january - april 2003 volume 37 number 1 - ku...
Post on 16-Apr-2020
6 Views
Preview:
TRANSCRIPT
Kasetsart Journal : N
atural Science January - A
pril 2003 Volum
e 37 Num
ber 1
January - April 2003
Volume 37 Number 1
The Kasetsart Journal
Advisor : Napavarn Noparatnaraporn
Rangsit Suwanketnikom
Editor-in-Chief : Ed Sarobol
Associate Editors : Wanchai Chanprasert, Natural Science
Suparp Chatraphorn, Social Science
Editorial Board : Natural Sciences Social Sciences
Amara Thongpan Suwanna Thuvachote
Pornsri Chairatanayuth Pongpan Trimongkholkul
Onanong Naivikul Nongnuch Sriussadaporn
Praparat Hormchan Patana Sukprasert
Korchoke Chantawarangul
Aree Thunyakijjanukij
Overseas Members
G. Baker (Mississippi State University, USA.)
A. Bruce Bishop (Utah State University, USA.)
John Hampton (Lincoln University, New Zealand)
Helen H. Keenan (University of Stathclyde, Scotland)
Chitochi Miki (Tokyo Institute of Technology, Japan)
Eiji Nawata (Kyoto University, Japan)
Manager : Orawan Wongwanich
Assistant Managers : Surai Suwannarat
Business Office : Kasetsart University Research and Development Institute (KURDI)
Kasetsart University, Chatuchak, Bangkok 10900.
The Kasetsart Journal is a publication of Kasetsart University intended to make available the results
of technical work in the natural and the social sciences. Articles are contributed by Kasetsart University faculty
members as well as by those from other institutions. The Kasetsart Journal : Natural Sciences edition is issued
four times per year in March, June, September and December while The Kasetsart Journal : Social Sciences
edition is issued twice a year in June and December.
Exchange publications should be addressed to
The Librarian,
Main Library,
Kasetsart University,
Bangkok 10900, Thailand.
KASETSART JOURNALNATURAL SCIENCE
The publication of Kasetsart University
VOLUME 37 January - April 2003 NUMBER 1
Screening Methods for High Yield Corn Inbreds in Honeycomb Design and Performances
of Their Hybrid Combinations
.............................................. Krisda Samphantharak and Tanapong Ouanklin 1
Development of Male and Female Parents of F1 Hybrid in Chinese Cabbage
................. Ekapote Payakhapaab, Tragool Tunsuwan, Chokchai Chimonkon,
................................................... Dumdern Karadee and Maneechat Nikonpun 5
Soybean Yield and Nutrient Composition as Affected by Soil and Foliar Fertilizations
........................ Chin Theng Phiv, Chawalit Hongprayoon, Peerasak Srinives,
.................................................... Arunsiri Kumlung and Yongyuth Osotsapar 14
Preliminary Test of Polyploidy Induction in Cotton (Gossypium arboreum)
Using Colchicine Treatment
.... Arunee Wongpiyasatid, Praparat Hormchan and Ngamchuen Rattanadilok 27
Cloning and Nucleotide Sequence of Four tRNA Genes in Mitochondrial Genome
of Thai Walking Catfish, Clarias macrocephalus Günther
......................................................... Pradit Sangthong and Amnuay Jondeung 33
Relation of Paralumbar Nerves and Conus Medullaris to the Vertebrae of Swamp Buffaloes
................................. Narong Chungsamarnyart, Worawut Rerkamnuaychoke
..................................................................................... and Nati Nilnophakoon 41
Isolation of Anti-malarial Active Compound from Yanang (Tiliacora triandra Diels)
............................................................. Chalerm Saiin and Sutthatip Markmee 47
Synergistic Effects of Sesame Oil with Cypermethrin on the Survival and Detoxification
Enzyme Activity of Plutella xylostella L. Larvae
......... Suraphon Visetson, John Milne, Manthana Milne and Pintip Kanasutar 52
Development of Fish Strip from Hybrid Clarias Catfish Surimi Fortified with Konjac Flour
........ Benjawan Chotpradit, Mayuree Chaiyawat and Nongnuch Raksakulthai 60
Antiaflatoxigenic Effect of Lactic Acid Bacteria Isolated From Some Thai Fermented Foods
............ Siriporn Stonsaovapak, Ladda Wattanasiritham and Aree Shuvisitkul 65
Using of Extrusion Process for Preparation of Instant Cereal Beverage Powders based
on Corn and Soybean
..... Chulaluck Charunuch, Pracha Boonyasirikool and Chowladda Tiengpook 72
The Optimum use of Salinity, Nitrate and Pond Depth and b-Carotene Production
of Dunaliella salina
....... Orapin Bhumibhamon, Udom Sittiphuprasert, Naiyana Boontaveeyuwat
........................................................................................ and Jantana Praiboon 84
Quantity and Distribution of Plant Nutrients on Eutrophication in Bang Pra Reservoir,
Chonburi Province
........ Ratcha Chaichana, Chumlong Arunlertaree, Boonsong Srichareondham
.................................................................................. and Narong Veeravaitaya 90
Fisheries in the Mun River: A One-Year Trial of Opening the Sluice Gates of the
Pak Mun Dam, Thailand
.Tuantong Jutagate, Chaiwut Krudpan, Praneet Ngamsnae, Kanjana Payooha
...................................................................................... and Thanatip Lamkom 101
Synthesis of Barium Titanate as an Electroceramic Raw Materials
................................................................................... Nuchnapa Tangboriboon 117
Kasetsart J. (Nat. Sci.) 37 : 1 - 4 (2003)
Screening Methods for High Yield Corn Inbreds in HoneycombDesign and Performances of Their Hybrid Combinations
Krisda Samphantharak and Tanapong Ouanklin
ABSTRACT
Plant selection method is changing accordingly with emerging new concepts of selections. One
of the most widely discussed concept is plant selection under nil competition environment in honeycomb
designs to avoid plant to plant competition, minimize soil heterogeneity, promote highest expression of
genetic potential, enhance differentiation among lines and facilitate line selection. This study designed
to compare moving circle selection and prediction criterion, PC = X ( ) /Xs X Sp- 2 with conventional
visual grid selection (selection 1 plant out of each 19 plants in the same row) in honeycomb design.
Grouped replicated R-49 honeycomb design and 40 replicated plants was used to screen 49 S7 inbreds
under nil competition environment. As a results, moving circle selection identified highest number of
diverse and good combine lines followed by PC and visual grid selection when tested in conventional
plant spacing, 0.75 ¥ 0.25 m. Top-7 hybrids were derived from top–5 inbreds of moving circle selection
while only 3 and 1 hybrids in the top-7 were derived from top-5 inbreds of PC and visual selection,
respectively. The results suggested that moving circle selection was the most effective method of
selection under this experimental conditions. However, considering time and cost efficiency, visual grid
selection is more practical for the identification of potential inbreds.
Key words: honeycomb, prediction criterion, moving circle
INTRODUCTION
Genetic and environmental interaction(GxE) is one of the most decisive factors for thesuccess or failure of plant selection. There are twokinds of environment, the one that can be controlledand the one that can not be controlled. Eventhough,plant densities are controllable environment butthere are different views for the optimum plantdensities for the effective line screening. It is acommonsense that plant screening should be doneunder the conditions that plants will be grown.However, conditions in farmers’ fields are variedwidely and the optimum conditions are impossibleto ascertain. To solve the problem, multilocation
yield trials are needed but it is very costly andpractically will carry out only for the mostpromising lines on the final screening. In addition,yield per unit area can be improved by increasingplant densities or increasing yield per plant withthe same densities. Troyer and Rosenbrook (1983)and Russell (1991) suggested that selection shouldbe done under higher plant densities as means toimprove grain yield of maize. Selection under highplant densities also increase heritabilities and gainsfor many traits (Eagles and Lothrop, 1994).Indirectly, selection under higher plant densitiesshould verify progenies that can tolerate morelimited moisture supplies, effectively use availablenutrients, effective in partitioning of available
Department of Agronomy, Faculty of Agriculture, Kasetsart University, Bangkok 10900, Thailand.
Received date : 20/01/03 Accepted date : 26/03/03
2 Kasetsart J. (Nat. Sci.) 37 (1)
photosynthates and survive greater pressures forsusceptibility to diseases and pests (Hallauer, 1990).On different poin of views, Fasoula and Fasoula(2000) suggested a selection under nil competionenvironment in honeycomb designs by movingcircle selection for effective control of soilheterogeneity and full expression of genotypes.Moreover, potential yield per plant ( X ), toleranceto stress (predicted by standardized entry mean,X /Sp) and response to input (predicted by thestandardized selection differential, ( ) /Xs X Sp- ),were proposed for analysis of yield components orprediction criterion (PC) = X ( ) /Xs X Sp- 2 . Thisstudy was conducted to evaluate the effectivenessof each selection method; moving circle, PC andvisual selections in honeycomb design in order toidentify useful inbreds and hybrid combinations.
MATERIALS AND METHODS
Forty-nine S7 inbreds from different sourcesof germplasm; Pioneer3012, Pioneer3013,Pacific328, Pacific700, CPDK888, CPDK999,G5445A, SW3853, Cargill919, Pop28 (HS), Ki32and Ki42 were planted in grouped replicated R-49honeycomb design with 40 replications. Plantspacing was equilateral triangle of side 0.86 m.,three seeds per hill and thined to 1 plant per hill at14th day after planting. Three selection methods;visual grid selection (1 out of 19 plants in the samerow), moving circle selection (1 out of 19 plants inthe circle) and prediction criterion, PC =X ( ) /Xs X Sp- 2 as proposed by Fasoula andFasoula (1997b) were applied in the sameexperimental plot. Selections were based onprediction criterion values and selectionfrequencies of each inbred by the other two selectionmethods. Top-5 inbred lines from each selectionmethod were selected.
The remnant seeds of selected inbreds wereseparately planted in non-replicated honeycombdesign, 0.86 m. spacing among plants and 3 plantsfrom each line were selected and bulked, separately.They were crossed in diallel series and the derived
hybrids and 4 checks were planted in randomizedcomplete block design with conventional spacing(0.75 ¥ 0.25 m.), 4 row plot of 5 meter rows and 2replications. Yields and desired agronomic traitswere recorded.
RESULTS AND DISCUSSION
Nil competition environment of each cropis depended upon plant types and root systems ofeach crop. For maize, Onenanyoli and Fasoulas(1989) used plant to plant space of 1.25 m. to avoidcompetition among plants. As a matter ofconvenience, the present study used plant to plantspace of 0.86 m. which fitted to the conventional0.75 m. row spacing being used at Suwam Farm.Under the present study plant to plant space of 0.86m. seemed to be adequate for corn inbreds becausewide gap among plants and full expression ofplants were observed.
Five selected inbreds out of 49 inbreds byeach selection method were presented in Table 1.From total of 15 selected inbreds (3 selectionmethods), only 8 inbreds were different. Theremaining 7 inbreds; 3 selected inbreds (Agron13,Argon26 and Agron27) from PC and 2 selectedinbreds (Agron26, Nei9201) from visual selectionwere overlapped with selected inbreds from movingcircle method. The other 2 selected inbreds(Agron4, Agron6) from visual selection wereoverlapped with selected inbreds from PC method.Considering the 5 selected inbreds of each selectionmethod and their original sources presented inTable 1, selected inbreds from PC methodcomprised of 3 inbreds originated fromPioneer3013 (Agron4, 6 and 26) 1 inbred fromG5445A (Agron27) and 1 inbred from SW3853(Agron13). The visual selection method rendered3 inbreds from Pioneer3013 (Agron4, 6 and 26) 1inbred each from Cargill 919 (Agron21) and Pop28(Nei9201). The moving circle method rendered amore diverse inbreds; 2 inbreds from SW3853(Agron12 and 13) and 1 inbred each fromPioneer3013 (Agron26), G5445A (Agron27) and
Kasetsart J. (Nat. Sci.) 37 (1) 3
Table 1 Selected top-5 of 49 S7 inbreds by each of 3 selection methods planted in grouped replicated
R-49 honeycomb design with equilateral triangular side of 0.86 m. and 40 replications.
Prediction criterion1 Moving circle selection Visual grid selection
Entry2 PC value Entry2 Frequency Entry2 Frequency
Agron27 3.11 Agron26 17 Agron6 11
Agron4 2.74 Agron12 14 Agron26 10
Agron13 2.64 Agron27 14 Agron4 6
Agron6 2.53 Nei9201 14 Agron21 6
Agron26 2.52 Agron13 11 Nei9201 6
1 PC = X Xs X Sp( ) /- 2
2 Original sources of inbreds in Table 1:
Pioneer3013 = Agron4, Agron6 and Agron26
G5445A = Agron27
SW3853 = Agron12 and Agron13
Cargill 919 = Agron21
Pop28(HS) = Nei9201
pop28 (Nei9201). Table 2 showed yields and otheragronomic traits of top-10 hybrids out of 28 hybridsfrom diallel cross of 8 selected inbred lines fromthe 3 selection methods. The high effeciency ofmoving circle selection was obviously displayed.Top –7 hybrids were derived from selected inbredsof moving circle selection and there were only 3and 1 hybrids in top-7 hybrids which had inbredsin common with inbreds from PC and visualselections, respectively. The Agron6 x Agron12hybrid ranked 8th comprised of inbreds from visualand moving circle selection. The Agron6 x Nei9201and Agron4 x Agron27 hybrids ranked 9 th and10 th derived from crossing of inbreds from visualselection and PC, respectively. The top5 hybridswere comparable to checks (hybrids derived fromearly generation testing for combining abilityprogram previously conducted) but statistically,better than the commercial hybrid, Pioneer3013.Therefore, selection for inbred per se under nilcompetition environment or for their combiningabilities were equally effective for the identificationof inbreds of which could render hybrids withsimilar yield levels, eventhough, they were different
inbreds. However, high yield inbreds hadadvantages on seed production and maintaining ofinbred lines. Using selection frequency of movingcircle selection and visual grid selection to identifystable lines in replicated honeycomb designs shouldbe an effective selection method for high yield andstable inbreds without any complicate calculationas compared to PC method. However, if moreselected inbreds (10 inbreds) from each selectionmethod were saved, all 3 methods were equallyeffective to identify potential inbred lines.Considering time and cost efficiency, visual gridselection with selection frequency of each lineshould be the most effective method for theidentification of potential inbreds. For populationimprovement, selection for inbred per se under nilcompetition environment in honeycomb designsfollowed by hybrid yield trials under high densitiesshould be a good combination to get high yieldinbreds and hybrids which can be grown underwide ranges of plant densities (Tokatlidis et al.,2001).
4 Kasetsart J. (Nat. Sci.) 37 (1)
LITERATURE CITED
Eagles, H.A. and J.E. Lothrop. 1994. Highlandmaize from central Mexico-its origin,characteristics, and use in breeding programs.Crop Sci. 34 : 11-19
Fasoula, D.A. and V.A. Fasoula. 1997a.Competitive ability and plant breeding. PlantBreed. Rev. 14 : 89 -138.
Fasoula, D.A. and V.A. Fasoula. 1997b. Geneaction and plant breeding. Plant Breed. Rev.15 : 315-374.
Fasoula, V.A. and D.A. Fasoula. 2000. Honeycombbreeding : Principles and application. PlantBreed. Rev. 18 : 177-250.
Fasoulas, A.C. and V.A. Fasoula. 1995.
Honeycomb selection designs. Plant Breed.Rev. 13 : 87-139.
Hallauer, A.R. 1990. Methods used in developingmaize inbreds. Maydica 35: 1-6.
Onenanyoli, A.H.A. and A.C. Faoulas.1989. Yieldresponse to honeycomb selection in maize.Euphytica 40 : 43-48.
Russell, W.A. 1991. Genetic improvement of maizeyields. Adv. Agron. 46 : 245-298.
Tokatlidis, I.S., M. Koutsika-Sotiriou and A.C.Fasoulas.2001. The development of density-indepdent hybrids in maize. Maydica 46 : 21-25.
Troyer, A.F. and R.W. Rosenbrook.1983. Utilityof higher plant densities for corn performancetesting. Crop Sci. 23 : 863-867.
Table 2 Means of agronomic traits and grain yields of top-10 hybrids (S7x S7) from diallel cross of 8
selected inbreds from 3 selection methods planted at Suwan Farm in conventional row spacing
0.75 ¥ 0.25 m.
Hybrid Grain yield Days to Days to Ear Plant Shelling 100
at 15% tasseling silking height height (%) grain
moisture -50% -50% (cm) (cm) weight
(kg/ha) (g)
Agron12 X Agron27 6275a 52i 50j 133gh 195fg 85f-j 23d-f
Agron26 X Nei9201 6018a-c 51j 50k 155fg 211c 86c-f 25a
Agron13 X Agron26 5837b-d 52f 50j 117d-f 202d 86cd 24cd
Agron27 X Nei9201 5743b-e 50i 50k 118de 202d 84k-m 24bc
Agron26X Agron27 5712b-e 52i 51h 109jk 199de 83k-m 25ab
Agron12 X Agron26 5481d-g 53f 53f 117ef 194hi 88ab 22gh
Agron13X Agron27 5462e-g 51k 50j 111ij 186kl 83mm 21ik
Agron6X Agron12 5343f-h 53f 52g 119cd 197e-g 85f-j 23ef
Agron6X Nei9201 5331f-h 52i 52g 106lm 197e-g 82mm 23c-e
Agron4 X Agron27 5168g-i 53g 54d 109jk 173n 85c-g 18pq
Checks:
Agron14 X Agron29* 6043ab 50i-m 51i 102op 188jk 84g-k 23f
Agron20 X Agron29* 5712b-e 52e-i 51i 92u 185kl 86c 20k-m
Agron30 X Agron32* 5656c-f 52e-i 48l 101p 174n 84h-l 17q-s
Pioneer 3013 5343f-h 48m 54d 97qr 179m 83k-n 20jk
Mean 4574 52 52 103 184 84 20
CV (%) 17 1.36 1.35 4.67 3.57 3.05 7.64
* Top hybrids of selected inbreds (S7) from early generation testing (topcross) program previously conducted.
Kasetsart J. (Nat. Sci.) 37 : 5 - 13 (2003)
Development of Male and Female Parents of F1 Hybrid inChinese Cabbage
Ekapote Payakhapaab, Tragool Tunsuwan, Chokchai Chimonkon,Dumdern Karadee and Maneechat Nikonpun
ABSTRACT
Male and female parents were improved to produce good hybrid progenies of Chinese cabbage,
a highly self-incompatible vegetable crop. Hybrid seed production using bees was also studied. Inbred
seeds of 4 Chinese cabbage lines were produced using bud pollination which is a conventional technique
for inbred lines. Results showed that line 40-9 gave the highest seed weight of 0.165 g/plant. Using seed
set analysis technique to check self-incompatibility, lines 23-3-4, 27, 27-3-7, and 40-9 were found to be
self-incompatible among the 9 Chinese cabbage lines evaluated. However, when fluorescent microscope
technique was used, the self-incompatible lines were 23-3-4, 27, 27-3-7, 40-9, and 142. Four inbred lines
with self-incompatibility were selected to produce seeds. When line 40-9 was used as female parent in
reciprocal crosses by bee pollination, the progenies gave the highest seed yield, an indication of maternal
effect. Crosses 40-9 x 142-5, 40-9 x 27-3-7 and 40-9 x 23-3-4 gave high seed weight of 4.8, 3.9 and 2.7
kg/rai, respectively. Comparison of 11 Chinese cabbage hybrids with 3 commercial varieties showed that
hybrid 142-5 x 40-9 gave the highest head yield with 6,170 kg/rai, 36.3% higher than commercial
varieties. Other crosses such as hybrids 23 x 27, 23 x 142, 27-3-7 x 23-”.-4, 27-3-7 x 142-5 and 40-9 x
23-3-4 had good horticultural characteristics. These results indicate that improvement of parental lines
is necessary to enhance good F1 hybrid.
Key words : Chiness cabbage, hybrid
Received date : 2/09/02 Accepted date : 02/12/02
INTRODUCTION
Chinese cabbage is not only a popular
vegetable throughout the country but also an
economical crop for export. Chinese cabbage grown
in Thailand are both open-pollinated and F1 hybrid
varieties. They are all imported from abroad so
seed price is very high. Popular Chinese cabbage
grown by farmers are hybrid varieties from Japan,
Taiwan and Korea.
The Vegetable Seed Production Thailand
project was supported by the International
Development Research Centre, Canada through
the Faculty of Agriculture, Chiang Mai University.
The project aimed to develop varieties of some
Brassica crops including Chinese cabbage and
their seed production. Chinese cabbage varieties
were collected from local markets and other
countries. Good F1 hybrid varieties were developed
from these varieties (Tunsuwan et al., 1997). Seed
production of open-pollinated Chinese cabbage
was tested in few locations under highland condition
and the results were satisfactory. Chimonkon et al.
(1997) developed self-incompatibility
Department of Horticulture, Faculty of Agriculture, Chiang Mai University Chiang Mai 50200, Thailand.
6 Kasetsart J. (Nat. Sci.) 37 (1)
characteristic of Chinese cabbage for F1 hybrid
seed production. This character can reduce labor
cost because emasculation of female parent is not
needed. Therefore, the price of F1 hybrid seeds is
reduced. Very often, the hybrid seeds can be
collected from both parents.
Self-incompatibility is a special
characteristic of some Brassica crops which
promotes cross-pollination and prevents self-
pollination of these crops. This characteristic is
controlled by multiple allelic genes at a single
locus. Pollen tube germination is inhibited by
stigma if they carry the same self-incompatible
genes (Nasrallah and Nasrallah, 1993; Nasrallah
et al., 1994; Isogai et al., 1987). The is a sporophytic
reaction in which 2n chromosome of S locus of
both parents controls the reaction (Gaude et al.,
1993; Pastuglia et al., 1997 and Nasrallah and
Nasrallah, 1993). Chinese cabbage also carries
self-incompatible genes of S locus. It is classified
into a sporophytic reaction (Opena et al., 1988).
The self-incompatible genes were used to develop
F1 hybrid Chinese cabbage for high yield and good
quality. Additionally, bee pollination was studied
for F1 hybrid seed production.
MATERIALS AND METHODS
1. Hand pollination of an unopened flower budfor inbred seed production
The seeds of Chinese cabbage Inbred lines
23-3-4, 27-3-7, 40-9 and 142-5 were germinated
for two days and then vernalized at 4-5∞C for 15
days before they were planted in the field in winter
of 1999 at Chiang Mai University. The
inflorescence was covered with paper bag before
blooming. When some flowers of the inflorescence
started to open, the paper bag was removed. The
young unopened flowers were forced to open by
forceps. The pollen from opened flowers of the
same inflorescence was used to pollinate the young
flowers. All other opened flowers were removed.
The inflorescence was covered with the same
paper bag. The seeds were collected at maturity.
2. Testing for self-incompatibility levelsTwo methods of testing for self-
incompatibility levels of Chinese cabbage were
used: seed set analysis and fluorescent microscope.
In seed set analysis method, unopened and opened
flowers of the same inflorescence were pollinated
with pollen from the same plant (Shinohara, 1981
; Opena et al., 1988). Ten plants with healthy
inflorescence from each inbred lines were selected.
About 3-4 healthy inflorescences per plant were
covered with paper bags. The open flowers were
removed before bagging. Two to three days after
bagging, both unopened and opened flowers were
emasculated and pollinated with pollen from the
same inflorescence of the same plant. The unopened
and the opened flowers were marked with string
and the inflorescence was covered with the same
paper bag. When the seeds matured, the number of
pods that set and number of seeds per pod were
counted.
Fluorescent microscope method was used
to observe pollen tubes in styles of female flowers
(Kho and Baer, 1968). Unopened and opened
flowers were taken from a plant and pollinated
with pollen from the same plant. The opened
flowers were emasculated and cross-pollinated
with pollen from different varieties.
Three types of flowers were collected: the
self-pollinated of the unopened flower, the self-
pollinated of the opened flower, and the cross-
pollinated of the opened flower. The flowers were
put on a slide in a petri dish containing potassium
dichromate (K2CrO4) solution underneath the slide.
The potassium dichromate kept the atmosphere in
the petri dish at 98%. The flowers were left in the
petri dish for 24 hrs. The styles of the flowers were
dissected and placed in 1 N sodium hydroxide.
