking. The residual of the active site where most of similar with Streptomyces sps active site
residual which was obtained from crystallography methods.
The structure showed high efficiency towards the lasparagine
as well as no efficiency against L-glutamine, so may be
L-asparaginase from Streptomyces radiopugnans MS1
will be a novel source for treatment for ALL as its have no
8 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
Table 1: CLUSTAL 2.1 Multiple Sequence Alignments Score of L-Asparaginase enzyme
SeqA Name Length SeqB Name Length Score
1 Seq1 322 2 Seq2 324 79
1 Seq1 322 3 Seq3 334 74
1 Seq1 322 4 Seq4 321 74
1 Seq1 322 5 Seq5 314 50
2 Seq2 324 3 Seq3 334 73
2 Seq2 324 4 Seq4 321 71
2 Seq2 324 5 Seq5 314 53
3 Seq3 334 4 Seq4 321 72
3 Seq3 334 5 Seq5 314 51
4 Seq4 321 5 Seq5 314 51
Note: Seq1: Streptomyces radiopugnans MS1,Seq2 : Streptomyces pristinaespiralis ATCC 25486,
Seq3: Streptomyces albus J1074 Seq4: Streptomyces sp. SPB78,Seq5 : Streptomyces sp. AA4.
Table 2: Here is shown, which of the inside->outside helices correspond to which of the
outside->inside helices.Helices shown in brackets are considered insignificant.
Inside -> outside | outside -> inside
(30 - 53 (24) 175) | (30 - 54 (25) 303 +)
185 - 204 (20) 922 | 183- 204 (22) 1238 ++
A"+"-symbol indicates a preference of this orientation.
A "++"-symbol indicates a strong preference of this orientation.
Table 3(A): The amino acid composition of the L-asparaginase was computed using the PEPSTATS.
Residue Number Mole% DayhoffStat
A = Ala 58 18.012 2.094
C = Cys 3 0.932 0.321
D = Asp 17 5.28 0.96
E = Glu 19 5.901 0.983
F = Phe 7 2.174 0.604
G = Gly 31 9.627 1.146
H = His 8 2.484 1.242
I = Ile 5 1.553 0.345
K = Lys 4 1.242 0.188
L = Leu 40 12.422 1.679
M = Met 10 3.106 1.827
N = Asn 5 1.553 0.361
P = Pro 23 7.143 1.374
Q = Gln 4 1.242 0.319
R = Arg 25 7.764 1.584
S = Ser 16 4.969 0.71
T = Thr 14 4.348 0.713
V = Val 28 8.696 1.318
W = Trp 2 0.621 0.478
Y = Tyr 3 0.932 0.274
9 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
Table 3(B): The amino acid composition of the L-asparaginase was computed using the PEPSTATS.
Property Residues Number Mole %
Tiny (A+C+G+S+T) 122 37.88
Small (A+B+C+D+G+N+P+S+T+V) 195 60.559
Aliphatic (A+I+L+V) 131 40.683
Aromatic (F+H+W+Y) 20 6.211
Non-polar (A+C+F+G+I+L+M+P+V+W+Y) 210 65.217
Polar (D+E+H+K+N+Q+R+S+T+Z) 112 34.783
Charged (B+D+E+H+K+R+Z) 73 22.671
Basic (H+K+R) 37 11.491
Acidic (B+D+E+Z) 36 11.18
Table 4: Physicochemical and structural data of Streptomyces radiopugnans MS1 of L-Asparaginase extracted from ProtParam
tool of the Expasy proteomics server”.