The sample was boiled at 60∞C for 30 minutes. The
styles were washed with distilled water, stained
with aniline blue solution (0.2% diluted in 2%
potassium phosphate), and kept for 24 hrs. in a
Kasetsart J. (Nat. Sci.) 37 (1) 7
refrigerator. Then they were squashed with glycerin
on a slide and observed under fluorescent
microscope. The number of pollen tubes in each
style was counted.
3. F1 hybrid seed production by beesFour inbred lines of Chinese cabbage, 23-
3-4, 27-3-7, 40-9 and 142-5, were vernalized at 4-
5∞C for 15 days. They were planted in a field at a
distance of 30 cm between plants and 50 cm
between rows. Six seedlings were planted for each
line with 3 plants per row. Plot size was 2 x 2 m
with two plots per crossing. Each plot was planted
with 2 inbred lines, side by side. Twelve possible
crosses were made including reciprocals. A bee
hive was placed in each cross making sure that the
number of bees in each net was enough for
pollination. A salan net was used to cover the plots
to protect against insects and to keep honey bees
inside the net. The mature seeds were harvested
when pods dried.
4. Varietal evalution of F1 hybrid Chinesecabbage and control varieties
Randomized complete block design with 3
replications was used for this experiment. The F1
hybrid varieties were tested against 3 control
varieties such as Chang, Bomb 159 and Tapa 23.
Each treatment was planted in a 2 x 2 meters plot.
Eight plants were planted per plot at a spacing of
40 x 50 cm. Guard rows were planted around each
replication.
RESULTS
1. Hand pollination of an unopened flower budfor inbred seeds production
Inbred lines of Chinese cabbage were
different in seed set (Table 1). Line 40-9 gave the
highest seed weight of 0.165 g/plant, followed by
27-3-7 and 27 with 0.153 and 0.123 g/plant,
respectively. It was observed that unopened flowers
in the middle of an inflorescence produced the
highest seed number while unopened flowers at
the top and bottom of the inflorescence produced
few seeds or did not set seed at all. It was also
observed that the flowers which gave good seed
set were big but the yellow color of petals did not
yet show up.
2. Testing for self-incompatibility levelsTesting for self-incompatibility levels by
seed set analysis methodThe self-incompatibility levels of the plant
is indicated by the number of seeds set in the
opened flowers. Some inbred lines such as lines
27-3-7 and 40-9 showed strong self-
incompatibility. When the range of 0-25% of seed
setting was used to indicate strong self-
incompatibility levels, the strongest self-
incompatible line was 27-3-7 which showed 22.01
% seed set. It was followed by 40-9 and 23-3-4
with 24.72 and 29.24 % seed set, respectively.
When 25.5% of setting was used to indicate weak
self-incompatibility, the weak self-incompatible
Table 1 Seed weight from self pollinated Chinese cabbage.
Line Seed weight/plant (g)
40-9 0.165
27-3-7 0.153
27 0.123
23 0.076
142-5 0.047
23-3-4 0.032
8 Kasetsart J. (Nat. Sci.) 37 (1)
Table 2 Levels of self-incompatibility of Chinese cabbage lines, tested by seed set analysis.
Number of pod Number of seed
Line Unopened Opened Unopened Opened Seed set1 Conclusion2
flower flower flower flower (%)
23 15 15 210 80 38.10 WSI
23-3-4 15 15 236 69 29.24 WSI
27 15 15 193 96 49.74 WSI
27-3-7 15 15 231 51 22.01 SI
40-9 15 15 267 66 24.72 SI
142 15 15 253 88 34.78 WSI
142-5 15 15 245 79 32.24 WSI
1 0-25%-self-incompatibility, 26-50% weak self-incompatibility, 51-75% weak self compatibility and 76-100% self-compatibility.2 SI = self-incompatibility
WSI = week self-incompatibility
lines were 23, 27, 142, and 142-5 (Table 2 and
Figure 1).
Testing of self-incompatibility levels byfluorescent microscope technique
Chinese cabbage inbred lines were tested
for their self-incompatibility levels by fluorescent
microscope technique. Pollen tubes in styles of
unopened and opened flowers were observed using
fluorescent microscope after they were self-
pollinated. The inbred lines showed weak self-
incompatibility, weak and levels (Table 3). The
weak self-incompatible lines, 23-3-4, 27, 27-3-7,
40-9, and 142, showed low percentage of pollen
tubes in styles. Inbred lines 23, 40, and 142-5
showed some pollen tubes in their styles. They
were classified in both weak self-incompatible
and weak self-compatible groups. The self-
compatible line was 23-3-1 which showed 80% of
pollen tubes in opened flowers when self-pollinated
(Figure 2).
Comparing the two methods of evaluating
self-incompatibility levels, the results were
somewhat different. Seed set analysis method
showed strong self-incompatibility levels in lines
27-3-7, 40-9, and 23-3-4. However, the fluorescent
microscope technique showed weak self-
incompatibility levels in lines 23-3-4, 27, 27-3-7,
40-9, and 142. Some pollen tubes were found in
these lines under the fluorescent microscope. This
method of evaluation might be more sensitive than
the seed set analysis method. The pollen tubes
which were found in these lines might not be able
to convey to seed setting.
3. Bee pollination for F1 hybrid seed productionFour Chinese cabbage inbred lines, 23-3-4,
27-3-7, 40-9, and 142-5, were reciprocally crossed
with the use of bees. Seed yield of the crosses is
shown in Table 4. Seed weight ranged from 0.03 to
4.8 kg/rai. Cross 40-9 x 142-5 gave the highest
seed yield, 4.8 kg/rai. It was followed by crosses
40-9 x 27-3-7 and 40-9 x 23-3-4 which yielded 3.9
and 2.9 kg/rai, respectively. Seed yield as such
was rather low for seed production. There might
be some problems in bee pollination. Probably, the
size of the salan net (2.5 x 2.5 m) may be too small
for bee activities. The bees tend to stay in the hive
or are held on the salan. Maternal effects were
detected in line 40-9 as a mother plant compared to
the other mother lines (Table 4).
Kasetsart J. (Nat. Sci.) 37 (1) 9
Table 3 Levels of self-incompatibility of Chinese cabbage lines, tested by fluorescent microscope
technique.
Control Self pollinated Cross pollinated
Line Unopened Opened Unopened Opened Unopened Opened Conclusion
flower (%) flower (%) flower (%) flower (%) flower (%) flower (%)
23 - - 801 50 80 100 WSI2,WSC
23-3-1 - - 100 80 100 80 SC
23-3-4 - - 100 30 80 100 WSI
27 - - 50 30 30 100 WSI
27-3-7 - - 80 30 100 100 WSI
40 - - 80 50 100 50 WSI,WSC
40-9 - - 100 30 80 100 WSI
142 - - 30 30 100 80 WSI
142-5 - - 80 50 100 100 WSI,WSC
1 Number of pollen tube in style in percentage, 0-25%-self-incompatibility, 26-50% weak self-incompatibility, 51-75% weak
self-compatibility and 76-100% self-compatibility.2 WSI = weak self-incompatibility
SC = self-compatibility
WSC = weak self-compatibility
4. Varietal evaluation of F1 hybrid Chinesecabbage and control varieties
Evaluation of 11 F1 hybrid varieties of
Chinese cabbage obtained from the crosses against
3 control varieties showed that most F1 hybrid
varieties gave higher fresh head yield than the
control ones (Table 5).
Head fresh weight of F1 hybrid varieties
ranged from 3,665 to 6,170 kg/rai. Cross 142-5 x
40-9 gave the highest head fresh weight of 6,170
kg/rai followed by 23 x 142 and 27-3-7 x 142-5
which yielded 5,551 and 5,150 kg/rai, respectively,
These yields were significantly different from all
control varieties which gave head fresh yield
ranging from 3,625 to 4,527 kg/rai. Considering
head weight before trimming, the F1 hybrid
Figure 1 Self-compatible and self-incompatible
inflorescence of Chinese cabbage.Figure 2 Pollen tube in a style of female in
Chinese cabbage flower.
10 Kasetsart J. (Nat. Sci.) 37 (1)
Table 4 Seed weight of F1 hybrid Chinese cabbage.
Cross Seed weight Cross Seed weight
(kg/rai) (kg/rai)
40-9 x 142-5 4.826 27-3-7 x 23-3-4 0.197
40-9 x 27-3-7 3.941 142-5 x 27-3-7 0.144
40-9 x 23-3-4 2.714 23-3-4 x 40-9 0.128
142-5 x 40-9 1.642 23-3-4 x 142-5 0.085
23-3-4 x 27-3-7 1.403 27-3-7 x 142-5 0.051
27-3-7 x 40-9 0.773 142-5 x 23-3-4 0.030
Table 5 Fresh weight before and after trimming, trimming percentage, and solidity of Chinese cabbage
head of F1 hybrid and control varieties.
Cross and Head yield Head weight Head weight Trimming Solidity of head HSI
variety (Kg/rai) before trimming after trimming (%) (g/cm3)
Cross142-5 x 40-9 6,170.0 a3 1,390.0 b 964.0 a 30.65 0.5719 a 1.228 e
23 x 142 5,551.0 b 1,329.0 b 867.3 b 34.74 0.5507 a 1.308 d
27-3-7 x 142-5 5,150.0 b 1,484.0 a 804.7 b 45.77 0.4566 c 1.311 d
27 x 23 4,911.0 c 1,248.0 b 767.3 c 38.52 0.4110 d 1.279 d
27-3-7 x 40-9 4,851.0 c 1,333.0 b 758.0 c 43.14 0.4916 b 1.356 c
40-9 x 142-5 4,736.0 c 1,181.0 c 740.0 c 37.34 0.5857 a 1.299 d
23 x 27 4,646.0 c 1,299.0 b 726.0 c 44.11 0.4499 c 1.432 b
40-9 x 27-3-7 4,414.0 d 1,107.0 c 689.7 d 37.70 0.4418 c 1.227 e
142 x 23 4,186.0 d 1,112.0 c 654.0 d 41.19 0.4511 c 1.289 d
40-9 x 23-3-4 3,785.0 e 974.0 d 591.3 e 39.29 0.5020 b 1.569 a
27-3-7 x 23-3-4 3,665.0 e 1,173.0 c 572.7 e 51.18 0.4243 d 1.513 a
VarietyChang 4,527.0 d 1,486.0 a 707.3 d 52.40 0.5269 a 1.404 b
Tapa 23 3,917.0 e 1,152.0 e 612.0 e 46.88 0.3997 d 1.343 c
Bomb 159 3,625.0 e 1,473.0 a 566.3 e 61.55 0.3931 d 1.427 b
C.V. (%) 7.65 6.38 7.65 - 6.58 3.35
LSD.05 588.33 135.78 91.926 - 0.053 0.076
1. Solidity = MHW/(0.524d12d2)
MHW = mean head weight
d1 = head width
d2 = head length
2. Head shape index; HSI = head width/head length
3. Means follow by the same letters indicate no differences at P = .05 by least significant difference.
Kasetsart J. (Nat. Sci.) 37 (1) 11
varieties gave head weight ranging from 970 to
1,484 g (Table 5). The range was more or less
similar to fresh head weight of the control varieties
which ranged from 1,152 to 1,486 g. However,
when the outer leaves were trimmed off, most of
the F1 hybrid varieties showed higher head weight
than the control (Table 5, Figure 3 and 4). Head
weight of the F1 hybrid varieties after trimming
ranged from 572.7 to 964 g/head, while the control
varieties showed a range of 566.3 to 707.3 g/head.
The head weights of these varieties were
significantly lower than most of the F1 hybrid
varieties.
The control varieties showed higher
percentage of trimming than most (BE SPECIFIC)
of the F1 hybrid varieties (Table 5). Variety Bomb
159 gave the highest trimming percentage of
61.55%. A good control variety such as Chang
showed 52.40%. It was followed by variety Tapa
23 with 46.88%. The F1 hybrid varieties showed a
range of 30.65 to 51.18%. Therefore, the marketable
yield of most of the F1 hybrid varieties should be
higher than the control. Head solidity of the control
variety, Chang, was not significantly different
from high yielding F1 hybrid varieties, 142-5 x 40-
9 and 23 x 142. However, varieties Bomb 159 and
Tapa 23 were less solid than all of the F1 hybrid
varieties. High solidity of Chinese cabbage is
more perferable than low solidity.
Another important characteristic of Chinese
cabbage is head length. Long head is more
preferable than short one, therefore, high head
shape index is preferred.
Cylindrical head shape was observed in the
F1 hybrids 40-9 x 23-3-4 and 27-3-7 x 23-3-4 with
head shape index of 1.569 and 1.513, respectively,
which were significantly different from the control
varieties. However, there were many F1 hybrid
Figure 3 Head of F1 hybrid Chinese cabbage
142-5 x 40-9 (50) and control varieties
(1-Chang, 2-Bomb 159 and 3-Tepa 23).
Figure 4 Head of F1 hybrid Chinese cabbage 27-
3-7 x 23-3-4 (44) and control varieties
(1-Chang, 2-Bomb 159 and 3-Tapa 23).
12 Kasetsart J. (Nat. Sci.) 37 (1)
Table 6 Horticultural characteristics of F1 hybrid Chinese cabbage.
Cross- Solidity of Thickness Head Color of Color of
Cross section of head of petiole shape outer leaves inner leaves
petiole
23 x 27 Flat Firm Thick Obovate Pale green Yellow
23 x 142 Flat Firm Semi Obovate Light green Yellow
27 x 23 Flat Firm Semi Obovate Pale green Yellow
27-3-7 x 23-3-4 Flat Firm Thick Obovate Pale green Yellow
27-3-7 x 40-9 Semiround intermediate Thick Obovate Light green Yellow
27-3-7 x 142-5 Flat Firm Thick Obovate Pale green Yellow
40-9 x 23-3-4 Flat Firm Thick Ovate Light green Yellow
40-9 x 27-3-7 Flat Firm Thick Obovate Pale green Yellow
40-9 x 142-5 Flat Firm Thick Obovate Pale green Yellow
142 x 23 Flat Firm Thick Obovate Pale green Yellow
142-5 x 27-3-7 Flat Firm Thick Obovate Light green Yellow
varieties which their head shape index ranged
from 1.227 to 1.311. Their heads were rather
round which is undesirable in the market.
Other horticultural characteristics of most
of F1 hybrid varieties were more or less the same
(Table 6). They had very tight heads, oval shape,
thick petioles, pale and light green color of outer
leaves, and yellow color of inner leaves.
The F1 hybrid varieties had certain levels
of disease resistance. Even though the hybrids
were not screened for disease resistance, soft rot is
a common disease for Chinese cabbage, The disease
was not observed on the F1 hybrid and the control
varieties.
DISCUSSION
Improvement of F1 hybrid varieties of
Chinese cabbage requires good male and female
parental lines with high levels of self-
incompatibility. Comparison ot self-
incompatibility test by using seed set analysis and
fluorescent microscope technique showed that the
former method was better than the later. Results
showed that lines 23, 23-3-4, 27-3-4, 40-9, and
142-5 were self-incompatible and may have good
potential for F1 hybrid seed production. Among
the lines tested for seed production using bud
pollination technique, line 40-9 gave the highest
seed weight of 0.165g/plant.
Production of F1 hybrid seeds of the crosses
showed that self-incompatibility could be utilized.
Results showed that there was maternal effect.
When line 40-9 was used as a female parent, the
crosses gave the highest seed weight.
Varietal evaluation of F1 hybrid Chinese
cabbage showed that F1 hybrid 142-5 x 40-9 gave
higher head weight than standard varieties.
However, the head shape was rather round. There
were other good potential F1 hybrids such as 23 x
27, 23 x 142, 27-3-7 x 23-3-4, 27-3-7 x 142-5 and
40-9 x 23-3-4.
CONCLUSION
Inbred lines 23, 23-3-4, 27-3-7, 40-9 and
142-5 were suitable to be used as parental lines due
to the high levels of self-incompatibility which is
Kasetsart J. (Nat. Sci.) 37 (1) 13
good for F1 hybrid seed production. All the lines
gave high seed yield when used as a female parent.
Among these lines, 40-9 showed maternal effect.
It also gave high seed yield when inbred seeds
were produced by self-pollination of the unopened
flowers.
Bee pollination of F1 hybrid seed production
was not satisfied (SATISFACTORY?) because
seed yield was quite low. Production of F1 hybrid
seed by bee pollination is useful due to low cost in
inbred and hybrid seed production. However,
whether this technique is expropriated
(APPROPRIATE?) or not needs to be evaluated
further.
Most F1 hybrid varieties gave high head
yield but their heads were rather round which is not
desirable. Good potential F1 hybrid varieties were
142-5 x 40.9, 23 x 27, and 23 x 142.
LITERATURE CITED
Briggs, F.N. and P.F. Knowles. 1967. Introduc-tion to Plant Breeding. Reinhold Publishing
Corporation: A Subsidiary of Chapman-
Reinhold, INC., 426 p.
Chimonkon, C., M. Nikornpun and T. Tunsuwan.
1997. Varietal trial of Chinese cabbge,pp.
120-126. In National Vegetable Meeting,
15th, Bangkok,
Gaude, T., A. Friry, P.Heizmann, C. Mariac, M.
Rougier, I. Fobis and C. Dumas. 1993.
Expression of a self incompatibility gene in a
self compatible line of B.oleracea. Plant Cell5 : 75-86.
Isogai, A., S. Takayama, C. Tsukamoto, Y. Ueda,
H. Shozawa, K. Hinata, K. Okazaki and A.
Suzuki. 1987. S-locus-specific glycoproteins
associated with self-incompatibility in
Brassica campestris. Plant Cell Physiol.28(7) :1279-1291.
Kho, Y.O. and J. Baer. 1968. Observing pollen
tubes by means of fluorescence. Euphytica17 : 298-302.
Nasrallah, J.B. and M.E. Nasrallah. 1993. Pollen-
stigma signaling in the sporophytic self
incompatibility response. Plant Cell 5 : 1325-
1335.
Nasrallah, J.B., J.C. Stein, M.K. Kandasamy and
M.E.Nasrallah. 1994. Signaling the arrest of
pollen tube development in self-incompatible
plants. Science. 266 : 1505-1508.
Opena, P.T., C.G. Kuo and J.Y.Yoon. 1988.
Breeding and Seed Produciton of ChineseCabbage in the Tropic and Subtropics.
Technical Bulletin No.17. AVRDC. Taiwan.
P. 92.
Pastuglia, M., V. Ruffio-Chable, V.Delorme,
T.Gaude, C. Dumas and J.M. Cock. 1997. A
function S locus anther gene is not required
for the self incompatibility response in
B.oleracea. Plant Cell 9 : 2065-2076.
Shinohara, S. 1981. Principles of Vegetable SeedProduciton. Tsukuba International
Agriculture Training Center, Textbook V.C.
No.26. 225 p.
Tunsuwan, T., C. chaimongkul and M. Nikornpun.
1997. Hybrid Chinese cabbage seed
production project, pp. 105-119. In NationalVegetable Meeting, 15th, Bangkok.
Kasetsart J. (Nat. Sci.) 37 : 14 - 26 (2003)
Soybean Yield and Nutrient Compositionas Affected by Soil and Foliar Fertilizations
Chin Theng Phiv1, Chawalit Hongprayoon1,Peerasak Srinives2, Arunsiri Kumlung1 and Yongyuth Osotsapar1
ABSTRACT
Soil fertilizer application and foliar fertilization offer a possible means of increasing soybean
[Glycine max (L.) Merr.] yield in Thailand but little is known of appropriate foliar fertilizer use to
supplement soil fertilization. Field experiment was conducted twice to determine the effects of soil N P
K fertilization together with foliar fertilizers containing macronutrients and micronutrients on growth,
yield and nutrient composition of soybean (Sukhothai 1 and KUSL 20004 cultivars). The treatments were
arranged in 3 ¥ 3 factorial experiment in randomized complete block. Three methods of soil fertilization
were control (S0), 18 kg N ha-1 at 7 days after seeding (DAS) (S1), and 18 kg N ha-1 at 7 DAS + 18 – 18
– 18 kg N – P2O5 – K2O ha-1 at 30 DAS (S2). Foliar fertilizer contained both macronutrients and
micronutrients. The three methods of foliar fertilization were control (F0), 3 applications at 34, 42 and
49 DAS (F1) and 6 applications at 20, 27, 34, 42, 49 and 56 DAS (F2). Throughout the studies, soil and
foliar fertilizations did not significantly affect growth, yield and yield components of soybean. The
concentration of N P K Fe and Zn in shoot at 68 DAS and N P K and Ca in leaves at 89 DAS were not
consistently affected by soil and foliar fertilizations. The remarkable effects of soil fertilizers on the
concentrations of Ca Mn and Cu in shoot, and Mg Fe Mn and Cu in leaves were observed. Foliar
fertilizations increased Fe and Cu concentrations in leaves. The nutrient concentrations of soybean shoot
and leaves under this investigation were in sufficient ranges which were agreeable with soil test results.
This finding indicated that the soil can provide sufficient nutrients for soybean growth and yield under
this condition. Therefore, soil and foliar fertilization will not be economically feasible.
Key words: soybean, soil fertilizer, foliar fertilizer, macronutrients, micronutrients
1 Department Soil Science, Faculty of Agriculture, Kasetsart University, Kamphaeng Saen, Nakhon Pathom 73140 , Thailand.2 Department of Agronomy, Faculty of Agriculture, Kasetsart University, Kamphaeng Saen, Nakhon Pathom 73140 , Thailand.
Received date : 01/11/02 Accepted date : 27/12/02
INTRODUCTION
Soybean [Glycine max (L.) Merr.] has
efficient symbiotic nitrogen fixation that can
provide over 80% of the nitrogen in the crop at
maturity, however in most cases fixation accounts
for 25 – 75% of total plant nitrogen (Deibert et al.,
1979). One metric ton of soybean grain removes
approximately 59 kg N, 60 kg P, 19 kg K and
different amount of other macronutrients and
micronutrients (Fageria et al., 1997). To maintain
soil fertility, at least nutrients (other than nitrogen)
removed in the grain should be returned into soil
by applying the fertilizers. Soybeans grown in
Thailand were reportedly response to N P and K
fertilization. The recommendation rates for soybean
producers are 18 kg N, 36 kg P2O5 and 18 kg K2O
ha-1 for clay loam and silty loam soils. However,
only 36 kg P2O5 ha-1 was applied at planting for
soybean grown in clayey texture soil (Division of
Soil Science, 1999). The suitability of these
fertilizer rates to different soybean cultivars grown
in different soil types need further clarification.
Foliar fertilization of soybean with a liquid
N–P–K–S fertilizer during pod filling period (R5
to R6) has received considerable attention in various
parts of the United States since 1975 (Garcia and
Hanway, 1976). During seed growth period,
soybean plants translocate large quantities of N, P,
K and S from leaves to developing pods and seeds
resulting in decreasing photosynthesis and
ultimately premature senescence (Sinclair and de
Wit, 1975). Soybean yield was increased by foliar
boron application due to increasing final number
of branches and pods on branches (Schon and
Blevins, 1990). Foliar spray containing Ca and B
improved pod development and pod retention of
soybean in field condition (Weaver et al., 1985).
Furthermore, increasing soybean yield from foliar
B + Mg treatment was resulted from an increased
number of pods on the main stem and branches
(Reinbott and Blevins, 1995).
Some information is available on the
effectiveness of foliar applied fertilizers for
leguminous crops in Thailand. Foliar applications
of B and Fe can ameliorate the deficiency problems
of these elements on blackgram, peanut and
mungbean. Two foliar applications of borax, at a
very low rate of 50 gha-1, during flower
development and pod set, were as effective in
correcting boron deficiency in backgram as a high
rate applied to soil (Rerkasem, 1989). Five foliar
applications of 0.5% FeSO4 solution at 10, 20, 30,
40 and 50 days after emergence was the most
effective way to alleviate iron chlorosis, and
substantially improved yield of peanut (Ratanarat
et al., 1990). Mungbean plants given a foliar spray
with a nutrient solution contained 0.5% Fe, Zn and
Mn recovered from the chlorosis and produced
greater number of pods (Oonkasem and
Thavarasook, 1988). Foliar fertilization of a
solution of 5 gL-1 ferrous sulfate was effective in
correcting chlorosis that was induced by iron
deficiency, and it enhanced both growth and yield
of susceptible mungbean cultivars (Ohwaki et al.,
1997).
At present, foliar fertilization together with
soil application have been practiced in many areas
of Thailand but limited information was available
(Pongsakul and Ratanarat, 1999). Suanmalee et al.
(1990) reported that only soil N P K fertilization or
soil fertilization in combination with foliar
applications of N P K fertilizers significantly
increased soybean yield in Pak Chong soil series
(clayey, kaolinitic, Oxic Paleustults) and Wang
Saphung soil series (fine – clayey, mixed Ultic
Haplustalfs). However, N P K foliar fertilization
without soil fertilizer application did not improve
soybean yield. It is obvious that research on the
effects of foliar fertilizers containing both
macronutrients and micronutrients on soybean
yield in this country is almost non. More studies
are, therefore, needed to clarify the roles of foliar
fertilization on soybean yield improvement. The
objective of this study was to determine the effects
of soil N P K fertilization together with foliar
fertilizers containing macronutrients and
micronutrients which applied during vegetative
and reproductive stages on growth, yield and
nutrient composition of soybean.
MATERIALS AND METHODS
Field experiment was conducted on
Kamphaeng Saen soil series (fine-silty, mixed,
Typic Haplustalfs) at the Asian Regional Center
(ARC) of the Asian Vegetable Research and
Development Center (AVRDC), Kamphaeng Saen
Campus, Kasetsart University during November
2001 – March 2002 and was repeated during May
– August 2002. Before land preparation of each
cropping, a composite soil sample was collected
Kasetsart J. (Nat. Sci.) 37 (1) 15
16 Kasetsart J. (Nat. Sci.) 37 (1)
from the depth of 0 to 20 cm and tested for pH,
electrical conductivity (EC), organic matter (OM),
P, K, Ca, Mg, Fe, Mn, Zn and Cu. Briefly, pH was
analyzed in a 1 : 1 soil/water ratio, EC of saturated
extract by EC meter, organic matter by Walkley
and Black method, P by the Bray P–2 method, K,
Ca and Mg by ammonium acetate method (Jackson,
1973). Soil Fe, Mn, Zn and Cu were detemined by
atomic absorption spectrophotometry on the DTPA
extract (Linsay and Norvel, 1978). The soil test
values for the first and second trials are shown in
Table 1.
Before planting of soybean, land was
ploughed once and harrowed twice. Each plot
measured 5 m in length and 3 m in width. The
planted spacing between hills was 25 cm and
between rows was 60 cm. Soybean cultivars
‘Sukhothai 1’ and ‘KUSL 20004’ were used in the
first and second trials, respectively. Soybean seed
was inoculated with rhizobium bacteria before
seeding. About 3-4 seeds were dropped in each
hill. Upon establishment, plants were thinned to 2
plants per hill. To minimize moisture stress, furrow
irrigation was applied throughout the growing
season. Weeds were controlled chemically and
hand weeded as necessary.
The experimental design was randomized
complete block with four replications. The fertilizer
treatments were factorially arranged in 3¥3 soil
application and foliar fertilization methods. Soil
fertilizer application methods were control (So),
18 kg N ha-1 at 7 days after seeding or DAS or
growth stage Vc (S1) and 18 kg N ha-1 at 7 DAS
+ 18-18-18 kg N- P2O5-K2O ha-1 at 30 DAS or
growth stage R1 (S2). Ammonium sulfate (21–0–0)
and compound fertilizer (15–15–15) were used in
soil fertilizer treatments. The foliar fertilization
methods were control (water sprayed plots, F0),
foliar fertilizer application 3 times at 34, 42 and, 49
DAS or growth stages R2, R3 and R4 (F1) and
application 6 times at 20, 27, 34, 42, 49 and 56
DAS or growth stages V4, V6, R2, R3, R4 and R5
(F2). The concentration of each element in solution
applied at early growth stages was lower than
those used at later stages. The detail of soil and
foliar fertilizer applications were given in Table 2.
The sources of nutrients for foliar fertilizer mixture
were urea (46–0–0), ammonium sulfate (21–0–0),
potassium nitrate (13–0–46), magnesium sulfate
(10% Mg and 14% S), Fe EDTA (13.2% Fe), Zn
EDTA (14% Zn), Mn EDTA (13% Mn), Cu EDTA
(14% Cu) and calcium-boron-molybnenum
solution (6% Ca, 2% B and 0.2% Mo) under the
commercial trade name B PlusTM*.
Alkyl aryl polyethoxylate and sodium
alkylsulfonate alkylate 60% adjuvant was used at
the rate of 0.1 mlL-1 . All foliar fertilizer solutions
were applied with backpack hand sprayer in the
early morning (8 – 10 am). The nozzle size was
adjusted to deliver an appropriate rate and uniform
distribution. Foliar fertilizer mixtures were sprayed
uniformly across each plot.
Table 1 Soil test values for the first and second fertilizer trials conducted at ARC, Kasetsart University,
Kamphaeng Saen.
Trial pH EC OM P K Ca Mg Fe Mn Zn Cu
(dSm-1) (%) (mg kg-1)
1 6.5 0.8 1.4 238.4 131.6 1721.5 246.6 30.8 1.3 36.2 1.1
2 6.8 1.1 1.9 130.1 143.1 1921.6 232.7 24.9 1.0 52.3 1.2
* Use of trade name does not imply endorsement of the product name nor criticism of similar ones not named.
Kasetsart J. (Nat. Sci.) 37 (1) 17
To study plant growth parameters, 5 plants
were collected from two sampling rows at 46, 54,
69 and 89 DAS or growth stages R4, R5, R6 and
R7 of the first trial and 65 and 79 DAS or growth
stages R6 and R7 of the second trial. The plants
were cut at ground level and determined for node
number, branch number and plant height. After
growth measurement, plant samples were air-dried
at 70∞C for 3 days to measure dry weight. Whole
plant samples were taken at 68 DAS or growth
stage R6. They were washed thoroughly with tap
water containing mild detergent, rinsed three times
with deionized water, dried and ground for chemical
analysis (Schon and Blevins, 1990).
Ten plants were randomly collected from
sampling rows at maturity and counted for number
of pods per plant and number of pods on branches.
One hundred pods were randomized and counted
for the total number of seeds to obtain average
number of seeds per pod.
The soybean was harvested at maturity
when 95% of total pods turned brown (R8). Grain
yield was measured from a 5 m length of the center
two rows. Plant number per plot was recorded
before threshing. Grain yield was weighed and a
grain sample was collected from each plot to
determine grain moisture. The grain yield was
adjusted to 13% moisture. Subsamples from each
plot were obtained to detemine 100 - seed weight.
Samples of trifoliate leaves (including
petioles) consisting of 25 uppermost fully expanded
leaves were randomly collected one week before
harvesting from each plot to analyze for the nutrient
concentration of leaves in the last growth stage.
Leaf samples were washed in 0.1 N HCl for
approximately 30 seconds, rinsed in deionized
water for 30 seconds to remove of residual foliar
fertilizer (Moraghan, 1991). Leaf samples were
dried in a hot air oven at 70∞C and ground to pass
a 2-mm screen. Plant samples were digested with
perchloric/nitric/sulfuric tertiary acid. Total N was
determined by auto analyzer and P by vanado-
molybdate colorimetry. The concentrations of K,
Ca, Mg, Fe, Mn, Zn and Cu were determined by
atomic absorption spectrophotometry (Walsh,
1971).
Data were analyzed with analysis of
variance (ANOVA) using IRRISTAT package.
The treatment means were separated using
Duncan’s multiple range test.
Table 2 Soil fertilizer rates, foliar fertilizer concentrations and application schedule of the fertilizer
trials.
Treat- Dates and rates of soil and foliar fertilizer application
ment 7DAS* 20DAS 27DAS 30DAS 34DAS 42DAS 49DAS 56DAS
(kg N ha-1) (2L/plot) (2L/plot) (kg N-P2O5-K2O ha-1) (3L/plot) (4L/plot) (4L/plot) (4L/plot)
S0 - - - - - - - -
S1 18 - - - - - - -
S2 18 - - 18–18–18 - - - -
F0 - - - - - - - -
F1 - - - - P3 P3 P3 -
F2 - P1** P2 - P3 P3 P3 P3
* DAS = Days after seeding;** P1, P2 and P3 = Concentration (mg kg-1) of elements in the solution as follows :
P1 = 250 N, 50 P, 100 K, 25 S, 15 Mg, 30 Ca, 15 Fe, 10 Mn, 7.5 Cu, 7.5 Zn, 10 B, 1 Mo
P2 = 500 N, 100 P, 200 K, 50 S, 30 Mg, 45 Ca, 30 Fe, 20 Mn, 15 Cu, 15 Zn, 20 B, 2 Mo
P3 = 750 N, 150 P, 300 K, 75 S, 45 Mg, 60 Ca, 45 Fe, 30 Mn, 22.5 Cu, 22.5 Zn, 30 B, 3 Mo
18 Kasetsart J. (Nat. Sci.) 37 (1)
RESULTS AND DISCUSSION
1. Plant growthThe effects of soil and foliar fertilizer
applications on plant height, number of nodes per
plant, number of branches per plant and dry weight
of shoot are shown in Tables 3 and 4. Soil and
foliar fertilizer treatments did not influence plant
height at 46 days after seeding (DAS) of the first
trial and 79 DAS of the second trial (Table 3).
However, soil fertilizer treatments decreased plant
height at 69 DAS of the first trial but increased that
of the second trial. The heavy rainfall at that plant
age in the first trial may contribute to this variation.
Faliar treatments did not show any influence on
soybean height. The results corroborated the work
of Edmisten et al. (1994) which indicated that
foliar treatments of complete fertilizers at 10 – 14
days intervals starting at 2 – 3 leaf stage had no
effect on height of cotton. There was an interaction
between soil and foliar treatments on plant height
at 79 DAS of the second trial. This interaction
indicated that one application of soil fertilizer (S1)
increased plant height when foliar fertilizer was
not used.
Soil fertilizer and foliar fertilizer
applications did not result in a significant increase
in number of nodes per plant (Table 3). The result
revealed that the effect of fertilizer treatments on
plant height may be due to the increase in length of
the internodes.
There was no response of shoot dry weight
to soil fertilizer treatments. Foliar fertilizer
application, however, significantly increased dry
weight at 89 DAS of the first trial (Table 4). The
interaction between soil and fertilizer treatments
remarkably affected dry weight at 54 DAS of the
first trial. This interaction indicated that one
application of soil fertilizer (S1) in plots without
foliar fertilizer (F0) tended to increase dry weight
of soybean. In contrast to the result of this
experiment, Haq and Mallarino (2000) indicated
that foliar fertilization with N P K at early season
seldom influenced dry weight of soybean at the R2
Table 3 Plant height (cm) and number of nodes per plant of soybean after soil and foliar fertilizations.
Fertilizer Height (1st trial) Height (2nd trial) Node no. (1st trial) Node no. (2nd trial)
treatment 46 DAS 69 DAS 65 DAS 79 DAS 46 DAS 69 DAS 65 DAS
SoilS0 60.4 91.9 b 85.6 a 86.7 11.3 14.7 16.3
S1 58.9 87.7 a 90.9 b 89.6 11.2 15.3 16.1
S2 56.4 87.9 a 91.0 b 88.2 11.2 14.6 16.5
F- test ns * ** ns ns ns ns
FoliarFo 56.7 88.1 87.9 87.5 a 11.3 14.9 16.8
F1 59.7 90.6 90.4 89.3 ab 11.0 15.0 16.5
F2 59.3 88.2 89.4 87.5 a 11.3 14.9 16.5
F-test ns ns ns ns ns ns ns
S x F ns ns ns * ns ns ns
CV (%) 9.4 4.9 4.5 4.2 5.4 5.0 5.4
ns = not significant different ,* significant different at P £ .05, ** significant different at P £ .01
Means in each column followed by the same letter are not different by DMRT at P £ .05
Kasetsart J. (Nat. Sci.) 37 (1) 19
growth stage.
It was noted that foliar treatment did not
significantly increase number of branches per plant
in the cultivar ‘Sukhothai 1’ (Table 5). Therefore,
the promotion of six split foliar fertilizer
applications (F2) on plant dry weight was likely
due to the effects of treatments on increasing dry
weight of leaves, branches or stems. Similar results
were obtained by Poole et al. (1983).
Soybean is relatively sensitive to
phytotoxicity due to foliar fertilizer treatments
(Weaver et al., 1985). The ammonium
polyphosphate mixed solution damaged the foliage
more than potassium polyphosphate mixed solution
or urea alone. Repeated applications of foliar
fertilizer increase leaf injury (Parker and Boswell,
1980). Visual leaf injury evaluation in this
experiment was made 3 days after each spray.
Only less than 5% of leaf area was affected by F1
treatment, a little more leaf burn developed on
mature leaves sprayed with F2 solution. Although
leaf burn was not serious and the plants recovered
within two weeks without an adverse effect on
plant growth, this may cause negative effect on
foliar treatments in general.
The number of branches per plant of
‘KUSL 20004’ soybean from the second trial was
shown in Table 6. Soil and foliar fertilizer
treatments did not cause a considerable increase in
number of branches per plant at 89 DAS of the first
trial (Table 5), and 65 DAS of the second trial
(Table 6).
Soybean canopy was relatively dense from
35 DAS. Foliar application tended to increase
humidity in leaf canopy which was favorable for
the growth of pathogens and pest control by
chemicals was not effective under this condition.
2. Soybean yield and yield componentsSoybean yield of the first trail is shown in
Table 5. The yield of the second trial is not presented
due to the damage of plants by white flies during
the final stage of seed filling which seriously
affected seed yield but not some yield components
(Table 6).
Soil and foliar fertilizer applications had
Table 4 Dry weight (kg ha-1) at different stages of soybean growth after soil and foliar fertilizations.
Fertilizer First trial Second trial
treatment 54 DAS 69 DAS 89 DAS 65 DAS 79 DAS
SoilS0 544 1995 2515 2562 2608
S1 586 2101 2733 2494 2547
S2 536 2087 2523 2419 2679
F – test ns ns ns ns ns
FoliarFo 539 2039 2572a 2395 2673
F1 565 2048 2399a 2633 2603
F2 560 2096 2800b 2444 2559
F – test ns ns * ns ns
S x F ** ns ns ns ns
CV (%) 11.5 14.3 13.9 12.8 11.9
ns = not significant different, *significant different at P £ .05, ** significant different at P £ .01
Means in each column followed by the same letter are not different by DMRT at P £ .05
20 Kasetsart J. (Nat. Sci.) 37 (1)
Table 5 Yield and yield components of ‘Sukhothai 1’ soybean in the first trial.
Fertilizer Branches/plant Pods/plant Seeds/plant Weight of Grain yield
treatment 89 DAS 46 DAS 89 DAS 89 DAS 100 seeds (g) (kg ha-1)
SoilSo 3.1 8.8 47.6 140.8 14.7 2254
S1 2.9 9.2 51.2 142.5 14.3 2225
S2 2.6 9.4 53.2 139.3 14.0 2238
F – test ns ns ns ns ns ns
FoliarFo 2.7 9.1 52.5 139.2 14.8 2229
F1 3.0 8.1 51.0 140.8 14.0 2281
F2 2.9 10.2 49.2 140.7 14.2 2208
F – test ns ns ns ns ns ns
S x F ns ns ns ns ns ns
CV (%) 29.8 22.9 14.8 4.70 8.2 16.8
ns = not significant different
Table 6 Yield and yield components of ‘KUSL 20004’ soybean in the second trial.
Fertilizer Branches/plant Pods on main stem Pods on branches Seeds/pod Seeds/plant
treatment 65 DAS 65DAS 79 DAS 65 DAS 79 DAS
SoilS0 3.6 39.9 39.5 20.0 19.4 2.4 141.7
S1 3.4 40.9 40.1 20.6 19.5 2.5 140.5
S2 3.4 40.8 40.6 24.3 19.4 2.3 141.1
F – test ns ns ns ns ns ns ns
FoliarF0 3.6 40.3 40.0 21.1 19.9 2.4 141.0
F1 3.3 40.9 40.5 20.0 19.0 2.5 139.7
F2 3.6 42.6 39.7 23.8 19.4 2.4 143.6
F – test ns ns ns ns ns ns ns
S x F ns ns ns ns ns * ns
CV (%) 15.2 7.8 6.5 24.8 22.3 9.4 3.8
ns = not significant different, *significant different at P £ .05
no significant effects on seed yield of soybean in
the first trial. Even, split application of foliar
fertilizer (F1 and F2) did not increase seed yield
over the control (Table 5). Further increasing to
six - split application gave no increase in seed
yield. On the contrary, Suanmalee et al. (1990)
reported that soil fertilization significantly
increased yield of soybean grown in Pak Chong
Kasetsart J. (Nat. Sci.) 37 (1) 21
and Wang Saphung soil series. Supplementing
with six applications of foliar fertilizers in 10 days
interval did not further increase grain yield in
either locations. The effective response of soybean
yield to soil fertilizer treatments in both soils was
mainly due to low level of available P and K.
The effects of fertilizer treatments on yield
components of both trials are shown in Table 5 and
6. Total pods per plant at 46 and 89 DAS of the first
trail was not increased by increasing soil and foliar
fertilizer applications. Average number of pods
per main stem and pods on branches per plant were
also slightly affected by soil and folair fertilizer
applications. One application of soil fertilizer (S1)
or three split applications of foliar fertilizers (F1)
slightly increased the average number of seeds per
plant but not on seed size of the first trial (Table 5).
Both soil and foliar fertilizer treatments did not
affect branch number, pod number per main stem,
pod number on branches, number of seeds per pod,
and number of seeds per plant of the second trial
(Table 6). Our results are in contrary to the finding
of Parker and Boswell (1980) which indicated
yield reduction of soybean in NPKS foliar treated
plots and presented the positive correlation between
leaf injury and yield depression. Little leaf injury
produced from foliar fertilizer treatments could
possibly explain a lack of positive yield response
or a small yield decrease. It did not result in a
significant yield reduction (Haq and Mallarino,
2000). In order to avoid leaf burning and to improve
the chance of positive yield response, Poole et al.
(1983) suggested that foliar fertilization should be
conducted before 0800 or after 1700 hours which
is not practical to general field conditions. Although
our sprayed solution contained both boron and
magnesium but the result of foliar application was
not in agreement with the works of Schon and
Blevins (1990), and Reinbott and Blevins (1995)
which suggested that foliar treatments with both
nutrients promoted higher soybean yield, mainly
due to increase in number of branches per plant,
number of pods on branches, and seed size.
3. Shoot and leaf nutrient concentrationsSoil and foliar fertilization treatments did
not show significant effect on N P K and Mg in
shoot sampled at 68 DAS (Table 7). However, the
effect of soil fertilization on shoot Ca content was
inconsistent. Calcium concentration in shoot from
soil fertilizer treated plots of the first trial was
relatively lower than control. Little influence of
soil treatments on Ca in shoot was noted in the
second trial. The data in Table 5 showed slight
trend towards increasing shoot dry weight with
soil fertilization. The relatively larger biomass
production in these treatments may contribute to
the dilution of Ca in shoot.
Concentrations of Fe Zn Mn and Cu in
soybean shoot were shown in Table 8. Shoot Fe
and Zn were not affected by soil fertilizer treatments
but two split applications of soil fertilizers (S2)
remarkably increased Mn and Cu in soybean shoot
of the first trial and Cu in shoot of the second trial.
The content of Zn Mn and Cu was not affected by
foliar treatments of both trials. Shoot Fe declined
in foliar treated plant of the first trial but tended to
increase in the second trial. This indicated the
inconsistent effect of foliar fertilization on Fe
content in soybean shoot.
Concentration of macronutrients in leaves
sampled at 89 DAS are shown in Table 9. Soil and
foliar fertilizer applications did not significantly
increase the concentration of N P K and Ca in
leaves, but one application of soil fertilizer
(S1)remarkably increased leaf Mg content.
Macronutrient concentration in leaves from all
treatments are in sufficient range. Our data are in
contrary with the finding of Boote et al. (1980) that
foliar application of N P K and S during pod filling
stages increased the concentration of all the
elements in soybean leaves without significantly
improved seed yield. Generally, soybean plant
requires high amount of N for seed production.
The major part of N is accumulated in seed during
pod filling stages. As much as 75% of the total N
is found in the seeds at harvest time (Vasilas et al.,
22 Kasetsart J. (Nat. Sci.) 37 (1)
Table 7 N, P, K,Ca and Mg concentrations (% dry weight) in shoot at 68 DAS of both trials.
Fertilizer First trial Second trial
treatment N P K Ca Mg N P K Ca Mg
SoilSo 2.80 0.22 2.27 1.58a 1.31 2.18 0.21 2.39 1.17 0.98
S1 2.79 0.23 2.29 1.44b 1.23 2.42 0.24 2.59 1.19 1.02
S2 2.73 0.24 2.33 1.48b 1.24 2.23 0.23 2.48 1.18 1.06
F – test ns ns ns * ns ns ns ns ns ns
FoliarFo 2.73 0.22 2.16 1.51 1.25 2.18 0.22 2.39 1.12 0.99
F1 2.78 0.24 2.37 1.53 1.31 2.27 0.23 2.57 1.21 1.04
F2 2.82 0.23 2.36 1.48 1.28 2.38 0.23 2.49 1.20 1.01
F – test ns ns ns ns ns ns ns ns ns ns
S x F ns ns ns * ns ns ns ns ns ns
CV (%) 11.5 9.1 9.3 7.4 6.3 13.8 9.2 10.0 13.1 8.1
ns = not significant different, *significant different at P £ .05
Means in each column followed by the same letter are not different by DMRT at P £ .05
Table 8 Fe, Zn, Mn and Cu concentrations (mg kg-1) in shoot at 68 DAS of both trials.
Fertilizer First trial Second trial
treatment Fe Zn Mn Cu Fe Zn Mn Cu
SoilS0 150.8 18.4 67.7 b 9.4 a 77.4 15.3 27.6 7.0 a
S1 172.7 23.5 59.6 a 10.5 a 99.9 19.3 32.0 11.6 b
S2 175.3 25.7 72.4 b 16.6 b 100.2 19.9 31.4 12.4 b
F – test ns ns * ** ns ns ns **
FoliarF0 195.0 b 23.6 70.1 12.6 90.4 18.0 27.6 10.6
F1 147.7 a 21.3 63.4 12.7 90.3 18.5 33.0 9.3
F2 165.7 a 22.7 66.2 11.2 96.7 18.0 30.3 10.7
F – test * ns ns ns ns ns ns ns
S x F ns ns ** ** ns ns ** ns
CV (%) 28.0 38.4 16.1 22.6 30.2 32.2 18.0 27.0
ns = not significant different, * significant different at P £ .05, ** significant different at P £ .01
Means in each column followed by the same letter are not different by DMRT at P £ .05
Kasetsart J. (Nat. Sci.) 37 (1) 23
1995). The results of our experiments indicated
that N concentration in soybean leaves collected
one week before harvesting was not affected by
either soil or foliar fertilizer treatments. A well
established soybean-rhizobium symbiosis from
inoculation may be effective in providing enough
N to plants.
It is important to note that the soil used in
this experiment was previously grown to soybean
and amended with duck manure and chemical
fertilizers. The roots and stover were incorporated
to the soil after harvest. The C:N ratio of soybean
roots and stover was favorable for fast
mineralization and would provide some available
N to soybean in the succeeding crop (Goss et al.,
2002). The residual N benefit of soybean stover to
succeeding crop was 13.16% of their total N or
equal to 12.7 kg N ha-1 (Yataputanon et al., 2002).
Nitrogen gained from symbiotic fixation together
with the mineralized N from soil organic matter
may have contributed to sufficiency of this element
in untreated control.
The soil and foliar fertilizer applications
did not affect the concentration of P K and Ca in
leaves but one application of soil fertilizer (S1)
significantly increased Mg content in leaves as
compared to control (Table 9). However, there
was no marked influence of foliar fertilization on
Mg concentration in leaves. The result of leaf
analysis at 89 DAS also revealed that soil and
foliar fertilization did not change nutrient
composition especially N P K and Ca as compared
to control. The values of N P K Ca and Mg were in
sufficient ranges for soybean at this growth stage.