S.No Physicochemical Character Data
1 Aminoacid Length: 322
2 Average Theoretical pI/Mw: 5.64 / 33319.27
3 Monoisotonic Theoretical pI/Mw: 5.64 / 33340.28
4 Charge: -3
5 Negatively charged residues (Asp + Glu): 36
6 Positively charged residues (Arg + Lys): 29
7 Abscent amino acid: B,Z,X
8 Common amino acid: A,L,G
9 The instability index (II): 27.55, protein as stable
10 Aliphatic index: 97.73
11 Total number of atoms: 4709
12 Formule: C1461H2370N428O437S13
13 Grand average of hydropathicity (GRAVY): 0.167
14 The estimated half-life 30 hours
15 A280 Molar Extinction Coefficients 15470 (reduced) 15595 (cystine bridges)
16 A280 Extinction Coefficients 1mg/ml 0.464 (reduced) 0.468 (cystine bridges)
17 Improbability of expression in inclusion bodies 0.586
Table 5A: Binding site analysis of L-Asparaginase.
Ligand Clusters Identified
Note prediction based on first cluster
MAMMOTH Scores
Cluster Ligands Structures Av min max
1 4 4 11.6 9.5 13.2
2 3 3 10.6 8.4 12.4
3 2 2 10.8 9.5 12.2
8 1 1 15.7 15.7 15.7
6 1 1 13.1 13.1 13.1
7 1 1 13.1 13.1 13.1
5 1 1 8.4 8.4 8.4
4 1 1 8.3 8.3 8.3
10 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
Table 5C: Heterogens present in Predicted Binding Site.
Heterogens present in Predicted Binding Site
Heterogen Count source structures
SUC 2 1l0g_A,2hds_A
CFX 2 1i2w_B,1ymx_B
Table 6: Substrate specificity through docking.
S.No Protein Source Ligand
Estimated Free
energy of
Binding
1 Streptomyces radiopugnans MS1 L-Asparagine -125.25
L-Glutamine -0.18
2 Streptomyces pristinaespiralis ATCC 25486 L-Asparagine -119.53
L-Glutamine -0.75
3 Escherichia coli str. K-12 substr. MG1655 L-Asparagine -118.17
L-Glutamine -105.18
4 Pectobacterium atrosepticum SCRI1043 L-Asparagine -117.37
L-Glutamine -66.46
L-glutaminase activity.
The wet lab data on the enzyme- substrate kinetics
were supported to docking data against l-asparagine [48].In
the present study, a homology model of Bacterial L-
asparaginase from Streptomyces radiopugnans MS1 was
obtained in order to provide a reliable model with which to
design new inhibitors and to investigate the treatment of ALL using novel protein sources. In the absence of the
experimental structure of Lasparaginase,it is believed that the
model presented through this work will be useful for further
studies on novel sources of Lasparaginase for treatments of
ALL.
Referance
1 Narta, U.K. et al., (2007). Pharmacological and
clinical evaluation of L-asparaginase in the treatment of
leukemia. Crit. Rev. Oncol./Hematol. 61, 208–221.
2. Kotzia, G.A., Labrou, N.E., 2007. L-Asparaginase
from Erwinia chrysanthemi 3937: cloning, expression
and characterization. J. Biotechnol. 127, 657–669. 3. Albert L, Simon S. (1997) Pharmaceutical
Enzymes. New York: Marcel Dekker Inc Publishing;
223-260.
4. Broome, J. D. (1961) Nature, 191:1114–1115.
Doi: 10.1038/1911114a0.
5. Mashburn, L., & Wriston, J. C. (1964) Archives
of Biochemistry and Biophysics 105:450–452.doi:
10.1016/0003-9861 (64)90032-3.
6. Eden, O. B., et al., (1990) Medical and Pediatric
Oncology 18:497–502. doi:10.1002/mpo.2950180612.
7. Asselin, B. L., et al (1993) Journal of Clinical
Oncology 11:1780–1786.
8. Berman, HM., et al. (2000) The protein data bank. Nucl Acids Res. 28:235–42.
9. Thompson, JD., et al. (1994) CLUSTAL W:
improving the sensitivity of progressive multiple
sequence alignment through sequence weighting,
position-specific gap penalties and weight matrix
choice. Nucleic Acids Res., 22:4673-4680.
10. Fakher Rahim. (2010) An in Silico Development
of Selective Inhibitor for Histamine Receptors.
Biotechnology.9(2):157-163. DOI: 10.3923/biotech.
2010.157.163.