These were consistent with the adequacy of
available P, extractable K Ca and Mg in Kamphaeng
Saen soil series. It is obvious that these nutrients
were not the limiting factors under the studied
conditions.
The concentration of Fe Zn Mn and Cu in
leaves sampled at 89 DAS are shown in Table 9.
Soil fertilizer application did not affect the
Table 9 N, P, K, Ca, Mg, Fe, Mn, Zn and Cu concentrations in leaves of ‘Sukhothai’ 1at 89 DAS of the
first trial.
Fertilizer N P K Ca Mg Fe Zn Mn Cu
treatment (%) (mg kg-1)
SoilS0 2.51 0.26 1.98 2.05 0.80 b 297 a 27.0 75.9 a 14.6 a
S1 2.45 0.27 2.03 2.16 1.03 a 219 b 29.7 97.8 b 15.6 b
S2 2.45 0.28 2.08 1.97 0.96 ab 215 b 28.9 99.8 b 15.9 b
F – test ns ns ns ns ** ** ns * *
FoliarF0 2.43 0.27 2.03 2.11 0.98 172 a 26.6 a 82.7 a 14.8 a
F1 2.37 0.28 2.04 2.05 0.95 220 b 25.9 a 91.0 b 15.0 a
F2 2.47 0.27 2.03 2.01 0.89 237 b 33.6 b 99.8 c 15.9 b
F – test ns ns ns ns ns ** * * *
S x F ns ns ns * ns ns ns ns ns
CV (%) 18.1 8.7 7.7 10.3 14.8 26 23.4 16.7 12.3
ns = not significant different, * significant different at P £ .05, ** significant different at P £ .01
Means in each column followed by the same letter are not different by DMRTat P £ .05
24 Kasetsart J. (Nat. Sci.) 37 (1)
concentration of Zn but one application of soil
fertilizer (S1) remarkably increased Fe Mn and Cu
concentration in leaves. In addition, three
applications of foliar fertilizer (F1) significantly
increased Fe and Mn concentration while six
applications (F2) markedly increase concentration
of Zn and Cu in leaves. Our finding is in agreement
with the work of Bednarz et al. (1999) in cotton.
However, none of the four elements were deficient
in untreated plots and the increases of Zn and Cu
were beyond the plant required concentration
(Reuter ond Robinson, 1997).
Application of foliar fertilizers containing
macronutrients and micronutrients at reproductive
stage have been shown to increase soybean seed
yield in some studies (Schon and Blevins, 1990;
Smith et al., 2000). However, the other studies
showed that foliar fertilization of soybean either
did not influence or decrease yield (Parker and
Boswell, 1980; Freeborn et al., 2001). Generally,
nitrogen limitation of this crop during early to mid
pod filling stages is due to rapidly decreasing of
N2-fixation by Bradyrhizobium spp. (Haper, 1987).
Furthermore, root activity also decreases during
that growth period and nutrient uptake is not
sufficient to meet the seed demand for nutrients
(Garcia and Hanway, 1976). However, the contrary
result from the study on 15N-labeled urea absorption
and translocation of soybean indicated that changes
in the rate of nutrient absorption by root during
pod-fill were minimal and unlikely to be a major
factor determining the effectiveness of foliar
fertilization (Vasilas et al., 1978). Early season
foliar fertilization for soybean was also studied if
foliar application could increase P and K supplied
to young plants (Haq and Mallarino, 2000).
However, they reported that foliar fertilization of
soybean with various nutrient mixtures resulted in
very small and infrequent yield increase. Addition
of a mixture of micronutrients to the N P K S
fertilizer did not result in additional yield response
(Mallarino et al., 2001). These findings are in
agreement with the result of our experiment which
indicated that three-split foliar fertilization at
reproductive stage (F1) or two-split applications
at early season together with four-split applications
at seed filling stage (F2) did not increase yield of
irrigated soybean in this fertile soil. In addition,
positive response to foliar fertilization tended to
occur when soil or weather condition reduced
plant growth and nutrient availability (Haq and
Mallarino, 2000). It is obvious from the result of
soil test before planting, shoot analysis at 68 DAS
and leaf analysis at 89 DAS that there was no
limited nutrient for soybean under this studied
condition. Soil and foliar fertilizations in this
fertile soil, therefore, will not offset the application
costs.
CONCLUSIONS
Three methods of soil fertilization and three
methods of foliar fertilization did not significantly
affect growth, yield and yield components of
soybean. The concentrations of nutrients in shoot
at 68 DAS and leaves at 89 DAS were not
consistently affected by soil and foliar fertilizations.
The nutrient concentrations of soybean shoot and
leaves were in sufficient ranges. This finding
indicated that soil can provide sufficient nutrients
for soybean growth and yield under this condition.
LITERATURE CITED
Bednarz, C.W., N.W. Hopper and M.G. Hickey.
1999. Effects of foliar fertilization of Texas
Southern High Plains cotton : Leaf phosphorus,
potassium, zinc, iron, manganese, boron,
calcium and yield distribution. J. Plant Nutri.22 : 863-875.
Boote, K.J., R.N. Gallaher, W.K. Robertson, K.
Hinson and L.C. Hammond. 1980. Effects of
foliar fertilization on photosynthesis, leaf
nutrition, and yield of soybeans. Agron. J. 72
: 271-275.
Deibert, E.J., M.D. Jeriego and R.A. Olson. 1979.
Kasetsart J. (Nat. Sci.) 37 (1) 25
Utilization of 15N fertilizer by nodulating and
nonnodulating soybean isolines. Agron. J. 71
: 717-723.
Division of Soil Science. 1999. FertilizerRecommentation for Field Crops.Department of Agriculture, Bangkok, 60 p.
(In Thai).
Edmisten, K.L., C.W. Wood and C.H. Burmester.
1994. Effects of early-season foliar
fertilization on cotton growth, yield and
nutrient concentration. J. Plant Nutr. 17 :
683-692.
Fageria, N.K., V.C. Ballger and C.L. Jones. 1997.
Growth and Mineral Nutrition of FieldCrops. 2nd ed. Marcel Dekker Inc., New
York. 624 p.
Freeborn, J.R., D.L. Holshouser, M.M. Alley,
N.L. Powell and D.M. Orcutt. 2001. Soybean
yield response at reproductive stage to soil-
applied nitrogen and foliar-applied boron.
Agron. J. 93 : 1200-1209.
Garcia, L.R. and J.J. Hanway. 1976. Foliar
fertilization of soybeans during the seed-filling
period. Agron. J. 68 : 653-657.
Goss, M.L., A. de Varennes, P.S. Smith and J.A.
Ferguson. 2002. N2 fixation by soybean grown
with different levels of mineral nitrogen, and
the fertilizer replacement value for a following
crop. Can. J. Soil Sci. 82 : 139-145.
Haq, M.U. and A. P. Mallarino. 2000. Soybean
yield and nutrient composition as affected by
early season foliar fertilization. Agron. J. 92
: 16-24.
Harper, J.E. 1987. Nitrogen metab olism, pp. 497-
533. In J.R. Wilcox (ed.). Soybean :Improvements, Production, and Uses. 2nd
ed. Agron. Mono. 16. ASA, CSSA, and SSSA,
Madison, WI.
Jackson, M.L. 1973. Soil Chemical Analysis.Prentice-Hall, New Delhi. 498 p.
Lauer, D.A. 1982. Foliar fertilization of dry beans
with Zn and NPKS. Agron. J. 74 : 339-344.
Linsay, W.L. and W.A. Norvel. 1978. Development
of a DTPA soil test for zinc, iron, manganese
and copper. Soil Sci. Soc. Am. J. 42 : 421-
428.
Mallarino, A.P., M.U. Haq, D. Wittry and M.
Bermudez. 2001. Variation in soybean
response to early season foliar fertilization
among and within fields. Agron. J. 93 : 1220-
1226.
Moraghan, J.T. 1991. Removal of endogenous
iron, manganese, and zinc during plant
washing. Commun. Soil Sci. Plant Anal. 22
: 323-330.
Ohwaki, Y., Y. Kraohaw, S. Chotechuan, Y. Egawa
and K. Sugahara. 1997. Differences in
responses to iron deficiency among various
cultivars of mungbean (Vigna radiata (L.)
Wilczek). Plant and Soil 192 : 107-114.
Oonkasem, B. and C. Thavarasook. 1988.
Micronutrient deficiency of mungbean in
Takhli soil, pp. 172-185. In Proceedings of the3rd Mungbean Conference. Kanchanaburi,
November 21-23, 1988. (In Thai).
Parker, M.B. and F.C. Boswell. 1980. Foliar injury,
nutrient intake, and yield of soybean as
infuenced by foliar fertilization. Agron. J. 72
: 110-113.
Pongsakul, P. and S. Ratanarat. 1999. On overview
of foliar fertilization for rice and field crops in
Thailand, pp. 199-220. In A. Suriyapan, E.
Hansakdi, P. Parkpian, R. Simmons and C.
Traynor, (eds.). Proceedings of the 2nd
International Workshop on FoliarFertilization. April 4-10, 1999. Bangkok.
Poole, W.D., G.W. Randal and G.E. Ham. 1983.
Foliar fertilization of soybeans. I. Effects of
fertilizer sources, rates and frequency of
application. Agron J. 75 : 195-200.
Ratanarat, S., W. Masangsan, P. Vadeesirisak, C.
Ditsantia and V. Phanuvas. 1990. Effects of
iron foliar spray and specific Rhizobium strains
on yield components of three peanut cultivars,
pp. 120-128. In Proceedings of 8th NationalGroundnut Research Meeting. 3-5 May
26 Kasetsart J. (Nat. Sci.) 37 (1)
1989. Roi-Et, Thailand (In Thai).
Reinbott, T.M. and D.G. Blevins. 1995. Response
of soybean to foliar-applied boron and
magnesium and soil applied boron. J. PlantNutr. 18 : 179-200.
Rerkasem, B. 1989. Boron deficiency in food
legumes in Northern Thailand. J. Soil Fert.16 : 130-152. (In Thai with English abstract).
Reuter, D.J. and J.B. Robinson. 1997. PlantAnalysis : An Interpretation Manual.CSIRO, Victoria, Australia. 572 p.
Schon, M.K. and D.G. Blevins. 1990. Foliar boron
applications increase the final number of
branches and pods on branches of field grown
soybeans. Plant Physiol. 92 : 602-607.
Sinclair, T.R. and C.T. de Wit. 1975. Photosynthate
and nitrogen requirements for seed production
by various crops. Science 189 : 565-567.
Smith, G., W. Weibold, T.L. Niblack, P. Scharf
and D.G. Blevins. 2000. Yield components of
soybean plants infected with soybean cyst
nemathode and sprayed with foliar
applications of boron and magnesium. J. PlantNutr. 23 : 827-834.
Suanmalee, N., N. Tiaranan, R. Deemark and Y.
Soravisuitra. 1990. Foliar fertilization forsoybean production on Pak Chong and
Wang Sapung soil series. Annual Report,
Field Crops and Fertilizer Research Group,
Soil Science Division, Department of
Agriculture, Thailand. (In Thai).
Vasilas, B.L., J.O. Legg and D.C. Wolf. 1978.
Foliar fertilization of soybeans : absorption
and translocation of 15N – labeled urea. Agron.J. 70 : 787-791.
Vasilas, B.L., R.L. Nelson, J.J. Fuhrmann and
T.A. Evans. 1995. Relationship of nitrogen
utilization patterns with soybean yield and
seed filling period. Crop Sci. 35 : 809-813.
Walsh, L.M. 1971. Instrumental Methods forAnalysis of Soil and Plant Tissue. ASA,
CSSA and SSSA, Madison, WI. 221 p.
Weaver, M.L., H. Timm, H. Ng, D.W. Burke and
M.J. Silbernagel. 1985. Pod retention and
seed yield of beans in response to chemical
foliar applications. HortScience 20 : 429-
431.
Yataputanon, J., P. Chaivanakupt, S. Wunprasert
and T. Arayangkul. 2002. N-fixation of
soybean and residual effect from N-fixation
of soybean to rice yield in rice-soybean
cropping system using N-15 technique. J.Soil and Fert. 24 : 1-21. (In Thai with English
abstract).
Kasetsart J. (Nat. Sci.) 37 : 27 - 32 (2003)
Preliminary Test of Polyploidy Induction in Cotton(Gossypium arboreum) Using Colchicine Treatment
Arunee Wongpiyasatid1, Praparat Hormchan2 and Ngamchuen Rattanadilok3
ABSTRACT
Two local varieties of Gossypium arboreum, PM2 and PM3 were treated with colchicine solution
for polyploidy induction. Two colchicine solutions, colchicine solution # 1 (0.1% colchicine) was
derived from powder sold by Sigma and colchicine solution # 2 (0.5% colchicine) from drug tablets for
gout treatment. Three experiments were undertaken which were, Experiment 1: apical meristem
dropping with colchicine solution # 1; Experiment 2: seed treatment with colchicine solution # 2.
Experiment 3 : apical meristem dropping with colchicine # 2. All were compared with the untreated
(water treatment) controls. The results showed % germination of PM2 and PM3 after seed treatment to
be lower than those of the controls. The same were found with their heights. Eleven, nine and three
presumably polyploidy plants of PM2 in Experiment 1, PM3 in Experiment 1 and PM3 in Experiment 2
respectively were found to have stomata sizes of 24.9%, 34.9% and 31.4% increased and stomata
frequencies of 24.2%, 46.5% and 45.9% decreased compared to those of the controls respectively.
Key words: cotton, Gossypium arboreum, colchicine, polyploidy
INTRODUCTION
Cotton originally cultivated in Thailand
were native cotton, Gossypium arboreum origin
and the so-called ‘Indian cotton’. Earlier attempt
to improve cotton production was by introducing
the ‘Cambodian cotton’ from Cambodia to Thailand
in the early 1950’s. The so-called ‘Cambodian
cotton’ was in fact the American Upland cotton,
Gossypium hirsutum introduced to Cambodia
earlier (Na Pompeth, 1994). G. arboreum consists
of both white and brown cotton which produces
short, sparse seed hairs that are not spinnable. It is
diploid and possess 13 pairs of chromosome
(2n=26) while G. hirsutum is allotetraploids with
26 pairs of chromosome (4n=52) (Fryxell, 1969)
American cotton, G. hirsutum is very likely
an alloploid derived from hybridization between
Gossypium thuberi and G. arboreum (http://www.
biology. ualberta.ca/courses hp/gen275/problem-
set-key-2-0.1 htm) followed by chromosome
doubling resulting in well-developed seeds.
However, hybridization between different species
may not be so successful due to different
chromosome numbers or sizes. Polyploidy,
therefore, could be artificially induced by some
treatments, such as colchicine. In the late 1930’s,
it was discovered that colchicine inhibited the
formation of spindle fibers and effectively arrested
mitosis at the anaphase stage. At this point, the
chromosomes have multiplied but cell division
have not yet been taken place resulting in polyploidy
1 Department of Applied Radiation and Isotopes, Faculty of Science, Kasetsart University, Bangkok 10900, Thailand.
2 Department of Entomology, Faculty of Agriculture, Kasetsart University, Bangkok 10900, Thailand.
3. Department of Agronomy, Faculty of Agriculture, Kasetsart University, Bangkok 10900, Thailand.
Received date : 14/02/03 Accepted date : 31/03/03
28 Kasetsart J. (Nat. Sci.) 37 (1)
cells. In later year, a number of other mitotic
inhibitors including oryzalin, trifluralin,
amiprophos-methyl and N2O gas have been
identified and used as doubling agents (Bouvier et
al., 1994; van Tuyl et al, 1992; Taylor et al, 1976).
Colchicine treatment is the classical method
to induce doubling of chromosome number. The
techniques used for chromosome doubling of barley
haploid with colchicine have been reported by
Jensen (1974), Subrahmanyam and Kasha (1975)
and Thiebaut and Kasha (1977). Yan (2001)
demonstrated that ploidy of waxflowers could be
doubled using colchicine. The tetraploid plantlets
were found to have large leaves with fewer large
stomata than the diploid, an indicator of increased
ploidy level. Most species of Fuchsia are either
diploid or tetraploid. Addink (2002) reported that
a crossing between a diploid and tetraploid of
Fushia often resulted in a triploid which was
mostly sterile and could not be used for further
breeding. Doubling the chromosome number with
colchicine treatment from the diploid parent and
the triploid could solve breeding problem in Fushia.
Hybrid HAR was obtained from crossing of G.
hirsutum and G. arboreum and G. raimondie using
colchicine (DOA, 1984). Stephens (1947) also
reported the morphology of cotton hybrids through
colchicine treatment.
Chromosome counting which is time
consuming and laborous is not suitable for detection
mixoploidy in tissues with lower proportion of
dividing cells such as leaves (Uhlik, 1981) Recently
stomata size, leaf index value, stomata frequency,
pollen grain diameter and other changes in plant
morphology were found to be useful indicators in
the primary screening for new ploidy levels.
Evan(1955) and Speckman et al (1965) stated that
stomata length was the accurate indicator of
polyploidy level in many plants. Wright (1976)
also showed that stomatal measurement was a
quick way to determine whether or most of the
leaves on a branch were polyploidy. The purpose
of this study is to induce polyploidization in G.
arboreum by colchicine treatment using plant
attributes as primary indicators.
MATERIALS AND METHODS
Two local varieties of G. arboreum, PM2
(light brown cotton) and PM3 (white cotton) were
used for polyploid induction through colchicine
treatment. PM2 and PM3 were grown in pots, 30
pots/variety/treatment. Three seeds per pots were
grown to obtain three plants. Twenty pot plants
were treated with colchicine while 10 pot plants
with just water.
Colchicine solutions were derived from
two sources
1) Sigma sold colchicine powder was
diluted in water into 0.1 % colchicine solution
(colchicine solution # 1)
2) Colchicine tablets (drug for gout
treatment) were dissolved in water to obtain 0.5%
colchicine solution (colchicine solution # 2)
Three experiments were undertaken as
followed
Experiment 1A few drops of colchicine solution # 1 were
applied on the apical meristem of seedlings between
the first pair of true leaves. To aid in absorption,
cotton balls were placed on the treated spots. The
treatments were repeated during 8:00-9:00 am for
3 consecutive days. The controls were treated with
water.
Experiment 2This experiment was achieved by soaking
seeds in colchicine solution # 2. The bottles with
seed treatment were periodically shaken. After 24
hours, the treated seeds were washed in the flowing
water for 3 hours, and then planted in the pots. The
controls were treated with water.
Experiment 3The similar procedure was followed as in
Kasetsart J. (Nat. Sci.) 37 (1) 29
Experiment 1 except colchicine solution # 2 (with
no cotton balls covered the apex) was used instead
of colchicine solution # 1.
All plants, both treated and untreated (the
controls) in all experiments were allowed to grow
normally. Seed germination, plant height, stomata
size, and stomata frequency per 1 mm of leaf area
were checked.
Stomata measurementSimilar sizes of treated and untreated leaves
from 3-4 months old plants were sampled, 5 leaves/
plant. For stomata sizes, lower epidermis from
both left and right sides of each leaf sample were
peeled off, placed on glass slides covered with
cover glasses and measured under 40X
stereomicroscope. Stomata lengths were measured
employing ocular micrometer, 10 measurements/
leaf (5 from left and 5 from right sides of the mid
vein). It was replicated 5 times. The values obtained
were computed into micrometer (mm) using stage
micrometer.
To obtain stomata frequency, the
measurements were undertaken under 40X
stereomicroscope through TV monitor. Surface
cells of 5 leaves/plant, treated and the control,
were used, 10 measurements/plant The
measurements were undertaken from both left and
right sides of each leaf.
RESULTS AND DISCUSSION
Changes in the morphological
characteristics such as plant height, stomata size
and stomata frequency were important indicators
for the detection of ploidy levels in M1 generation
of cotton varieties. Table 1 presents % germination
of PM2 and PM3 after seed treatment (Experiment
2) with colchicine solution # 2 to be lower than
those of the controls. The results half agreed with
explanation from Addink (2002) who stated that
colchicine with too high concentration could inhibit
the development of living part resulting in mortality
of organism. Although most treated seeds survived
to produce healthy plants, only a few could become
polyploidy. This might be due to the fact that even
though colchicine solution # 2 had high contration
of colchicine (0.5%), the starch suspension from
tablets could interfere with the absorbtion of
colchicine through the seed coats. However, the
Table 1 Averaging percent germinations and height of G. arboreum the local varieties, PM2 and PM3,
after colchicine treatments compared to the (untreated) control.
Germination (%) Plant Height (cm)
Experiment Treatment PM2 PM3 1st measurement/1 2nd measurement/2
PM2 PM3 PM2 PM3
1 Control - - 12.50 13.15 62.40 66.90
Treated - - 9.70 11.15 60.50 68.70
2 Control 95 100 14.40 13.05 71.10 89.60
Treated 78 72 11.90 11.95 66.40 94.80
3 Control - - 11.75 10.60 60.40 62.90
Treated - - 10.10 11.50 60.50 60.90
1 Averaged heights of PM2 and PM3 plants from the first measurement on Days 75, 60 and 45 after planting for Experiment 1,
2 and 3 respectively.2 Averaged heights of PM2 and PM3 plants from the second measurement on Days 130, 120 and 100 after planting for Experiment
1, 2 and 3 respectively.
30 Kasetsart J. (Nat. Sci.) 37 (1)
24 – hour period of seed soaking still allowed
sufficient time for some seeds to receive high
doses resulting in no germination while some
obtained low or no dose resulting in
polyploidization or normal germination
respectively.
The averaging heights of treated plants of
PM2 and PM3 in all experiments were also found
to be lower than those of the untreated except that
of PM3 treated plant in Experiment 3 on the first
measurement. This exception might be similarly
explained to the result of % germination that the
starch suspension from tablets in colchicine
solution could prevent absorbtion of colchicine
doses through meristem droppings, hence, no
apparent height different from the control to be
seen. For seedling treatment, colchicine solution #
1 revealed more effectively than 0.5 % from drug
tablets with different effects. Stebbin (1950) stated
that the decrease growth rate of polyploids was
caused by the reduced ratio of cell division. The
supply of the cells with auxin, a phyto-hormone
was interrupted, the respiratory intensity was
reduced and the activity of many enzymes was
disminished. The results on plant height on first
measurement also agreed with Kerr (2001) and
Wright (1976) who stated that the induced 4n
seemed to grow more slowly and growth
abnormality were the first indication of successful
colchicine treatment.
However, the inhibition continued for 5-6
weeks after which the surviving plants of both
varieties in all experiments resumed normal growth
and development as appeared on the second
measurements. This was confirmed by Yan (2001)
who treated shoot tips of waxflower by immersion
in 0.05 % colchicine and found them to exhibit a
deformation of the new growth but it was only
transient, later growth returned back to normal.
In Table 2 the stomata size of selected
plants are found to range from 26.25-34.65, 32.35-
37.40 and 30.15-33.85 mm while those of the
control are 22.50-27.25, 24.65-27.75 and 22.05-
26.65 mm for PM2 in Experiment 1, PM3 in
Experiment 1 and PM3 in Experiment 2
respectively.
Compared to the control plants, the treated
plants of both cotton varieties had epidermis with
Table 2 Anatomical differences in leaves between the controls and the treated cotton plants of the two
cotton varieties, PM2 and PM3.
Ranges of Stomata
Experiment Variety Treatment Stomata Length Length (±S.D) Frequency (±S.D) 1
(mm) (mm)
1 PM2 Control 22.50-27.25 25.20±1.25 427.3±19.30
Treated 26.25-34.65 30.40±3.01 324.0±89.60
Difference - 20.90% increase 24.20% decrease
1 PM3 Control 24.65-27.75 26.00±1.00 451.50±33.02
Treated 32.35-37.40 35.00±1.54 241.70±15.47
Difference - 34.90% increase 46.50% decrease
2 PM3 Control 22.05-26.65 24.70±1.00 451.50±33.02
Treated 30.15-33.85 32.40±1.95 244.44±43.00
Difference - 31.40% increase 45.90% decrease
1 = number of stomata per 1 mm2
Kasetsart J. (Nat. Sci.) 37 (1) 31
larger stomata sizes but lower stomata frequency
(Table 2). It was found that the leaves of plants of
PM2 in Experiment1 and PM3 in Experiment 1 and
2 had 24.2, 46.5 and 45.9 % fewer stomata that
were 20.9, 34.9 and 31.4 % longer in length than
those of the untreated plants respectively. The
differences were observed by microscopy as
described in the procedure.
The results agreed with those of Uhlik
(1981) who reported that the polyploid plants
usually had gigantic characteristics such as thicker,
wider and greener leaves with greater stomata size
and larger flowers. Stomata size, frequency of
stomata including pollen grain diameter were
favorable used as preliminary indicator of plants
with polyploidy levels. Tan and Dunn (1973) also
studied the correlation of the above characters
with ploidy levels of Bromus inermis and found
the possitive correlations of stomata length and
pollen grain diameter while negative correlation
of stomata frequency with ploidy levels. That
meant stomata length and pollen grain diameter
increased with the increasing of polyploidy levels.
The opposite was noticed in stomata frequency.
The results agreed with Yan (2001) who reported
that the leaves of the tetraploid plantlets of
waxflower had 54% fewer stomata that were 15%
shorter in length than those of the diploid plantlets.
Collins (1933, 1960) and Kerns and Collins (1947)
studied the diploid, triploid hybrids and diploid
and autotetraploid plants of pineapple variety
‘Smooth Cayenne’ and found that the sizes of cell,
trichomes and stomata also increased with the
ploidy levels while the stomata frequency was
reduced. Sax and Sax (1973) also found greater
somata frequency in diploid than tetraploid leaves
of equal area of Tradescantia camaliculata.
In Experiment 1, chimera was observed
from 5 out of 11 PM2 polyploidy plants which
indicated that as colchicine rarely acted on cells in
a growing point, artificial induction usually resulted
in a mixture called mixoploid or chimera (Wright,
1976). Similarly reported by Addink (2000) and
Kehr (2001), they explained colchicine treatments
to plant constituting of many cells to have chimera
appearances. The results showed that the induced
polyploidy plants still composed of plants with
differing number of chromosomes.
Primary screening of morphological
characteristics revealed 22 plants [11 plants of
PM2 (Experiment 1), 8 plants of PM3 (Experiment
1) and 3 plants of PM3 (Experiment 2)] to be
presumably polyploids with higher ploidy levels.
The 0.1% solution of colchicine derived from
colchicine powder sold by Sigma seemed to give
better results than the 0.5 % solution from the drug
tablets. The rate of polyploidy occurrence from
seedling in Experiment 1 appeared to be higher
than seed treatment in Experiment 2. To confirm
polyploidization, the selected plants will be
furtherly analyzed and chromosome number will
be determined.
CONCLUSION
The preliminary investigation had
demonstrated that
1. 0.1% colchicine solution derived from
powder sold by Sigma gave better results than
0.5% colchicine solution derived from drug tablets.
2. The presumably polyploidy plants of
PM2 and PM3 had slower growth at the beginning
and later resumed normal growth, larger stomata
and less stomata frequency compared to those of
the controls.
ACKNOWLEDGEMENTS
This research work was financially
supported by Kasetsart University Research and
Development Institute (KURDI).
LITERATURE CITED
Addink, W. 2002. Colchicine : Use in plant
breeding work to induce mutations
32 Kasetsart J. (Nat. Sci.) 37 (1)
(polyploidy). file://A:\Colchicine.htm.
Bouvier, L., F.R. Fillon and Y. Lespinasse. 1994.
Oryzalin as an efficient agent for chromosome
doubling of haploid apple shoots in vitro.
Plant Breeding 113 : 343 – 346.
Collins, J.L. 1933. Morphological and cytological
characters of triploid pineapples. Cytologia 4: 248-256.
Collins, J.L. 1960. The Pineapple. Interscience
Publishers, N.Y. 295 pp.
DOA. 1987. Cotton. Academic Document 9 : 213
(in Thai).
Evans, A.M. 1955. The production and
identification of polyploids in red clover, white
clover and lucerne. New Phytol 514 : 149 –
162.
Genetic 275. 2002. Problem Assigment # 2Answer Key. http://www.biology.ualberta.
ca/courses.hp/gen275/problem-set-key-
2.01.htm.
Kerr, A. 2001. Tetraploidy conversion : An easyand effective method of colchicinetreatment. http://members.tripod.com/
~h_syriacus/tetraploidy.htm.
Kern. K.R. and J.L. Collins. 1947. Chimera in the
pineapple : colchicine induced tetraploids and
deiploid-tetraploids in the cayenne variety. J.of Heredity 38 : 322-330.
Jensen, C.J. 1974. Chromosome doubling
techniques in haploids, pp. 153-190. In K.L.
Kasha (ed.). Haploids in higher plants-Advances and potential. University of
Guelph, Canada.
Na Pompeth, B. 1994. Technical aspects of research
in Thailand with emphasis on integrated pest
management approach, pp. 37-50. In CottonSectors in Continental (itak) Southeast Asia.Regional Conference Proceedings, Vientiane,
Lao PDR, Oct 26-28, 1994. French Ministry
of Foreign Affairs/ CCL/CIRAD-DORAS
Project.
Sax, K. and H.J. Sax. 1973. Stomata size and
distribution in diploid and polyploid plants. J.Arnold Arboreum 18 : 164-172.
Speckmann, G.J., J. Post, Jr. and H. Dijkstra. 1965.
The length of stomata as an indicator for
polyploidy in rye-grasses. Euphytica 14 :
225-230.
Stebbins, G.L. 1984. Polyploidy and the
distribution of the arctic-alpine flora : new
evidence and a new approach. BotanicaHelvetica 94 : 1-13.
Stephens, S.G. 1947. Cytogenetics of Gossypium
and the problem of the origin of New World
cotton, pp. 431-442. In Advances in GeneticI. New York Academic Press.
Subrahmanyam, N.C. and K.J. Kasha. 1975.
Chromosome doubling of barley haploids by
introus oxide and colchicine treatments. Can.J. Genet. Cytol. 17 : 573-583.
Tan, Geok-Yong and G.M. Dunn. 1973.
Relationship of stomatal length and frequency
and pollen-grain diameter to ploidy level in
Bromus inermis Leyss. Crops Sci. 13 : 332-
334.
Taylor, N.L., M.K. Anderson, K.H. Wuesenberry
and C. Watson. 1976. Doubling the
chromosome number of trifolium species
using nitrous oxide. Crop Sci. 16 : 516-518.
van Tuyl, J.M., B. Meijer and M.P. van Dien.
1992. The use of oryzalin as an alternative for
colchicine in in-vitro chromosome doubling
of Lilium and Nerine. Acta Hort. 325 : 625-
629.
Uhlik, J. 1981. Kompendium pro postgradualni
studium genetiky a slechteni. Praha VSZ :105 – 195.
Wright, J.W. 1976. Introduction to ForestGenetics. Academic Press, New York.
Yan, G. 2001. Chromosome doubling of waxflower
plantlets regenerated in vitro, pp. 11-20. In
The Proceeding Biology of Waxflower. Areport for the Rural Industries Research and
Development Cooperation.
Kasetsart J. (Nat. Sci.) 37 : 33 - 40 (2003)
Cloning and Nucleotide Sequence of Four tRNA Genesin Mitochondrial Genome of Thai Walking Catfish,
Clarias macrocephalus Günther
Pradit Sangthong and Amnuay Jondeung
ABSTRACT
The Hind III digested fragment of Thai walking catfish mitochondrial DNA was cloned and its
nucleotide sequence was determined. This fragment, consisting of 668 bp, was composed of partial
WANCY region and COI gene. The partial WANCY region was consisted of partial tRNATrp gene,
complete tRNAAla, tRNAAsn, tRNACys, and tRNATyr genes, and origin of light strand replication (OL).
These genes and non-coding sequence (OL) were the same in their organization as those found in other
vertebrates. The partial nucleotide sequence of COI stared with GTG and its inferred amino acids were
highly conserved as previously described in other fishes. Interestingly, the intergenic spacer between
tRNACys and tRNATyr was ten nucleotides in length, which might be unique among Clariid species.
Key words: nucleotide sequence, tRNA genes, Thai walking catfish, Clarias macrocephalus
INTRODUCTION
Thai walking catfish, Clarias
macrocephalus Günther, is one of five Clariid
species found in Thailand and lives in freshwater
swamps, marshes and canals throughout the country
and Southeast Asia (Smith, 1945). Thai fish farmers
have cultured Thai walking catfish for so long by
collecting catfish fry from natural waters such as
paddy fields, swamps and canals (Sidthimunka,
1971). After Tongsanga et al. (1962) had
successfully induced spawning in C.
macrocephalus, the fingerling production was done
by artificial insemination. Since then, the Thai
walking catfish has become one of the most popular
farming species in Thailand. In 1987, the African
catfish, Clarias gariepinus,was introduced to
Thailand and successfully hybridized with C.
macrocephalus (Lawonyawut et al.,1992). The
successful interspecific hybridiazation has resulted
in changing the farming species into the hybrid
ones. This change also has impact on Thai
walking catfish, which is now becoming shortened
and threatened. Therefore, it is very inevitable to
set up the sustainable conservation and
management programs. In making decision
regarding the conservation on the genetic resources
of this species, an understanding of the amount and
distribution of its genetic variation is necessary
(Allendorf and Ryman, 1987). The molecular
genetic information, such as protein polymorphism,
mitochondrial or nuclear DNA variation will be
facilitated in order to understand the genetic
variability of this species.
The vertebrate mitochondrial genome is a
small duplex, covalently closed circular DNA and
varies in size ranging from 15-20 kb. All animal
mitochondrial genomes contain 37 genes, 2 for
Department of Genetics, Faculty of Science, Kasetsart University, Bangkok 10900, Thailand.
Received date : 04/02/03 Accepted date : 31/03/03
34 Kasetsart J. (Nat. Sci.) 37 (1)
ribosomal RNAs, 13 for proteins and 22 for tRNAs
and one major non-coding region (Boore, 1999).
Animal mitochondrial DNA (mtDNA) is haploid
and maternally inherited without recombination.
MtDNA changes at a rate as much as 5-10 times
higher than that of nuclear DNA. This means that
genes in mtDNA have higher variability than
single-copy genes in nucleus. Therefore,
mitochondrial DNA analyses have been widely
used to study the population structure and gene
flow, hybridization and phylogenetic studies
(Moritz et al., 1987) Although the complete
mitochondrial DNA sequences of many fish species
have been reported but none of Clarias species
(Boore, 1999).The objective of this study was to
sequence a cloned fragment of Thai walking
mtDNA in order to obtain a sequence for uses in
the further studies. In this report, the first partial
nucleotide sequence of WANCY region and of
COI gene in mitochondrial genome of Thai walking
catfish was presented.
MATERIALS AND METHODS
Mitochondrial DNA isolation.The mtDNA was isolated by a slightly
modified method of White and Densmore III(1992).
The fresh eggs of single individual of Thai walking
catfish (Clarias macrocephalus Günther) was
homogenized for 1 stroke in 15 ml TEK (50 mM
Tris-HCl pH 7.5, 10 mM EDTA, 1.5% KCl) buffer.
The homogenate was poured into a 50 ml
polypropylene tube and underlayered with 15 ml
of 15% sucrose in TEK buffer. The homogenate
was then centrifuged at 5,500xg for 10 min. The
supernatant was transferred to the new
polypropylene tube and centrifuged at 8,000xg for
30 min. The pellet was suspended in 5-10 ml cold
EST (100 mM EDTA, 150 mM NaCl, 10 mM Tris-
HCl pH 8.0) buffer for 2 cycles and centrifuged at
8,000xg for 15 min. The mitochondrial pellet was
resuspended in 500 ml EST and transferred to a
microfuge tube. The 18% SDS solution was added
to the pellet suspension until final concentration
was 2%. All previous steps were carried out at 4∞C. The suspension was allowed to stand at room
temperature for 10 min. The 250 ml 5M NaCl was
added into the microcentrifuge tube and centrifuged
at 8,000 g for 15 min. The supernatant was
successively extracted by phenol-chloroform-
isoamyl alcohol (25:24:1) and chloroform isoamyl
alcohol (24:1), respectively. The mtDNA was
precipitated with two volumes of ice-cold absolute
ethanol overnight and centrifuged at 12,000xg for
10 min at 4∞C. After washing with 70% ethanol,
the mtDNA was vacuum dried, resuspended in 30
ml TE (10 mM Tris-HCl pH 8.0, 1 mM EDTA pH
8.0) buffer and stored at –20∞C until use.
Cloning and sequencing.Isolated mtDNA was completely cleaved
with Hind III and yielded 5 fragments; 8.8, 3.2,
3.0, 1.1 and 0.6 kb. All Hind III digested fragments,
covering entire genome of mtDNA, were randomly
ligated to pUC 18 with T4 DNA ligase and
transformed into E. coli JM 109 as described by
Sambrook et al. (1989). Transformed colonies
were screened for recombinant plasmid by using
X-gal color system. Recombinant plasmids were
characterized by cleaving with Hind III.The
inserted fragments were compared to each fragment
of intact mtDNA molecules digested with the
same restriction enzyme. It was found that there
were only two clones, pMmt H500 and pMmt
H1000, which contained 0.6kb- and 1.1kb-inserted
fragments respectively. The inserted fragment in
pMmt H1000 clone was too large to be analysed
only with a few reactions. Thus the result will be
presented in the next report.
The recombinant, pMmt H500, was sent to
Bioservice Unit (BSU) of The National Center for
Genetic Engineering and Biotechnology for DNA
sequencing. Dye terminator labeling method was
applied for sequencing on an automatic sequencer
(377 DNA sequencer, PE Biosystem). Nucleotide
sequence data were analyzed by the basic BLAST
Kasetsart J. (Nat. Sci.) 37 (1) 35
program available on www.ncbi.nlm.nih.gov/. The
tRNA genes were aligned with CLUSTAL W
program (Thompson et al., 1994) available on
http://dot.imgen.bcm.tmc.edu:9331/. The obtained
mtDNA sequence of Thai walking catfish was
deposited at GenBank data libraries under the
accession number AF 322219.
RESULTS AND DISCUSSION
The nucleotide sequence of the L-strand of
the Thai walking catfish mtDNA obtained from
the clone pMmt H500 is shown in Figure 1. The
total length of the partial mitochondrial was 668
bp. The overall base composition of this fragment
of L-strand was 39.04%A, 25.75%T, 26.65%C
and 18.56%G. An alignment of this fragment with
mitochondrial sequences of other organisms
deposited in GenBank database revealed that it
contained a partial cluster of 5 tRNA genes, origin
of L-strand replication (OL), partial sequence of
COI and some intergenic spacers.
A partial cluster of 5 tRNA genes was
composed of a partial sequence of tRNATrp gene
and 4 complete genes; tRNAAla, tRNAAsn,
tRNACys and tRNA Tyr. The four tRNA genes
were identified by their sequence homologies to
other vertebrate tRNAs; their specific anticodons
and their potential to fold into cloverleaf secondary
structure showed mismatch and variable atypical
base-pairing in their stem regions (Figure 2). These
tRNAs ranged in size from 69-73 nucleotides. All
proposed cloverleaf structures contained 7-8 bp in
the amino acid arm, 5-6 bp in the TYC stem, 5 bp
in the anticodon stem and 4-5 bp in the DHU stem.
These structures showed variabilities from their
counterparts found mtDNA of bichir (Noack et al.,
1996) and Japanese sardine(Inoue et al., 2000)
which were found consistently 7 bp in the amino
acid stem, 5 bp in the TYC stem, 5 bp in the
AAGCTTTAAGTAGGAGTGAAAATCTCCTAATCTCTGCCATAAGACTTGCAGGACTCTATCCCACATCTTCTGAATGCAACTCAGAC
ACTTTAATTAAGCTAAAGCCTTACTAGATGAGAAGGCCTCGATCCTACAAACTCCTAGTTAACAGCTAGGCGCTCAAACCAACGAG
CATTCATCTACTTTCCCCGCCGCCTAAGCATAAAGGCGGGGAAAGCCCCGGCGGGGGTTTAACCTGCATCTTTAGATTTGCAATCT
AACATGTTATACACCACAAGGCTTCAATATTTACTGATAGGAAAAGGACTCAAACCTTTGTACATGGAGCTACAATCCACCGCCTA
M T I T R W F F S T N H K D I G T L Y L V F GACCCTCGGCCATCCTACCTGTGACGATCACACGCTGATTTTTCTCAACCAACCATAAAGACATTGGCACCCTTTATCTAGTATTTG
A W A G M V G T A L S L L I R A E L A Q P G A L L G D DGTGCCTGAGCCGGAATAGTCGGCACAGCCCTGAGCCTACTAATCCGAGCAGAACTGGCACAGCCTGGGGCTCTTCTAGGAGATGAC
Q I Y N V I V T A H A F V M I F F M V M P I M I G G F G NCAGATCTATAATGTTATTGTCACCGCCCACGCCTTCGTAATAATCTTCTTTATAGTAATACCAATTATGATTGGAGGCTTCGGAAA
W L V P L M I G A P D M A F P R M N N M SCTGACTTGTGCCCCTAATAATTGGTGCCCCCGATATAGCATTCCCACGAATAAATAACATAAGCTT
OL
tRNATrp (partial sequence)
COI (partial sequence)
tRNAAla
tRNACys
tRNATyr
tRNAAsn
Figure 1 The partial L-strand nucleotide sequence of Thai walking catfish mitochondrial genome. The
direction of transcription is denoted by arrows. Beginning and end of each gene are indicated
by a vertical bar (|). The non-coding sequences, origin of L-strand replication (OL) and
intergenic spacer, are overlined with thick and dotted lines respectively. The deduced amino
acid sequence for partial COI is shown above the nucleotide sequence (one-letter abbreviation
is placed above the first nucleotide of each codon). The Hind III retriction sites are underlined.
36 Kasetsart J. (Nat. Sci.) 37 (1)
anticodon stem, and 3-4 bp in the DHU stem.
These animal mt-tRNAs are usually smaller and
lower G+C content and have more nonstandard
base pairs in their stem regions than those of their
nuclear counterparts (Brown, 1985). The order of
gene arrangement of these 4 tRNAs reported here
had similar organization of tRNA genes called
WANCY region, a coding region of 5
mitochondrial tRNAs (tryptophan, alanine,
asparagine, OL, cysteine and tyrosine)(Seutin et
al.,1994), which was reported in mitochondrial
genome of other fishes(Tzeng et al., 1992; Zardoya
and Meyer, 1996 ; and Inoue et al., 2000).
The origin of light strand replication (OL)
in a non-coding DNA sequence of approximately
30 nucleotides is located in the WANCY
TAGATGA
ATCTACT
G
AT
G
G
A
AG
CTG
C T T CCG TAGG
TC
TTGAA
CCTAG
GGATC
TC GCGGAGCT
GT
T T
TG
GTA
TT
tRNAAsn
5í�3í�
TG
G GAA
TTA
A
TG TGACA T
TT
ACGAA
TTAGA
AATCT
GCCTTG
AA
CGGGGC
T
TT
C
T
AC
ATA
CG C CCGCAGG
tRNACys
5û�3û�
TG
G TAG
C
TT
ATGGC
GTGGA
TACCT
T
T
AG
TTG
T T T CCAAAGG
GTAGGA
GTATCCT
CA
G G
TGCC GA
GG CATG
tRNATyr
5û�3û�
T T CGAAG T
AAGGCTT
TTCTGAA
A
TACGT C TCG TGG AG
TCTGA
AGACT
TA
T A
A
G
TG
CGTAT
GAA
T
AG
ATG
ë�
ë�
ë�
ë�
ë�
ë�
ë�
ë� ë�
ë�
tRNAAla
3û�5û� Aminoacyl arm
DHU armTYC arm
Variable arm
Anticodon arm
Figure 2 The putative secondary structure of four Thai walking catfish mitochondrial tRNAs; tRNAAla,
tRNAAsn, tRNACys and tRNATyr, based on sequence of Figure 1.
Kasetsart J. (Nat. Sci.) 37 (1) 37
region(Seutin et al.,1994). In Thai walking catfish
mtDNA fragment, the OL found between the
tRNAAsn and tRNACys and is 35 nucleotides in
length. The OL sequence had capability to form a
stable stem-loop structure with 11 bp in the stem,
13 nucleotides in the loop (Figure 3). The four
nucleotides of the OL stem were parts of tRNACys
gene. It was slightly different from that of lungfish
mtDNA which about half of OL stem shared with
tRNACys gene (Zardoya and Meyer, 1996). The
Thai walking catfish OL also had a conserved
motif, 5’-GCCGG-3’, at base with tRNACys gene.
This conserved motif of OL has been also reported
in Atlantic cod, loach, bichir and human (Noack et
al., 1996; Tzeng et al., 1992 and Anderson et al.,
1981). The most interesting character of Thai
walking catfish OL is a A-T rich sequence in the
loop, which has been reported in bichir (Noack et
al., 1996), African clawed frog (Roe et al.,1985)
and human (Anderson et al., 1981). The role of the
thymine rich sequence in loop region in the human
is shown to be involved in synthesis of RNA
primer for light-strand replication process (Wong
and Clayton, 1985).
The partial sequence of COI, as shown in
Figure 1, is 305 nucleotides in length. The derived
amino acid sequence of a part of COI gene, coding
for cytochrome c oxidase subunit I, is shown in
5û�GGGG GCC T
G CG CG C
G CA TA TA T
C
AG CC
AT
G
T
CCA
C
T
CT
CG
3û� ATGAG
Loach12
(Crossostoma lacustre)
AGA3û� 5û�GCGG TGC
CC
AT
C
C
CC
TG
C
G
G CC GG CG CG CG CA T
T AG CA TA T
A T
C
Atlantic cod15
(Gadus morhua)
G CG CC GG CG CG CA T
A TA TG CG C
TC
TT
A
T
AT
TG
T
G
5û�GGGC CCG GT3û� CCACBichir10
(Polypterus ornatipinnis)
G CG CC GG CG CG CG C
G CA TA TA T
GAT3û� GGGGCCGC5û�
TC
G
AT
T
G TG
T
T
C
Thai walking catfish
(Clarias macrocephalus)
A
G CG CC GG CG CG CA T
G CA TA TG C
GAT3û� GGGG GCC 5û�
TC
GC
C
T
TT
GC
T
T
Human16
(Homo sapiens)
Primer�initiation
T
Figure 3 The stem-loop structures for the origin of light strand replication (OL) of Thai walking catfish
mtDNA and other vertebrates. The underlined sequence represents conserved motif.
38 Kasetsart J. (Nat. Sci.) 37 (1)
Figure 4. The COI gene starts with the initiation
codon of GTG. Normally, this triplet codon
specifies valine within open reading frame. GTG
as initiation codon has been previously reported in
many fish species such as freshwater loach (Tzeng
et al., 1992), lungfish (Zardoya and Meyer, 1996),
bichir (Noack et al., 1996), deep sea fish (Miya
and Nishida, 1999) and Japanese sardine (Inoue et
al.,2000), but not in Atlantic cod (Johansen et
al.,1990), which use GUG as the initiation codon
for the COI gene. The inferred amino acid sequence
of partial COI is also compared to those sequences
of cod, loach and trout (Figure 4). It was found that
the homologies of TW catfish COI compared to
that of other fish ranges from 96 to 97%. This
shows that COI polypeptide sequence is highly
conserved as previously described in Atlantic cod,
loach and trout (Johansen et al., 1990; Tzeng et
al., 1992; Zardoya et al. 1995)
Interestingly, the intergenic spacer between
tRNACys and tRNATyr is 10 nucleotides in length.
It has been reported that the intergenic spacers in
many fish species are absent or small number of
nucleotides (Miya and Nishida, 1999; Inoue et al.,
2000) Long spacer has been found between
tRNAThr and tRNAPro genes of 8 cod fish species
which varies in size ranging form 25 to 99 bp and
their variation can be determined both at
intraspecific and interspecific levels(Bakke et al.,
1999) Thus, the intergenic spacer found here might
be a unique feature of the Clariid species.