11. Usman S.F. et al. (2008) In silico Mutation Study
of Haemagglutinin and Neuraminidase on Banten Province Strain Influenza A H5N1 Virus. Trends in
Bioinformatics.1 (1):18-24. DOI: 10.3923/tb.2008.
18.24.
12. Abro,G.H., et al. (2004) Performance of
Transgenic Bt Cotton Against Insect Pest Infestation.
Biotechnology.3 (1):75-.81. DOI: 10.3923/biotech.
2004.75.81.
11 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
13. Jorg Schultz., et al(1998) a simple modular
architecture research tool: Identification of signaling
domain Proc. Natl. Acad. Sci. 95:5857-5864.
14. Pantelis, G,. et al. (2004) PRED-TMBB: a web
server for predicting the topology of ß-barrel outer
membrane proteins Nucleic Acids.; Research 32. 15. Altschul,. et al., (1997) Gapped BLAST and PSI-
BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
16. Schaffer., et al. (2001) "Improving the accuracy of
PSI-BLAST protein database searches withcomposition-
based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.
17. Aubrey, A.,et al.(2011). In silico Characterization
and Homology Modeling of Cyanobacterial
Phosphoenolpyruvate Carboxylase Enzymes with
Computational Tools and Bioinformatics Servers.
American Journal of Biochemistry and Molecular Biology.1(4):319-336. DOI: 10.3923/ajbmb.2011.
319.336.
18. Bijan Ranjbar .,et al.(2006). Effects of Glyoxime
and Dichloroglyoxime on Lysozyme: Kinetic and
Structural Studies. Asian Journal of Biochemistry.1
(2):153-161. DOI: 10.3923/ajb.2006.153.161.
19. Nuanchai,K., (2009) In vitro Degradation
Behavior of Bombyx mori Silk Fibroin Films Exposure
to Protease XXIII.8 (4):468-472. DOI: 10.3923/
biotech.2009.468.472
20. Saad Osman Abdalla and Safaai Deris (2005)
Predicting Protein Secondary Structure Using Artificial
Neural Networks: Current Status and Future Directions.
Information Technology Journal.4(2):189-196.
21. Arnold, K,. et al. (2006) The SWISS-MODEL
Workspace:A web-based environment for protein
structure homology modelling. Bioinformatics. 22:195–
201.
22. Aubrey A. Smith and Manuela C. Plazas .
(2011).In silico Characterization and Homology
Modeling of Cyanobacterial Phosphoenolpyruvate
Carboxylase Enzymes with Computational Tools and Bioinformatics Servers.1 (4):319-336. DOI: 10.3923
/ajbmb.2011.319.336.
23. Angshuman Bagchi and Tapash Chandra
Ghosh.(2007) Homology Modeling and Molecular
Dynamics Study of the Interactions of SoxY and SoxZ:
The Central Player of Biochemical Oxidation of Sulfur
Anions in Pseudaminobacter salicylatoxidans. Research
Journal of Microbiology.2 (7):569-576. DOI: 10.3923/
jm.2007.569.576.
24. Rice, P., et al. (2000) The european molecular
biology open software suite. Trends Genet 16:276-277.
25. Combet,C., et al., (2000)NPS@; Network protein sequence analysis,Trends Biochem.Sci 25:147-150.
26. Eisenaber,F., et al. (1996) Prediction of secondary
structural content of proteins from their amino acid
composition alone. I.New analytic vector decomposition
methiods.Proteins Struct. Funct, Design 25:157-168.
27. Mirhashemi S.M., and Aarabi M.H., (2011)To
Study Various Concentrations of Magnesium and
Aluminium on Amylin Hormone Conformation.
Pakistan Journal of Biological Sciences.14 (11):653-657. DOI: 10.3923/pjbs.2011.653.657.
28. Bijan Ranjbar., et al.(2006) Effects of Glyoxime
and Dichloroglyoxime on Lysozyme: Kinetic and
Structural Studies.1(2):153-161. DOI: 10.3923/ajb.
2006.153.161.