CONCLUSION
The mtDNA of Thai walking catfish was
isolated from freshly ripen eggs, cleaved with
Hind III and cloned into pUC18. A recombinant
clone, pMmt 500 contaning about 0.6kb-inserted
fragment, was screened by using X-gal system and
sent for sequencing of its inserted fragment. The
inserted mtDNA fragment was found to be 668 bp
in length and composed of a partial WANCY
region and a partial COI gene. The sequence was
analyzed and discussed comparatively with
mitochondrial sequences of other organisms.
LITERATURE CITED
Allendorf, F.W. and N. Ryman. 1987. Genetic
management of hatchery stocks, pp. 141-159.
In N. Ryman and F. Utter (eds.). PopulationGenetics & Fishery Management.University
of Washington Press. Seattle.
Anderson, S., A.T. Bankier, B.G.Barrell, M.H.L.
de Bruijn, A.R. Coulson, J. Drouin, I.C.
Eperon, D.P. Nierlich, B.A. Roe, F. Sanger,
Figure 4 The inferred amino acid sequence of partial COI gene of Thai walikng catfish (Mac) and those
of other fishes: Atlantic cod (Cod), Loach (Loa), and Trout (Tro). A dot indicates amino acid
similarity.
10 20 30 40 50 60Mac MTITRWFFSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELAQPGALLGDDQIYNVIVTA 60Cod .A.......................................S.................. 60Loa .A.......................................N.................. 60Tro .A.......................................S.................. 60
70 80 90 100Mac HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMS 101Cod ............L.........I.................. 101Loa .............L................H.......... 101Tro ......................I.................. 101
Kasetsart J. (Nat. Sci.) 37 (1) 39
P.H. Schreier, A.J. Smith, R. Staden and I.G.
Young. 1981. Sequence and organization of
the human mitochondrial genome. Nature290 : 457-465.
Bakke, I., G.F. Shields and S. Johansen. 1999.
Sequence characterization of a unique
intergenic spacer in Gadiformes mitochondrial
DNA. Mar Biotechnol. 1 : 411-415.
Boore, J.L. 1999. Survey and summary: Animal
mitochondrial genomes. Nucleic Acid Res.27 : 1767-1780.
Brown, W.M. 1985. The mitochondrial genome
of animals, pp.95-130. In R.J. MacIntyre (ed.).
Molecular Evolutionary Genetics. Plenum
Press, New York.
Inoue, J.G., M. Miya, K. Tsukamoto and M.
Nishida. 2000. Complete mitochondrial DNA
sequence of Japanese sardine, Sardinops
melanostictus. Fisheries Sci. 66 : 924-932.
Johansen, S., P.H. Guddal and T. Johansen. 1990.
Organization of the mitochondrial genome of
Atlantic cod, Gadus morhua. Nucleic AcidsRes. 18 : 411-419.
Miya, M. and M. Nishida. 1999. Organization of
the mitochondrial genome of a deep-sea fish,
Gonostoma gracile (Teleostei: Stomiiformes):
first example of transfer RNA gene
rearrangements in bony fishes. Mar.Biotechnol. 1: 416-426.
Moritz, C., T.E. Dowling, W.M. Brown. 1987.
Evolution of animal mitochondrial DNA:
Relevance for population biology and
systematics. Ann. Rev. Ecol. Syst. 18 : 269-
292.
Lawonyawut, K., B.J. McAndrew, D.J. Penman
and P. Sodsuk. 1992. Electrophoretic and
morphological studies of the hybrid catfish,
pla duk bigoui (female Clarias macrocephalus
Gunther X male C. gariepinus Burchell), pp.
137-139. In Proceedings of InternationalWorkshop on Genetics in Aquaculture andFisheries Management, University of
Sterling, 31st August –4th September 1992.
Noack, K., R. Zardoya and A. Meyer. 1996. The
complete mitochondrial DNA sequence of
the bichir (Polypterus ornatipinnis), a basal
ray-finned fish: ancient establishment of the
consensus gene order. Genetics 144 : 1165-
1180.
Roe, B.A., D.P. Ma, R.K. Wilson and J.F.H. Wong.
1985. The complete nucleotide sequence of
the Xenopus laevis mitochondrial genome. J.Biol. Chem. 260 : 9759-9774.
Sambrook, J., E.F. Fritsch and T. Maniatis. 1989.Molecular Cloning: A Laboratory Manual.2nd ed.,Cold Spring Harbor Laboratory Press,
Cold Spring Harbor, NY.545 p.
Seutin, G., B.F. Lang, D.P. Mindell and R. Morais.
1994. Evolution of the WANCY region in
amniote mitochondrial DNA. Mol. Biol. Evol.11 : 329-340.
Sidthimunka, A. 1971. Production of catfish
(Clarias spp.) and its problems in Thailand.
Thai Fish. Gaz. 24(4) : 497-506.
Smith, H.M. 1945. The Fresh-water Fishes ofSiam, or Thailand. United States Government
Printing Office, Washington. 622p.
Thompson, J.D., D.G. Higgins and T.J. Gibson.
1994. CLUSTAL W: improving the sensitivity
of progressive multiple sequence alignment
through sequence weighting, position-specific
gap penalties and weight matrix choice.
Nucleic Acids Res. 22 : 4673-4680.
Tongsanga, S., A. Sidthimunka and D. Menasveta.
1962. Induced spawning in catfish (Clarias
macrocephalus Gunther) by pituitary hormone
injection, pp. 205-213. In Indo-PacificFisheries Council Proceedings, 10th Session,
IPFC Secretariat, FAO Regional Office for
Asia and Far East, Bangkok.
Tzeng, C.S., C.F. Hui, S.C. Shen and P.C. Huang.
1992. The complete nucleotide sequence of
the Crossostoma lacustre mitochondrial
genome: conservation among vertebrate.
Nucleic Acids Res. 20 : 4853-4858.
White, P.S. and L.D. Densmore III. 1992.
40 Kasetsart J. (Nat. Sci.) 37 (1)
Mitochondrial DNA isolation, pp. 29-58. In
A.R.Hoelzel (ed.). Molecular GeneticAnalysis of Population: A PracticalApproach. Oxford University Press, New
York.
Wong, T.W. and D.A. Clayton. 1985. In vitro
replication of human mitochondrial DNA:
accurate initiation at the origin of light-strand
synthesis. Cell 42 : 951-958.
Zardoya. R. and A. Meyer. 1996. The complete
nucleotide sequence of the mitochondrial
genome of the lungfish (Protopterus dolloi)
supports its phylogenetic position as a close
relative of land vertebrate. Genetics 142 :
1249-1263.
Zardoya, R., A. Garrido-Pertierra and J.M. Bautista.
1995. The complete nucleotide sequence of
the mitochondrial DNA genome of the rainbow
trout, Oncorhynchus mykiss. J. Mol. Evol. 41
: 942-951.
Kasetsart J. (Nat. Sci.) 37 : 41 - 46 (2003)
Relation of Paralumbar Nerves and Conus Medullaris tothe Vertebrae of Swamp Buffaloes
Narong Chungsamarnyart, Worawut Rerkamnuaychoke and Nati Nilnophakoon
ABSTRACT
The last thoracic (T13) and the first three lumbar spinal nerves (L1-L3) of the 20 adult swamp
buffaloes specimens were dissected and observed the relation of their crossing to the tip of transverse
processes of first five lumbar vertebrae (TL1-TL5). Their dorsal and ventral branches crossed obliquely
caudolaterally on the dorsal and ventral surface of the lumbar transverse processes, respectively. The T13
crossed the anterior border of TL1 tip (20 specimens). Most of L1 (8 specimens and two of the right side)
crossed the posterior border of TL2 tip. The L1 of 6 specimens crossed the anterior border of TL3 tip.
Some variations of L1 crossed the anterior border of TL2 tip and the posterior border of TL3 tip. The L2
crossed the anterior (10 specimens and one of the right side) and the posterior (7 specimens) border of
the TL4 tip, and a few specimens variably crossed the posterior border of TL3 tip. Most of ventral branch
of L3 were lining caudolaterally under psoas muscles. The ventral branch of L3 in some specimens (4
specimens and two of only right and left side) have a branch on the dorsal surface of the psoas muscles
and crossed the posterior border of TL5 tip. The conus medullaris of spinal cord of all specimens were
taper to filum terminale at the caudal part of the first sacral vertebra.
This study showed the variation in the course of the lumbar spinal nerves. It might be recommended
that the effective paravertebral anesthesia nerve blocks in swamp buffaloes will be injected to the tip of
the first five lumbar transverse processes, and infiltrated to anterior and posterior of them for the last
thoracic and the first three lumbar spinal nerves blocks, respectively. The epidural anesthesia in swamp
buffaloes will be safe for the spinal cord by injection at sacrococcygeal foramen since the spinal cord is
taper to filum terminale in the first sacral vertebra.
Key words: paralumbar nerves, spinal cord end, swamp buffalo
Department of Veterinary Anatomy, Faculty of Veterinary Medicine, Kasetsart University, Bangkok 10900, Thailand.
Received date : 06/01/03 Accepted date : 10/03/03
INTRODUCTION
The local anesthesia of spinal lumbar nerves
or epidural anesthesia are the safety anesthesia in
large animals for ruminotomy, caesarian sections
and exploratory laparotomy. The lumbar
paravertebral nerves block in cow has been in
clinical practice (Cakala, 1961, de Lahunta and
Habel, 1986). The anesthesia injection points are
located by palpation and injection at the tip of
lumbar transverse processes which the dorsal and
ventral branches of the last thoracic spinal (T13)
and the first three lumbar spinal nerves (L1, L2 and
L3) are upper and under lining on lumbar transverse
processes as follows; the last thoracic spinal nerve
crossed the anterior border of the first lumbar
42 Kasetsart J. (Nat. Sci.) 37 (1)
transverse process Tip (TL1), the first lumbar
spinal nerve (L1) crossed the posterior border of
the second lumbar transverse process tip (TL2),
the second lumbar spinal nerve (L2) crossed the
posterior border of the fourth lumbar transverse
process tip (TL4), and the third lumbar spinal
nerve (L3) are running straight caudally along the
bodies of vertebrae, under psoas muscles.
Therefore, the relationship between lumbar spinal
nerves and the lumbar transverse processes are
important to locate the injection points for lumbar
paravertebral nerve blocks, but those injection
points in the swamp buffalo has not yet elucidated.
The end of spinal cord (conus medullaris)
in relation to the spinal vertebrae is important to
locate the safety point of epidural anesthesia
injection. The safety injection points should be
posterior to the end of spinal cord and anterior to
the end of dura mater. The end of spinal cord and
the end of dura mater of the horse, ox, dog and cat
have been reported and applied in clinical epidural
anesthesia (Seiferle, 1951; de Lahunta and Habel,
1986). The end of spinal cord of the horse, cow,
dog and cat terminate at the first or second sacral
vertebrae, the first sacral vertebra, the sixth lumbar
vertebra and the sixth lumbar to the third sacral
vertebrae, respectively. While the end of dura
mater of horse, cow, dog and cat locate at the third
sacral vertebra, fourth sacral vertebra, first sacral
and first coccygeal vertebra, respectively.
However, the relation between the end of
spinal cord and spinal vertebrae of the swamp
buffalo has not yet reported. Thus this study try to
elucidate the relation of the end of spinal cord to
the body of sacral vertebrae and the lumbar spinal
nerves to the lumbar transverse processes of
vertebrae.
MATERIALS AND METHODS
The posterior part of vertebrae of 20 adult
swamp buffaloes were collected from slaughter
house, including the last two thoracic with ribs, the
pelvis and coccygeal vertebrae. Thirteen buffalo
specimens were 3-4.5 years old. Six specimens
were 8-10 years old and 1 year old was one
specimen. The dorsal and ventral branches of 13th
thoracic, 1st, 2nd and 3rd lumbar spinal nerves were
dissected and observed of their crossing to the tip
of lumbar transverse processes (TL). Then the
specimens were fixed with 10% formalin for
dissecting the end of spinal cord and observed the
relation of the cord with the sacral vertebrae.
RESULTS
The dorsal and ventral branches of the 13th
thoracic, 1st, 2nd and 3rd lumbar spinal nerves
crossed obliquely caudolaterally on the dorsal and
ventral surface of the succeeded lumbar transverse
processes, respectively. The dorsal branches
perforated the longissimus dorsi muscle to
subcutaneous layer at the top of transverse
processes tip of succeeded vertebrae. (Figure 1a)
The ventral branch of the 13th thoracic
spinal nerve (VT13) of all 20 specimens crossed
the anterior border of transverse process tip of the
first lumbar vertebra (TL1 ). (Figure 1a, 1b, and
2a)
Most of specimens (8 specimens and two
of the right side) had ventral branches of the 1st
lumbar spinal nerve (VL1) crossed the posterior
border of transverse process tip of the 2nd lumbar
vertebra (TL2), while the VL1 of 6 specimens
crossed the anterior border of transverse process
tip of the 3rd lumbar vertebra (TL3 ) (Figure 1a, 1b,
and 2a). There were 4 specimens and one of the left
side which VL1 crossed the anterior border of
transverse process tip of the second lumbar vertebra
(TL2). It was one of the left side of specimen
which VL1 crossed posterior border of transverse
process tip of the third lumbar vertebra (TL3).
The ventral branch of the 2nd lumbar spinal
nerve (VL2) of 10 specimens and one of the right
side crossed the anterior border of the 4th transverse
process tip (TL4). The other 7 specimens had VL2
Kasetsart J. (Nat. Sci.) 37 (1) 43
Figure 1a and 1b. The dorsal and ventral views of lumbar region of swamp buffalo specimen No. 16
(B16) show the course of last thoracic (T13) and first three lumbar spinal nerves (L1-L3). The
dorsal (DT13) and ventral (VT13) branches of T13 cross the anterior tip of first lumbar
transverse process (TL1). The dorsal (DL1) and ventral (VL1) branches of L1 cross the anterior
part of TL3 tip. The dorsal (DL2) and ventral (VL2) branches of L2 cross the posterior part of
TL4 tip. The dorsal (DL3) and the right ventral (DVL3, dorsally psoas muscle branch)
branches of L3 cross the posterior part of TL5 tip. The dorsal (DL4 and DL5) and ventral (VL4
and VL5) branches of L4 and L5 run caudolaterally on the dorsal and ventral surface of pelvic
girdle, respectively.
44 Kasetsart J. (Nat. Sci.) 37 (1)
Figure 2b. The dorsal view of opened sacral region of buffalo specimen No. 20 (B20) shows the filum
terminale of spinal cord (arrow) at the caudal part of the first sacral vertebra (S1), and the end
of dura mater at the third sacral vertebra (S3). S2; the second sacral vertebra.
Figure 2a. The ventral view oflumbar region ofswamp buffalo speci-men No. 20 (B20)shows the course of theventral branches of thelast thoracic (VT13)and the first three lum-bar spinal nerves (VL1-VL3). The VT13crosses the anterior partof the first lumbar trans-verse process (TL1) tip.The VL1 crosses theanterior part of TL3 tip.The VL2 crosses theposterior part of TL4tip. The dorsally psoasmuscle branch of leftVL3 crosses the poste-rior part of TL5 tip.
Kasetsart J. (Nat. Sci.) 37 (1) 45
crossing the posterior border of the TL4 tip (Figure
1a, 1b, and 2a). The VL2 of a few specimens (2
specimens and one of the left side) showed variably
crossed the posterior border of TL3 tip.
The ventral branch of the 3rd lumbar spinal
nerve (VL3) of the most specimens (14 specimens
and two of only left and right sides) were lining
caudolaterally under psoas muscles to the inguinal
region. The VL3 in some specimens (4 specimens
and one of the left side) have a branch on the dorsal
surface of the psoas muscles (DVL3) which it
crosses the posterior border of transverse process
tip of the fifth lumbar vertebra (TL5) (Figure 1b,
right side and 2a, left side).
The ventral branch of the 4th,5th and 6th
lumbar spinal nerves were lining caudally along
the body of vertebrae to the dorsolateral wall of
pelvic cavity (Figure 1b). These nerves lied far
from the median plane about 3.5-4.5 cm.
The conus medullaris of spinal cord of all
specimens were tapered to filum terminale at the
caudal part of the first sacral vertebra (Figure 2b).
The end of dura mater of all specimens were
located caudal part of the third sacral vertebrae
(Figure 2b).
DISCUSSION
The location of ventral branch of 13th
thoracic spinal nerve of swamp buffalo was at the
same point as of the cattle (Cakala, 1961, de
Lahunta and Habel, 1986) since the ventral branch
of buffalo also crossed the anterior border of
transverse process tip of the first lumbar vertebra.
The ventral branches of the 1st, 2nd, 3rd
lumbar spinal nerves of swamp buffaloes were
greater variable distribution than those of the cattle
(Cakala, 1961, de Lahunta and Habel, 1986). It
might be the cause of the small number of the
specimens (only 20 specimens) and the transverse
process tips of swamp buffaloes are more lateral or
far from the emerging point (intervertebral
foramen) of each lumbar spinal nerves. Thus the
distribution of nerves are more variable lining.
However, the transverse process tips are the easiest
clinical palpation for locating anesthesia injection
points in buffaloes. As the results, it might be
recommended that the local anesthesia infiltration
points of 1st lumbar spinal nerve (L1) in buffaloes
are at the tips of both second and third transverse
process of lumbar vertebra (TL2 and TL3), but the
infiltration anesthesia point of L1 in the cattle is
only the posterior border of TL2 tip (Cakala,
1961). However, the tip of TL2 of buffaloes was
the main infiltration point for L1, since the
percentage of ventral branches of L1 (VL1) crossed
posterior border of TL2 tip were 45% (8 specimens
and two of the right side in 20 specimens) and the
crossing of the anterior border of TL2 tip were
20% (4 specimens and one of the left side in 20
specimens). The VL1 of the others specimens
(30% or 6 specimens in 20 specimens) and 5%
(one specimen) crossed the anterior border and
posterior border of TL3 tip, respectively.
The ventral branch of L2 (VL2) crossed the
anterior border and posterior border of TL4 52.5%
(10 specimens and one of the right side) and 35%
(7 specimens), respectively. It suggested that the
main anesthesia infiltration point for the 2nd lumbar
spinal nerve (L2) in the buffalo might be the tip of
the 4th transverse process tip (TL4). It was similar
to the recommended point in cattle (Cakala, 1961),
but in buffaloes might be need the minor anesthesia
infiltration point for L2 at the tip of TL3 since the
VL2 crossed the posterior border of TL3 12.5% (2
specimens and one of the left side). This infiltration
point will also anesthetize the more caudal lining
of L1 as mentioned above.
The ventral branch of the 3rd lumbar spinal
nerve (VL3) of the most specimens (75% or 14
specimens and two of only left and right sides)
were similar to cattle by lining caudal and slightly
lateral under psoas muscles to the inguinal region
(de Lahunta and Habel, 1986). Some specimens
(or 4 specimens and two of only right and left
sides) having a branch of VL3 on the dorsal
46 Kasetsart J. (Nat. Sci.) 37 (1)
surface of the psoas muscles and crossed the
posterior border of transverse process tip of the
fifth lumbar vertebra (TL5). Therefore, the
infiltration anesthesia of the udder will be injection
3.5-4.5 cm from the median plane to the L3 at
emergence point. This injection point was a little
shorter than the original method of paravertebral
anesthesia in cattle, 5 cm from the median plane
(Farquharson, 1940). However, the width of
vertebral bodies are variable on the body size of
animals.
The ventral branch of the forth lumbar
spinal nerve (VL4) for the udder might also be
anesthetize by injection at emergence point from
intervertebral foramen since it straight caudally
along the bodies of vertebrae to the dorsolateral
wall of pelvic cavity.
The conus medullaris of spinal cord and
the end of dura mater of all specimens were similar
with the cattle (Seiferle, 1951) because they
terminated at the caudal part of the first and third
sacral vertebrae, respectively. This might be
recommended that the lumbosacral epidural
anesthesia can be done in adult buffaloes as similar
procedure as in adult cows (de Lahunta and Habel,
1986).
CONCLUSION
The branch of the lumbar spinal nerves in
swamp buffaloes were greater distribution than in
the cattle. It is recommended to inject at the tip of
the first five lumbar transverse processes and
infiltration to both anterior and posterior part of
them for local anesthesia the last thoracic and first
three lumbar spinal nerves. The epidural anesthesia
in swamp buffaloes will be applied at
sacrococcygeal foramen as similar as in cattle
because of the conus medullaris of spinal cord is in
the first sacral vertebra, and the end of dura mater
is located caudal part of the third sacral vertebra.
ACKNOWLEDGEMENTS
The authors gratefully acknowledge the
Kasetsart University Research and Development
Institute for the research fund.
LITERATURE CITE
Cakala, S. 1961. A technic for the paravertebral
lumbar block in cattle. Cornell Vet. 51 : 64-
67.
De Lahunta A.D. and R.E. Habels. 1986. AppliedVeterinary Anatomy. W.B. Saunders Com.
Philadelphia.
Farquharson, J. 1940. Paravertebral lumbar
anesthesia in the bovine species. JAVMA 97
: 54-57.
Seiferle, E. 1951. Zur Ruckenmarks-topographie
von Pferd und Rind. Abstr. JAVMA 118 :
379-383.
Kasetsart J. (Nat. Sci.) 37 : 47 - 51 (2003)
Isolation of Anti-malarial Active Compound from Yanang(Tiliacora triandra Diels)
Chalerm Saiin and Sutthatip Markmee
ABSTRACT
Malaria remains to be one of the serious problems in tropical countries because of the increase in
antimalarial drug resistance. This investigation was to study the extraction of bioactive compounds with
anti-malarial activity from Yanang (Tiliacora triandra Diels) root. The dried root was extracted with
chloroform : methanol : ammonium hydroxide mixture (50:50:1). Further isolation and purification of the
crude extract using column chromatography and crystallization techniques provided two pure alkaloid
compounds: tiliacorinine (I) and tiliacorine (II) with 0.0082 and 0.0029 percent yield, respectively.
Structures of I and II were confirmed by spectroscopy techniques and compared with reference data.
Key words: anti-malarial, Yanang, Tiliacora triandra Diels, tiliacorinine, tiliacorine
INTRODUCTION
Today malaria is found throughout the
tropical and sub-tropical regions of the world and
causes more than 300 million acute illnesses and at
least one million deaths annually. Moreover, the
increase of drug resistance of Plasmodium
falciparum remains to be serious problems (WHO,
1998). Thailand is a resource of medicinal plants
and many of them have claimed to be used as
antimalarials. Hence, utilization of these plants
has been considered.
Tiliacora triandra Diels, one of the
medicinal plants, known in Thai as Yanang, belongs
to Menispermaceae family. Its root has been widely
used as antipyretic agent for all kinds of fever and
also prescribed in the preparation of antimalarial
in folk medicine (Fumio et al., 1990; Norman and
Nuntavan, 1992). Tiliacorinine (I) and tiliacorine
(II) which are bisbenzylisoquinoline alkaloids have
been found and isolated by using a combination
of chromatography and counter-current distribution
in Tiliacora species, Tiliacora racemosa Colebr
(Anjaneyulu et al., 1969) and their in vitro
antimalarial activity against Plasmodium
falciparum have been studied (Thaweephol et al.,
1987). The isolation of tiliacorinine and tiliacorine
from T. triandra roots by column of ion exchange
resin; Amberlite IRA 400 has been reported
(Thaweephol et al., 1974). Further preparative
thin layer chromatography have more frequently
used for purification of these two compounds
(Pichaet and Boondate, 1981; Thaweephol et al.,
1987). In this report we describe a simple column
chromatographic method without further
purification of the diastereomeric alkaloids,
tiliacorinine and tiliacorine from T. triandra roots.
Our method differs from those reported earlier
with regard to stationary phase material, eluting
solvent composition, and application.
Department of Pharmaceutical Chemistry and Pharmacognosy, Faculty of Pharmaceutical Sciences, Naresuan University,
Phitsanulok 65000, Thailand.
Received date : 27/01/03 Accepted date : 08/03/03
48 Kasetsart J. (Nat. Sci.) 37 (1)
MATERIALS AND METHODS
ChemicalsSilica gel 60 F254 size 0.040-0.0063 mm
for column chromatography, thin layer
chromatography (TLC) aluminium sheets 20 ¥ 20
cm coated with silica gel 60 F254 and kieselguhr
were obtained from Merck (Damstadt, Germany).
Chloroform, methanol and ethyl acetate were
commercial grade and were obtained from Rattana
Trading Co. (Thailand). Analytical grade petroleum
ether and heptane were obtained from SNP Co.
(Thailand). Analytical grade ammonia was
obtained from Carlo Erba (Thailand). Analytical
grade ether was purchased from BDH Co.
(Thailand). Mayer’s reagent was prepared
according to the reference method of USP 23.
Extraction of alkaloids from roots of T. triandraThe air-dried ground root of T. triandra
was bought from Manora O-soad store,
Phitsanulok, Thailand, dried in hot air oven at 70∞C for 3 hours, milled to fine powder and then dried
with the same procedure. The dried powder (2 kg)
was macerated in chloroform : methanol : ammonia
(50:50:1) at room temperature for 24 hours and
filtered. The filtrate was evaporated under reduced
pressure until dry. The residue from the filtration
was further macerated following the same
procedure until the portion of the filtrate gave a
negative result with Mayer’s test (USP 23). All
evaporated extracts were combined and dissolved
in small amount of chloroform. The chloroform
layer was extracted in 10% sulfuric acid several
times until the chloroform layer gave the negative
result with Mayer’s test. The combined aqueous
layer was basified with dilute ammonia to
precipitate water insoluble alkaloids. The mixed
alkaloids were collected and dried in vacuum
desiccator.
Isolation of tiliacorinine and tiliacorineThe mixed alkaloids (9.974 g) were
dissolved in chloroform : methanol (1:1), and then
filtered. The precipitate was discarded and the
filtrate was evaporated under reduced pressure.
The separation of active alkaloids was performed
using column chromatography on a silica gel 60
F254 (4 ¥ 40 cm) eluted with petroleum ether,
heptane and finally with chloroform : methanol :
ethyl acetate (5:1:3), with 30 ml fractions being
collected as follows: fractions 1-34 (A), 35-41 (B),
42-52 (C), 53-69 (D), 70-81 (E), and 82-145 (F).
The collected fractions were monitored using thin
layer chromatography on silica gel GF254 having
chloroform : methanol (9:1) as the solvent system.
Collection B and D were evaporated and then
crystallized in ether to give small pale yellow
needles of tiliacorinine (165 mg) and tiliacorine
(58 mg), respectively. Melting point measurement
(Buchi 535, Japan), ultraviolet-visible (UV-Vis)
spectrophotometry (Lamda20, Perkin Elmer,
Tiliacorinine (I) Tiliacorine (II)
N
O
O
N
CH3
CH3
OCH3 OH
H
OCH3
H1234
1’2’3’
4’ 4’3’2’
1’43 2 1
N
O
O
N
CH3
CH3
OCH3 OH
OCH3
H
H
RS
Kasetsart J. (Nat. Sci.) 37 (1) 49
Germany), infrared (IR) spectrophotometry (KBr
pellet technique, Spectra 2000, Perkin Elmer,
Germany), and proton nuclear magnetic resonance
(1H-NMR) spectrometry (Jeol JMN-A500
spectrometer, using tetramethylsilane as the
internal standard) were used to identify the
structures. Visualization of TLC was observed
under ultraviolet light or by spraying with Mayer’s
reagent.
RESULTS AND DISCUSSION
The extraction of 2 kg grounded root of T.
triandra gave 9.974 g total alkaloids. Further
isolation provided two pure alkaloid compounds
from collection B (165 mg, 0.0082%) and collection
D (58 mg, 0.0029%). The UV spectra of compounds
from collection B and D were identical at lmax 290
nm. The IR spectra of these two compounds are
shown in Table 1.
The 1H-NMR spectra of collection B and D
were in accordance with those of tiliacorinine and
tiliacorine as reported by Guha et al. (1976). The1H-NMR spectrum in CD3Cl of collection B
(Figure 1) showed the 2¢-NCH3 resonance at lower
field (d2.65, s, 3H) and the 2-NCH3 at higher field
(d2.32, s, 3H). The signals of two OCH3 appeared
at 3.87 (s, 3H) and 3.99 (s, 3H). 1H-NMR spectrum
in CD3Cl of collection D (Figure 2) showed the 2¢-NCH3 resonance at lower field (d2.64, s, 3H) and
the 2-NCH3 gave rise to a signal at higher field
(d2.34, s, 3H). The signals of two OCH3 appeared
at 3.87 (s, 3H) and 3.93 (s, 3H). Two of these
compounds, from collection B and D also had six
protons representing the two sets of methylene
bridge protons (d2.82, m, 3H, and d3.00, m, 3H),
the two methine neighbors situated on the two
heterocyclic rings and nine aromatic protons.
The UV-Vis, IR and 1H-NMR spectra of
compound from collection B were slightly
distinguishable from that of collection D. These
results confirmed that the compounds of both
samples were either tiliacorinine or tiliacorine.
However, comparing the melting points of these
compounds (Table 2) to those reported by
Thaweephol et al. (1987), it could be concluded
that collection B (Rf 0.73) was tiliacorinine and
collection D (Rf 0.57) was tiliacorine.
CONCLUSION
Tiliacorinine and tiliacorine, diastereomeric
compounds from the roots of T. triandra were
completely separated by using simple column
chromatography and crystallization techniques.
This method has never been used with this plant
before. The result provided high percentage yield
of tiliacorinine and tiliacorine that could be used
for structure modification and determine the
antimalarial activity relationship. The designing
and modifying of tiliacorine and tiliacorinine
structures are in progress to increase antimalarial
activity for further study.
Table 1 IR spectra bands of compounds from collection B and D.
The bands Frequency (cm-1)
Collection B Collection D
O-H stretching 3,394 3,402
C-H stretching of aromatic moieties 1,587 and 1,502 1,587 and 1,498
C-O stretching 1,277-1,122 1,273-1,118
50 Kasetsart J. (Nat. Sci.) 37 (1)
Figure 2 The 1H-NMR spectrum of collection D in CD3Cl.
Figure 1 The 1H-NMR spectrum of collection B in CD3Cl.
Kasetsart J. (Nat. Sci.) 37 (1) 51
Table 2 Melting point of tiliacorinine and tiliacorine.
Compounds Melting point (∞C)
Thaweephol et al. Our result
Tiliacorinine 162-175 167-170 a
Tiliacorine 264-267 262-264 b
a compound crystallized from collection Bb compound crystallized from collection D
ACKNOWLEDGEMENTS
This work was supported by a grant from
the Faculty of Pharmaceutical Sciences, Naresuan
University, Thailand. We wish to thank Ms.
Kanyarat Sompu and Ms. Wilasinee Kuangaw for
their technical assistance.
LITERATURE CITED
Anjaneyulu B., T.R. Govindachari, S.S. Sathe, N.
Viswanathan, K.W. Gophinath, and B.R. Pai.
1969. Alkaloids of Tiliacora racemosa Colebr.
Tetrahedron 25 : 3091-3105.
Fumio I., D. Supanee, K. Naoko, F. Yuichi, A.
Masaki, R. Nijsiri, and M. Isamu. 1990.
Chemical and biological studies on some Thai
medicinal plants. J Sci Soc. 16 : 25-31.
Guha K. P., P.C. Das , B.Mukherjee, R. Mukherjee,
G.P. Juneau, and N.S. Bhacca. 1976. Structure
of tiliamosine: A new diphenyl
bisbenzylisoquinoline alkaloid from Tiliacora
racemosa. Tetrahedron Letters 47 : 4241-
4244.
Norman R.F. and B. Nuntavan. 1992. ThaiMedicinal Plants Recommended forPrimary Health Care System. Bangkok:
Mahidol University. 402 p.
Pichaet W. and P. Boondate. 1981. Alkaloids of
Tiliacora triandra. Aust. J Chem. 34 : 2001-
4.
Thaweephol D., K. Panida and N. Kazumitsu.
1974. Isolation of active principle from
Yanang. Journal of Department ofMedicinal Science of Thailand 16 : 75-81.
Thaweephol D. and C.Pranee. 1987. Isolation of in
vitro antimalarial priciples from Tiliacora
triandra Diels. Journal of Department ofMedicinal Science of Thailand 29 : 33-38.
United States Pharmacopeial Convention, 1995.
The United States Pharmacopeia, TheNational Formulary : USP 23, NF18 1995,
Rockville, MD. 2391 p.
World Health Organization, 1998. The WorldHealth Report 1998-Life in the 21stCentury: a Vision for All. Geneva. 241 p.
Kasetsart J. (Nat. Sci.) 37 : 52 - 59 (2003)
Synergistic Effects of Sesame Oil with Cypermethrin on theSurvival and Detoxification Enzyme Activity of
Plutella xylostella L. Larvae
Suraphon Visetson1, John Milne2, Manthana Milne3 and Pintip Kanasutar1
ABSTRACT
Two types of insect-toxicity tests, (1) contact and (2) no-choice leaf dipping test, were conducted
using the insecticide cypermethrin without piperonyl butoxide (PB), cypermethrin with PB and cypermethrin
with sesame oil against the 2nd –3rd instar larvae of Plutella xylostella L. Sesame oil showed good
synergism with cypermethrin yielding synergistic ratios (SR) that ranged from 1.54 – 6.33 in the contact
method and 2.04-5.88 in the no-choice leaf dipping method and were comparable to using PB, which
showed SR’s of 6.33 and 6.71, respectively. Both PB and sesame oil mixed together with cypermethrin
inhibited monooxygenase activity by approximately two-third but induced glutathione–S-transferase ca.
2-3 folds in both methods. The synergists had no effect on esterase activity (CF ca. 1.2).
Residues of cypermethrin in the larvae increased by 1.29 – 2.57 folds in the treatments with added
sesame oil compared to a 2.86 fold increase when PB was added, using the contact method. The no choice
leaf dipping method revealed that cypermethrin residue levels increased by 2.82 – 6.91 fold with added
sesame oil and 8.27 fold with added PB. This indicated that both PB and sesame oil played the same role
in the inhibition of an enzyme, possibly monooxygenase. Field trials with Chinese kale showed the same
trends that were evident in the laboratory work. The addition of sesame oil to the insecticide reduced the
larval population by 70-80 percent while the addition of PB reduced the larval population by up to 88
percent in the kale crop. Monooxygenase activities of insect larvae collected in the field from kale sprayed
with cypermethrin plus synergist (sesame oil or PB) were lower than those from kale treated with
insecticide alone. The results in terms of synergism and changes in enzyme metabolism were discussed.
Key words: synergistic effects, sesame oil, cypermethrin, detoxification enzyme, Plutella xylostella L.
Received date : 27/01/03 Accepted date : 28/03/03
1 Department of Zoology, Faculty of Science, Kasetsart University, Bangkok 10900, Thailand.2 Department of Biology, Faculty of Science, Mahidol University, Bangkok 10100, Thailand.3 Department of Agriculture, Bangkok 10900, Thailand.
INTRODUCTION
Although insecticides create manyproblems such as pollution, insecticide resistantinsects, disruption of biodiversity, residues inagricultural products, and most of all, high cost ofproduction, insecticides have been proven to beone of the most effective methods in insect control.
In Thailand, of all vegetable insect pests, thediamondback moth (Plutella xylostella Linn.) isone of the most serious in vegetable. It is resistantto many insecticides in most parts of Thailandwhere insecticides are frequently used. Fortunately,Thailand is one of the countries with the mostdiverse plants in Southeast Asia. Many Thai farmersutilize plant products for insect control. Some
plants contain secondary plant substances such asazadirachtin from neem seed kernels that inhibithormone production in lepidopterous larvae(Schmutterer, 1990). Others, like rotenone fromderris (Derris elliptica Benth) (Visetson and Milne,2001) and selinnadien from tubers of nutgrass(Cyperus rotundus L.) (Visetson et al., 2001) havebeen effectively used in the control of thediamondback moth larvae. However, other uses ofplant products in insect control, e.g., as synergistswith insecticides have never been investigated.Sesame is widely grown in the northeastern part ofThailand. Thai farmers usually plant sesame cropsafter the rice has been harvested. Plants use left-over moisture in the soil from the rice crop andgrow very fast. Sesame oil has many uses: as acosmetic for skin protection, in medicine as anadjuvant for many drug emulsions for ulcer, incooking as a Thai food additive. Furthermore, thechemical structure of the oil is similar to that of theinsecticide synergist, piperonyl butoxide, whichhas played a large role in reducing population ofpyrethroid resistance insects (Collins, 1990).
This research was conducted to investigatethe synergistic effects of sesame oil and piperonylbutoxide with cypermethrin on the survival anddetoxification enzyme activity of P. xylostellalarvae. The inhibition by cypermethrin ofmonooxygenase, esterase and glutathione-S-transferase activity after addition of these synergistswould show how these synergists interact withdetoxification mechanisms. These results couldbe beneficial to Thai farmers as well as tobusinessmen who are looking for ways to reducethe cost of insecticides by the addition of analternative synergist.
MATERIALS AND METHODS
Insect larvae and plant samplesDiamondback moth larvae were collected
from a vegetable producing area in Kanchanaburiprovince, 150 kms west of Bangkok. Larvae werereared under laboratory conditions (23 ± 2∞C)
with methods modified from Visetson et al. (2001).F2 –generation was used for all experiments.Sesame pods collected from Nongpai district(Petchaboon province, 230 kms north of Bangkok)were air-dried. Sesame seeds from the pods wereground and screw- pressed to obtain esame oilwhich was collected into a bottle and stored at-20∞C until used in tests.
Efficacy testsThe toxicities of various concentrations
(0.01- 0.7% w/v) of cypermethrin with or without10% piperonyl butoxide (PB) and varied 0.5-10%sesame oil on 2nd – 3rd instar larvae of Plutellaxylostella L. were determined using a no choiceleaf dipping method and a contact method. Fivereplicates comprising 20 larvae in each replicatewere used in each test. A 5% emulsifier, triton X-100, was mixed into each test solution before trialscommenced. The no –choice leaf dipping methodused a leaf circle disk of Chinese kale with adiameter of 5 cm which was given to the larvae asfood. The contact method was done by allowing20 larvae to move freely in a petri-dish previouslysprayed with test solution. A completelyrandomized design with 5 replicates was used.Mortality was evaluated after 24 hours of exposure.All experiments were run at 23 ± 2∞C. In the caseof control mortality, Abbott’s formula (Matsumura,1975) was employed. LC50 values were calculatedfrom regression equations with cypermethrin usedas control groups.
Detoxification enzyme assaysThe surviving larvae from each treatment
were used in in vitro assays to optimize enzymeactivity of esterase, glutathione-S-transferase andmonooxygenase activities following the methodof Visetson and Milne (2001) by usingparanitrophenyl acetate, dichloronitrobenzene andaldrin as a substrate for the three enzymes. Proteinmeasurement was done according to the method ofLowry et al. (1951) and Bovine Serum Albuminwas used to quantify all enzyme activity.
Kasetsart J. (Nat. Sci.) 37 (1) 53
54 Kasetsart J. (Nat. Sci.) 37 (1)
The coefficient of determination (r2) wasdetermined for both insect larval mortality andenzyme activity. Synergist ratios (SR) andcorrection factors (CF) were quantified to measurethe effectiveness of synergists and changes inenzyme levels, respectively.
Determination of residuesUsing the contact and leaf dipping methods
with the LC50 level, larvae were exposed to variousconcentration of cypermethrin with or without PBor sesame oil for 24 hours and then transferred topetri-dish. Live larvae (approximately 0.5 g) wereassayed for cypermethrin by a method modifiedfrom Visetson (1991) using a disposable pasturepipette column. The column was previously packedwith 1 g aluminium oxide, followed by 0.5 g silicicacid. Live larvae (0.5 g) were crushed with 10 mgtrisodium citrate and 5 mg disodium hydrogenorthophosphate and the mixture was then loadedinto the column. The column was eluted with 15ml of 4% acetone in hexane. The eluent wasconcentrated to 0.5 ml and injected into a GLC/(Varian, USA) equipped with a 63Ni electroncapture detector and a 20 m capillary column,packed with 5% SE-30 on GAS-Chrom Q 80-100mesh. The conditions for chromatography were:injector temp. 220∞C, column 190∞C, detector285∞C, carrier gas flow (N2) 45ml/min. Theseconditions gave 99.8% recovery of cypermethrin.
Field experimentsField trials using Chinese kale were
separately undertaken to confirm laboratory results.The experiment used a randomized complete blockdesign with 5 replicates. Plot size was 6 x 2 squaremeters. Spraying at the rate of 80 litre/rai was doneonce a week, beginning on 10-day old Chinesekale. Seven sprays at 7 days interval were appliedduring the experiment. Larval numbers wereregularly checked at fixed points before and afterspraying for 24 hours. Duncan multiple range test(DMRT) was employed for means comparisonswith p<0.05 according to Finney (1964).
RESULTS AND DISCUSSIONS
Efficacy testsLC50 values for cypermethrin in both types
of test methods, (1) contact and (2) no choice leafdipping methods, against 2nd – 3rd instar larvae ofthe Plutella xylostella L were 0.57 and 0.47% w/v, respectively (Table 1). The addition of 10% PBresulted in synergist ratios (SR) of 6.33 and 6.71folds for first and second methods, respectivelywhereas addition of 10% sesame oil gave the SR of5.7 and 4.27 folds, respectively. In addition, sesameoil plus PB added to cypermethrin did not increaseSR values. The results indicated that both PB andsesame oil played the same role in increasingcypermethrin efficacy. These results were similarto those of Visetson and Milne (2001) who foundthat addition of PB and diethyl maleate to rotenoneincreased rotenone efficiency. A larger SR wasobtained when 20% sesame oil was added but atthis point it was not very economical in terms ofthe cost. The correlation between concentrationand mortality in most experiments indicated r2 of0.87 – 0.99 except that the addition of 0.5%sesame oil showed r2 of 0.69 only in the contactmethod. Hence, this low concentration of sesameoil added might not be sufficient to deplete thedetoxification mechanisms in the larvae. This resultwas similar to that of Visetson (1991) who workedwith PB added to cyfluthrin in the control ofTribolium castaneum. Furthermore, the resultsshowing higher insecticide efficiency after additionof PB confirmed Collins (1990)’s works whoshowed that PB may inhibit one of detoxificationenzymes possibly monooxygenase in insects.
Detoxification enzyme assaysCypermethrin alone gave little increased
monooxygenase activity by ca. 1.12 folds and giveno change in esterase and glutathione-S-transferaseactivity in both test methods (Table 2). Elevatedmonooxygenase levels after application ofpyrethroids have been reported by a number ofworkers (Rose, 1985; Hung and Sun, 1989;
Kasetsart J. (Nat. Sci.) 37 (1) 55
Table 1 LC 50 values of cypermethrin (0.01 – 0.7% w/v) with or without piperonyl butoxide (PB) and
sesame oil against 2nd – 3rd instar larvae of Plutella xylostella L. using no choice leaf dipping
method and contact method.
Application methods1
Treatment (% w/v) Contact Leaf dipping
LC50 (%w/v) r2 Regression eq.4 LC50 (%w/v) r2 Regression eq.
[ SR] [SR]
None3 0.57 ± 0.02c2 0.98 Y = 22.64 + 48.0X 0.47 ± 0.05b 0.97 Y = 33.92 + 34.22X
10% PB 0.09 ± 0.01a 0.99 Y = 46.24 + 41.80X 0.07 ± 0.02a 0.99 Y = 46.98 + 43.16X
[ 6.33] [ 6.71]
0.5% oil 0.37 ± 0.23bc 0.69 Y = 36.93 + 35.32X 0.22 ± 0.25b 0.76 Y = 41.80 + 37.26X
[1.54 ] [2.14 ]
1.0% oil 0.21 ± 0.22b 0.87 Y = 39.89 + 48.10X 0.23 ± 0.12b 0.84 Y = 39.62 + 45.12X
[2.71 ] [2.04 ]
10.0% oil 0.10 ± 0.06a 0.91 Y = 45.72 + 42.80X 0.11 ± 0.09a 0.97 Y = 45.36 + 42.16X
[5.70 ] [4.27]
10% oil + 10% PB 0.11 ± 0.03a 0.97 Y = 43.81 + 56.21X 0.12 ± 0.09a 0.93 Y = 44.04 + 49.64X
[5.18] [3.92]
20.0% oil 0.09 ± 0.03a 0.89 Y = 46.24 + 41.80X 0.08 ± 0.09a 0.99 Y = 46.54 + 43.16X
[6.33] [5.88 ]
1 means followed by different letters within the same column are significantly different at P < 0.052 means ± SD, 5 replicates, 20 individual /replicate, 24 hours check per batch from F2-generation for all experiments.3 ”None” means no PB or sesame oil was added to the various concentration of cypermethrin. SR = (LC50 none)/ (LC50 with PB
or sesame oil) while r2 was a correlation determination between concentration and mortality.4 Y = dependent variable (% mortality), X = independent variable (dose of cypermethrin with or without PB or sesame oil)
Visetson, 1991). Monooxygenase activity wasinhibited after PB was added giving a CF of 1.72fold but giving no change of esterase andglutathione-S-transferase activity in the leafdipping method. These results were similar tothose of Collins (1990) and Visetson (1991) whoworked with Tribolium castaneum. On the otherhand, the CFs for esterase and glutathione-S-transferase were slightly elevated in the contactmethod. These might be due to slight cross-synergisms of PB with esterase and glutathione-S-tranferase found by Prabharker et al. (1988).Although the statistical analysis showed nosignificant different, the addition of 10% sesameoil to cypermethrin trended to give CF of ca. 1.6for monooxygenase activity indicating inhibitionwhile no CF change was obtained when more oilwas administered. This was an indication that
sesame oil was a synergist with cypermethrin thatplayed more or less the same role as PB inmonooxygenase inhibition as proposed by Raffaand Priester (1985). The mixed oil - PB treatmentdid not show differences monooxygenase activity.CF from either PB or oil only treatments is alsoindicate that both sesame oil and PB gave the samemonooxygenase inhibition level.
Determination of cypermethrin residuesThe residues of cypermethrin in the larvae
from contact and leaf dipping method were 0.07and 0.11 ppm, respectively (Table 3). The additionof 10% PB and 20% sesame oil increasedcypermethrin in the larvae showing “residueincreases” (RI) of 2.86 and 2.57 folds in thecontact method and 8.27 and 6.91 folds with theleaf dipping method, respectively. The increased
56 Kasetsart J. (Nat. Sci.) 37 (1)
cypermethrin in the larvae after addition of sesameoil or PB indicated that might be due tomonooxygenase inhibition when the synergistswere added. Both synergists might block an activesite or bind with apoenzymes of monooxygenasemaking it inactive resulting in increasedcypermethrin levels. Furthurmore, the oil plus PBtreatment showed little difference in larvalcypermethrin levels from those of either the PB orthe sesame oil treatment alone. This was alsoanother indication of monooxygenase inhibitionshowing RI of 3.0 and 6.55 in the contact and leafdipping methods, respectively. Higher levels of
accumulated insecticides in insects in terms ofinsecticide metabolism have been reported beforeby a number of workers using labeled insecticideswith synergists: trans-permethrin by De Vries andGeorghiou, (1981), diazinon by Forgash et al.(1962), DDT and dieldrin by Palpp and Hoyer,(1968).
Field experimentsCypermethrin alone reduced larval numbers
in the field by given reduced number (RN) of 1.67.Greater RN (ca. 8.34) was obtained forcypermethrin with 10% PB and for cypermethrin
Table 2 Detoxification enzyme activity of 2nd – 3rd instar larvae of Plutella xylostella L. after addition
of PB or various amounts of sesame oil to cypermethrin at LC50 from Table 1.