29. Prajapat, R., et al.(2011) Homology Modeling and
Docking Studies Between AC1 Rep Protein of
Begomovirus and Whey α-lactalbumin. Asian Journal of
Biological Sciences.4(4):352-361. DOI: 10.3923/ajbs.
2011.352.361
30. Rajneesh Prajapat., et al.(2011) Phylogenetics and
in silico Docking Studies Between Coat Protein of Mimosa Yellow Vein Virus and Whey α-lactalbumin.
American Journal of Biochemistry and Molecular
Biology.1(3):265-274. DOI: 10.3923/ajbmb. 2011.265.
274.
31. Aparna Laskar., et al. (2011) Molecular Modeling
and Structural Analysis of Five SE Clan (S12 Family)
Serine Proteases. Asian Journal of Biotechnology.
3(5):435-448. DOI: 10.3923/ajbkr.2011.435.448.
32. Bowie, JU,. et al. (1991) A method to identify
protein sequences that fold into a known three-
dimensional structure. Science. 253:164–70. 33. Colovos C and Yeates TO. (1993) Verification of
protein structures: patterns of Non bonded atomic
interactions. Protein Sci. 2:1511–9.
34. UCLA-DOE Institute for Genomics & Proteomics
Server http://www.doe-mbiucla.edu/Services
35. Wiederstein and Sippl. (2007) ProSA-web:
interactive web service for the recognition of errors in
three-dimensional structures of proteins. Nucleic Acids
Research 35: W407-W410.
36. Vriend,G., and Sander,C. (1993) Quality control
of protein models: Directional atomic contact analysis. Journal of Applied Crystallography 26:47-60.
37. Sippl & Wiederstein (2008) A note on difficult
structure alignment problems.Bioinformatics 24: 426-
427.
38. Protein structure prediction on the web: a case
study using the Phyre server Kelley LA and Sternberg
MJE. Nature Protocols 4, 363
39. Ritchie, DW, (2008) Recent progress and future
directions in protein–protein docking.Current .Protein
and Peptide Science. 9:1–15.
40. Rithcie, DW,. (2003) Evaluation of Protein
Docking Predictions using Hex 3.1 in CAPRI rounds 1–2. Proteins: Struct Funct Genet. 52:98–106.
41. Amir, M.A., et al. (2011) In silico Molecular
Docking of Influenza Virus (PB2) Protein to Check the
12 International Journal of Research in Biotechnology and Biochemistry 2012; 2(1) : 1-12
Drug Efficacy. Trends in Bioinformatics.4(1):47-55.
DOI: 10.3923/tb.2011.47.55.
42. Noorbatcha, I.A., et al. (2009) Modification and
Characterization of Phytase for Animal Feed
Production. Journal of Applied Sciences.9(17):3080-
3085. DOI: 10.3923/jas.2009.3080.3085. 43. Jutti Levita., et al.(2010) Andrographolide Inhibits
COX-2 Expression in Human Fibroblast Cells Due to its
Interaction with Arginine and Histidine in
Cyclooxygenase Site.10(14):1481-1484. DOI: 10.3923/
jas.2010.1481.1484
44. Hetenyi C and van dar Spoe LD. (2006) Blind
docking of drug-sized compounds to proteins with up to
a thousand residues. FEBS Lett. 580:1447–50.
45. Nathan, ST., et al. (2005) Structure of
glutathioneS-transferase of the filarial parasite
Wuchereriabancrofti: a target for drug development
against adult worm. J Mol Mod. 11:194–9.
46. Sippl., (2008) On distance and similarity in fold
space. Bioinformatics 24:872-873. [view] 47. Wass M.N.,et al. (2010) 3DLigandSite: predicting
ligand-binding sites using similar structures.NAR
38:W469-73. PubMed.
48. Senthil kumar.M and Selvam.k (2011) Isolation
and Purification of High Efficiency L-asparaginase by
Quantitative Preparative Continuous-elution SDS PAGE
Electrophoresis, Microbial & Biochemical Technology
3(5):073-083.
Source of support: Nil; Conflict of interest: None declared
top related