Types of detoxification enzyme activity 1,
Treatment (% w/v) Monooxygenase2 Esterase Glutathione-S-transferase
(product produced/min/mg protein)3
[CF]4
Contact Leaf dipping Contact Leaf dipping Contact Leaf dipping
Control 4,412 ± 187.14ab 18.16 ± 3.23b 1.12 ± 0.46a
- - -
None5 5,120 ± 231b 5,461 ± 568b 14.24 ± 0.31ab 15.76 ± 1.17ab 1.04 ± 0.10a 2.07 ± 0.33a
- - -
10%PB 3,671 ± 926ab 3,182 ± 170a 12.14 ± 0.32ab 20.11 ± 1.56ab 0.54 ± 0.16a 2.31 ± 1.12a
[1.39] [1.72] [1.17] [0.78] [1.93] [0.89]
0.5% oil 4,003 ± 243ab 4,678 ± 164ab 12.12 ± 0.96ab 14.79 ± 1.07a 2.43 ± 1.15ab 3.89 ± 1.68 a
[1.28] [1.17] [1.17] [1.07] [0.43] [0.53]
1.0% oil 3,650 ± 331ab 3,783 ± 892ab 10.45 ± 0.47a 17.37 ± 3.54ab 2.17 ± 1.32ab 3.23 ± 1.15a
[1.41] [1.44] [1.36] [0.91] [0.48] [0.64]
10.0% oil 3,200 ± 786ab 3,312 ± 760ab 12.87 ± 0.67ab 19.12 ± 1.23b 3.53 ± 0.11b 3.15 ± 1.12a
[1.60] [1.65] [1.11] [0.82] [0.29] [0.66]
10% oil + 10% PB 3,450 ± 461ab 3,498 ± 312ab 12.88 ± 0.43ab 18.97 ± 3.37ab 3.09 ± 1.11b 3.86 ± 1.09a
[1.48] [1.56] [1.11] [0.83] [0.34] [0.54]
20.0% oil 3,100 ± 879a 3,301 ± 639a 13.54 ± 0.36ab 19.43 ± 7.12ab 3.19 ± 0.12b 3.11 ± 1.14a
[1.65] [1.65] [1.05] [0.81] [0.33] [0.67]
1 means followed by different letters within the same column are significantly different at P < 0.05, DMRT2 means ± SD, 5 replicates, n= 10-15 of 2nd – 3rd instar lavae were employed, 24 hour check per batch from F2-generation for
all experiments.3 enzyme assays were followed Visetson and Milne (2001), the unit of monooxygenase, esterase and glutathion-S-transferase
are picM aldrin epoxidation/min/mg protein, nM paranitrophenol produced/min/mg protein and nM DCNB conjugated
product/min/mg protein.4 CF is a correlation factor = (enzyme activity of none)/ (enzyme activity of treatment).5 “None” means no PB or sesame oil was added to the concentration of cypermethrin while control means spraying with water
onto the larvae.
Kasetsart J. (Nat. Sci.) 37 (1) 57
Table 3 Residues (ppm) of cypermethrin found in larvae of Plutella xylostella L. in the two assay
methods (contact and leaf dipping) after exposure to cypermethrin at LC50 level with and
without PB or sesame oil added.
Residue (ppm) of cypermethrin
Treatment (% w/v) Contact Leaf dipping3
(RI)4 (RI)
None1 0.07 ± 0.01a2 - 0.11 ± 0.06a -
10% PB 0.20 ± 0.11b [2.86] 0.91 ± 0.37b [8.27]
0.5 % oil 0.09 ± 0.06ab [1.29] 0.31 ± 0.12ab [2.82]
1.0% oil 0.09 ± 0.08ab [1.29] 0.54 ± 0.11ab [4.91]
10.0% oil 0.11 ± 0.06ab [1.57] 0.62 ± 0.09b [5.64]
10% oil + 10% PB 0.21 ± 0.07b [3.0] 0.72 ± 0.08b [6.55]
20.0% oil 0.18 ± 0.07b [2.57] 0.76 ± 0.08b [6.91]
1 “None” means no synergist was added to the cypermethrin.2 means followed by different letters within the same column are significantly different at P = 0.05, DMRT3 means ± SD, 5 replicates with 100 individual of 2nd – 3rd instar lavae of F2 generation per replicate were employed, exposure
for 24 hours for all experiments.4 RI was residue increase derived from (residues found in oil and PB or sesame oil added)/ (residue found in “none”).
with 10% sesame oil, RN was 5.74. In other words,the addition of sesame oil to the insecticide reducedthe larval population by 70-80 % while the additionof PB reduced the larval population by up to 88 %in the kale crop. These results showed higher RNvalues than those found by Visetson and Milne(2001) who, using derris extracts with PB, showedthat the addition of PB to cypermethrin reducedthe larvae in chinese kale by up to 50%. Thedifference might be due to a variety of ecologicaleffects. Season has often been reported to causemajor variation in terms of insect infestation incrops. This research was done in the rainy seasonwhen more larvae were found in the area while thework of Visetson and Milne (2001) was done insummer when there were less larvae were found.No further increase in RN was detected when amixture of PB and sesame oil or a higher percentageof sesame oil was added (Table 4). Thedetoxification enzyme activity of larvae from thefield experiment indicated more or less the sametrend as that in laboratory experiments exceptmonooxygenase activity. The monooxygenase
activity varying from 1.1- 1.5 folds was obtainedwhile esterases and glutathione-S-transferaseactivities showed no significant differences from“none”. The field results indicated that 10% sesameoil added to cypermethrin exhibited the same levelof monooxygenase inhibition as the addition of10% PB. This result confirmed the experiments ofYu (1986), Brattsten (1988) and Yang et al. (2001)who pointed out that plant allelochemicals couldeither reduce or inhibit detoxification mechanismsin terms of enzyme systems and hence increased ordecreased insect susceptibility to insecticides. Thiswas similar to the result of Rose (1985) who foundthat mid guts of polyphagous lepidopterous larvaeshowed stronger aldrin epoxidase activity than didthose of monophagous lepidopterous larvae. So,this research also gave strong evidence that sesameoil could stop monooxygenase function indiamondback moth larvae and that this oil could beused as a synergist in place of PB. However, theresults of enzyme activity of purified enzyme bothinduced and inhibited forms after sesame oil wasapplied with other insectcides would reveal the
58 Kasetsart J. (Nat. Sci.) 37 (1)
Table 4 Means numbers ± SD enzyme activities of 2nd – 3rd instar Plutella xylostella L. larvae, found
on the leaves of Chinese kale after application of cypermethrin at LC50 (from Table 1) with or
without PB or sesame oil.
Enzyme activity
Treatment (% w/v) Number of larvae/10 plants Monooxygenase Esterase Glutathione-S-transferase
(product produced/min/mg protein)2,3
[RN]4,5 [CF]
Control 35.13 ± 2.24c1 4,412 ± 187a 18.16 ± 9.23a 1.12 ± 0.12a
- - - -
None 21.21 ± 8.23b 5,822 ± 100b 22.14 ± 0.05ab 2.22 ± 0.36ab
[1.67] - - -
10% PB 4.21 ± 0.89a 3,825 ± 254a 24.67 ± 3.25b 3.12 ± 1.76b
[8.34] [1.52] [0.89] [0.71]
0.5 % oil 10.12 ± 3.41ab 5,273 ± 385b 24.23 ± 1.56b 3.46 ± 1.11b
[3.47] [1.10] [0.91] [0.64]
1.0 % oil 5.61 ± 2.32a 4,982 ± 146a 15.24 ± 3.89a 3.33 ± 1.54b
[6.26] [1.17] [1.45] [0.67]
10.0 % oil 6.12 ± 3.13a 4,481 ± 119a 21.11 ± 1.12ab 3.12 ± 1.11b
[5.74] [1.29] [1.05] [0.71]
10% oil + 10% PB 5.32 ± 1.67a 3,898 ± 540a 22.33 ± 2.67ab 3.23 ± 1.11b
[6.60] [1.49] [0.99] [0.69]
20.0 % oil 6.24 ± 2.41a 4,211 ± 931a 21.44 ± 1.11ab 3.98 ± 1.25b
[5.63] [1.38] [1.03] [0.56]
1 means followed by different letters within the same column are significantly different at P = 0.05, DMRT2 None means no PB or oil was added to the cypermethrin while control means spraying with water onto the kale.3 enzyme assays were followed Visetson and Milne (2001), the unit of monooxygenase, esterase and glutathion-S-transferase
are picM aldrin epoxidation/min/mg protein, nM paranitrophenol produced/min/mg protein and nM DCNB conjugated
product/min/mg protein.4 RN was reduced number which was derived from the division of larvae found in untreated control and number found in treated
one.5 3 replicates with 100 individual of 2nd – 3rd instar lavae were employed, exposure for 24 hours for all experiments.
extent to which sesame oil could be used as asynergist. If sesame oil acts synergistically with allother insecticides, the farmers can reduce the useof insecticides and increase their effectiveness byaddition of sesame oil in formulations.
CONCLUSIONS
Sesame oil showed good synergism withcypermethrin. Both PB and sesame oil mixedtogether with cypermethrin inhibitedmonooxygenase activity. Residues of cypermethrinin the larvae increased by 1.29 – 2.57 folds in thetreatments with sesame oil added. This indicated
that both PB and sesame oil played the same rolein inhibition, possibly monooxygenase. Field trialsinvolving larvae population in Chinese kale gavesimilar results as in the laboratory. The addition ofsesame oil to the insecticide spray reduced thelarval population by 70-80 percent while theaddition of PB reduced the larval population in thekale by up to 88 percent.
ACKNOWLEDGMENTS
This research was supported by theKasetsart University Research and DevelopmentInstitute (KURDI), Kasetsart University, Thailand.
Kasetsart J. (Nat. Sci.) 37 (1) 59
LITERATURE CITED
Brattsten, L.B. 1988. Potential role of plantallelochemicals in the development ofinsecticide resistance, pp 313-348. In P.Barbosa and D. Letourneau (eds.). Novelaspects of insect plant interactions. Wiley,New York.
Collins, P.J. 1990. A new resistance to pyrethroidsin Tribolium castaneum (Herbst). Pestic. Sci.28 : 101-115.
De Vries, D.H. and G. P. Georghiou. 1981.Decreased nerve sensitivity and decreasedcuticular penetration as mechanisms ofresistance to pyrethroids in a (IR)-trans-permethrin-selected strain of the house fly.Pestic. Biochem. Physiol. 15 : 234-241.
Finney, D.J. 1964. Statistical Methods inBiological Assay. 2nd ed. Charles Griffin andCompany Limited, London. 238p.
Forgash, A.J., B.J. Cook, and R.C. Riley. 1962.Mechanisms of resistance in diazinon-selectedmulti-resistant Musca domestica. J. Econ.Ent. 55 : 544-551.
Hung, C.F. and C.N. Sun. 1989. Microsomalmonooxygenase in diamondback moth larvaeresistant to fenvalerate and piperonyl butoxide.Pestic. Biochem. Physiol. 33 : 168-175.
Lowry O.H., N.J. Rosebough, A.L. Parr and R.J.Randall. 1951. Protein measurement with thefolin phenol reagent. J. Biol. Chem. 193 :256-275.
Matsumura, F. 1975. Botanical insecticides, pp.94-99. In Matsumura (ed.). Toxicology ofInsecticides. Plenum, New York.
Palpp, F.W.Jr. and R.F. Hoyer. 1968. Insecticideresistance in the house fly: decreased rate ofabsorption as the mechanism of action of agene that acts as an intensifier of resistance. J.Econ. Ent. 61 : 1298-1303.
Prabharker, N., D.J. Coudriet, and N.C. Toscano.1988. Effect of synergists on organophosphateand permethrin resistance in sweetpotato
whitefly (Homoptera: Aleyrodidae). J. Econ.Ent. 81 : 34-39.
Raffa, K.F. and T.M. Priester. 1985. Synergists asresearch tools and control agents in agriculture.J. Agric. Ent. 2 : 27-45.
Rose, H.A. 1985. The relationship between feedingspecialization and host plants to aldrinepoxidase activities of midgut homogenasesin larval Lepidoptera. Ecol. Ent. 10 : 455-467.
Schmutterer, H. 1990. Properties and potential ofnatural pesticides from the neem tree,Azadirachta indica. Annu. Rev. Entomol.35 : 271-297.
Visetson, S. 1991. Insecticide resistancemechanisms in the rust-red flour beetle(Tribolium castaneum. Herbst). PhD-thesis,The University of Sydney, NSW, Australia.
Visetson, S. and M. Milne. 2001. Effects of rootextract from derris (Derris elliptica Benth) onmortality and detoxification enzyme levels inthe diamondback moth larvae (Plutellaxylostella Linn.). Kasetsart J. (Nat. Sci.) 35: 157-163.
Visetson, S., M. Milne and J. Milne. 2001. Toxicityof 4,11-selinnadien-3-one from nutsedge(Cyperus rotundus L.) tuber extracts todiamondback moth larvae (Plutella xylostellaL.), detoxification mechanisms and toxicityto non target species. Kasetsart J. (Nat. Sci.)35 : 284- 292.
Yang, X, D.C. Margolies., K.Y. Zhu and L.L.Buschman. 2001. Host plant-induced changesin detoxification enzymes and susceptibilityto pesticides in the twospotted spider mite(Acari: Tetranychidae). J. Econ. Ent. 94 :381-387.
Yu, S.J. 1986. Consequences of induced foreigncompound-metabolizing enzymes in insects,pp 153-174. In L. B. Brattsten and S. Ahmad(eds.). Molecular aspects of insect-plantassociations. Plenum, New York.
Kasetsart J. (Nat. Sci.) 37 : 60 - 64 (2003)
Development of Fish Strip from Hybrid Clarias Catfish SurimiFortified with Konjac Flour
Benjawan Chotpradit, Mayuree Chaiyawat and Nongnuch Raksakulthai
ABSTRACT
The hybrid catfish surimi was prepared and used as raw material for fish strip. Fish strip was
processed by mixing hybrid catfish surimi, flour, salt, sugar, soy sauce and pepper for 10 minutes before
rolling into a thin sheet, cooked at 80∞C for 50 minutes in a hot air oven, then baked in a microwave oven
at a high power level for 35 seconds to expand and dry before cutting into a strip. To increase fibre of fish
strip, 1% of konjac flour could be added with moisture content of the mixture adjusted to 70% and 0.1-
0.2% sodium bicarbonate added. Dietary fibre of product from this process could be increased for 1.65
folds. The developed fish strip was more accepted in taste, texture and overall likeliness than the market
product.
Key words: fish strip, hybrid Clarias catfish, surimi, fibre, konjac flour
Department of Fishery Product, Faculty of Fisheries, Kasetsart University, Bangkok 10900, Thailand.
Received date : 03/02/03 Accepted date : 31/03/03
INTRODUCTION
In Thailand, at the present time, snacks
become more influence to people who live in rural
areas especially children. Many kinds of snacks
have been produced; however, most of those snacks
are made of starch and sugar, therefore, their
nutritive values are rather low. Fish can be added
to increase the protein content of snacks, e.g., in
fish strip that is one of the popular snacks with a
market share of about 10% (Boonyasirikul, 1998).
In general, fish strip is made from marine fish or
surimi. Freshwater fish has not yet been used as
raw material. Since hybrid Clarias catfish (Clarias
macrocephalus x C. gariepinus) is the second
highest species raised, the price is sometimes low
tremendously. Therefore new value added product
development may create market demand and a
way to assist the farmers. Surimi is stabilized
myofibrillar proteins obtained from mechanically
deboned fish flesh that is washed with water and
blended with cryoprotectants (Park and Morrissey,
2000). Washing process help to removes
compounds such as sarcoplasmic protein, inorganic
salts, low-molecular weight substances, lipids,
and blood components (Mireles DeWitt and
Morrissey, 2002). The objectives of this study are
to investigate the feasibility of using hybrid catfish
surimi as raw material for fish strip and increasing
dietary fibre in the product by fortification with
konjac flour.
Kasetsart J. (Nat. Sci.) 37 (1) 61
MATERIALS AND METHODS
1. Preparation of hybrid catfish surimi
3. Determination of appropriate dryingtemperature
An appropriate drying temperature was
determined by varying drying temperatures at 60,
70, 80, 90, and 100∞C for 50 minutes. The prepared
fish sheath was dried in a hot air oven at the above
temperature treatments before cooking in a
microwave oven at high level energy for 35 seconds
then cut into a strip of 2 mm width and 15 cm
length.
Fish strip was sensory evaluated for
appearance, color, flavor, taste, texture and overall
acceptability by 15 panelists using hedonic scoring
(1 - 9, 1 = dislike extremely, 9 = like extremely) to
determine the appropriate drying temperature. The
commercial sample with the ingredients of fish
meat, tapioca flour, sugar, salt and soy sauce given
full scores of 9 in all quality attributes was used to
compare with the experimental samples.
Experimental design was RCBD. Analysis of
variance and DMRT were employed. TA-HD
Texture Analyzer was used in measuring tensile
strength (g) of the products. Linear expansion was
calculated as:
Expansion (fold) =
Thickness of
Thickness of
fish strip after cooking in microwave oven (mm)
fish strip before cooking in microwave oven (mm)
4. Fortification of konjac flourKonjac flour of 0, 0.5, 1.0, 1.5 and 2.0% (w/
w) of the total mixture were prepared by suspending
small amount of water and added into the fish
mixture. The moisture of the mixture was adjusted
to 70% before thin sheath making as in 2. Sensory
evaluation and physical properties were determined
as in 3. Dietary fibre was analyzed according to
AOAC (1995).
5. Effect of sodium bicarbonate additionSodium bicarbonate at 0, 0.1, 0.2 and 0.3
% (w/w) of fish mixture with 1% (result of 4)
konjac flour was added and processed as in 2.
Sensory evaluation and physical properties were
Fresh hybrid catfish
Heading, Gutting and Filleting
Washing
Deboning
Leaching 3 times (20 min each)
1st, minced meat: iced water + 0.2%salt = 1:5 by wt
2nd, minced meat: iced water + 0.2%salt = 1:5 by wt
3rd, minced meat: iced water + 0.3%salt = 1:5 by wt
Pressing
Mixing with 3% sugar
Hybrid catfish surimi
Figure 1 Preparation of hybrid catfish surimi.
Source: Kongpun (1996)
2. Processing of fish stripIngredients for making fish strip comprised
74% hybrid catfish surimi, 10% corn starch, 2.5%
wheat flour, 2.5% tapioca flour, 6% sugar, 2.5%
soy sauce, 1.5% salt and 1% pepper.
Catfish meat was prepared into surimi
according to Kongpun (1996). All ingredients
were Kenwood mixed for 10 minutes and rolled on
plastic film into a thin sheath of 1.0-1.5 mm thick.
The fish sheath was dried in a hot air oven before
cooking in a microwave oven at high level of
energy for 35 seconds to reach 14-16% moisture
content then cut into a strip of 2 mm width and 15
cm length.
62 Kasetsart J. (Nat. Sci.) 37 (1)
determined as in 3.
RESULTS AND DISCUSSION
Optimum conditions were considered from
texture, linear expansion (fold), tensile strength
(g) and acceptability. Sensory evaluation scores
and physical characteristics of fish strip dried at
different temperatures are shown in Table 1. It was
found that drying temperature significantly affected
physical properties of fish strip. Sample dried at
80∞C got the highest sensory evaluation score for
texture and linear expansion after cooking was
also the highest but the tensile strength was the
lowest among all treatments, although it was higher
than that of the commercial sample.
Sensory evaluation scores and physical
characteristics of fish strip fortified with different
quantity of konjac flour are shown in Table 2. It
was found that the linear expansion of fish strip
decreased when concentration of konjac flour
increased. It could be concluded that the maximum
Table 1 Sensory evaluation scores and physical characteristics of fish strip dried at different temperatures.
Attribute Sensory evaluation scores at different drying temperature (∞C)1/
60 70 80 90 100 Com. sample
Appearance 6.73±0.90b 6.83±0.84b 6.73±0.88b 7.00±0.91b 6.73±0.88b 9.00±0.00a
Color 6.73±1.03bc 6.53±0.83bcd 7.03±1.31b 6.47±0.99cd 6.03±0.85d 9.00±0.00a
Flavor 6.80±1.08b 7.13±0.74b 7.00±0.84b 7.00±0.92b 6.73±1.03b 9.00±0.00a
Taste 6.27±1.33c 6.20±1.32c 7.13±0.99b 7.15±0.99b 6.27±1.03c 9.00±0.00a
Texture 6.77±0.65c 6.73±0.96c 7.37±0.69b 6.93±0.59bc 6.57±0.49c 9.00±0.00a
Acceptability 7.27±0.67bc 7.07±0.70c 7.53±0.64b 7.30±0.59bc 7.27±0.64bc 9.00±0.00a
Expansion (fold) 1.28±0.11b 1.38±0.08a 1.33±0.10a 1.16±0.11c 1.03±0.14d Not determined
Tensile strength (g) 332.3±42.7bc 325.5±36.8bc 312.2±23.2b 336.4±32.8bc 349.2±35.2c 276.8±11.3a
1/ Values in the same row followed by different letters are significantly different (P£0.05)
Table 2 Sensory evaluation scores and physical characteristics of fish strip fortified with different
concentrations of konjac flour.
Attribute Sensory evaluation scores of fish strip with different concentrations
of konjac flour 1/
0 (%) 0.5 (%) 1.0 (%) 1.5 (%) 2.0 (%)
Appearance 7.60±0.71a 7.40±0.54a 7.13±0.74ab 6.70±0.59b 5.93±0.80c
Color 7.23±0.90a 7.00±0.75a 7.43±0.90a 6.27±0.80b 6.03±0.85b
Flavor 7.47±0.83a 7.37±0.61ab 7.07±0.96abc 6.87±0.91bc 6.73±0.70c
Taste 7.60±0.74a 6.93±0.70a 7.10±0.85ab 6.60±0.51bc 6.10±0.95c
Texture 7.33±0.97a 7.20±0.80ab 7.10±0.54ab 6.53±1.35bc 5.93±1.10c
Acceptability 7.57±0.88a 7.23±0.56a 7.07±0.70a 6.37±0.67b 5.80±0.77c
Expansion (fold) 1.70±0.30a 1.62±0.09a 1.51±0.11ab 1.31±0.17c 0.87±0.13d
Tensile strength (g) 257.7±51.0a 269.4±32.7ab 282.9±26.9ab 301.2±46.1bc 334.8±34.2c
1/ Values in the same row followed by different letters are significantly different (P£0.05)
Kasetsart J. (Nat. Sci.) 37 (1) 63
Table 3 Sensory evaluation scores and physical characteristics of fish strip prepared with different
concentrations of sodium bicarbonate.
Attribute Sensory evaluation scores of fish strip with different concentrations
of NaHCO31/
0 (%) 0.1 (%) 0.2 (%) 0.3 (%) Com. sample
Appearance 7.00±1.25cd 7.80±0.56b 7.37±0.48bc 6.57±0.59d 9.00±0.00a
Color 6.17±1.13d 7.20±0.56b 6.77±0.68bc 6.43±0.98cd 9.00±0.00a
Flavor 6.60±1.18b 7.20±0.62b 6.80±1.00b 6.67±1.11b 9.00±0.00a
Taste 6.87±0.91c 7.57±0.62b 7.27±0.53bc 7.00±1.19c 9.00±0.00a
Texture 6.27±1.28c 7.47±0.91b 7.00±0.38b 6.23±0.70c 9.00±0.00a
Acceptability 6.83±0.99b 7.37±0.58b 7.10±0.47b 6.20±1.58c 9.00±0.00a
Expansion (fold) 1.24±0.15c 1.58±0.11b 1.71±0.11b 2.08±0.57a Not determined
Tensile strength (g) 324.1±28.9c 276.0±32.4b 277.7±42.0b 221.1±38.2a 271.0±19.4b
1/ Values in the same row followed by different letters are significantly different (P£0.05)
concentration of konjac flour used was 1.0 %.
Increasing a concentration of konjac flour lowered
sensory evaluation scores of the products. However,
sensory evaluation scores of samples with 1 %
konjac flour were not significantly different from
the samples with 0 or 0.5 % konjac flour (P>0.05).
Dietary fibre of the sample with 1 % konjac flour
was 0.76% (AOAC, 1995) increased by 1.65 folds
from sample with out konjac flour.
Sensory evaluation scores and physical
characteristics of fish strip prepared with different
concentrations of sodium bicarbonate compared
with commercial sample are shown in Table 3. It
was found that the higher the concentration of
sodium bicarbonate used the increase in the
expansion of fish strip was obtained. However,
from the sensory evaluation scores on texture and
overall acceptability, it was concluded that
appropriate concentrations of sodium bicarbonate
were 0.1 – 0.2 %.
Fish strip prepared at the most appropriate
conditions of konjac flour and sodium bicarbonate
was compared with commercial sample. The results
were shown in Table 4. The sensory evaluation
scores for all attributes except flavor of the prepared
sample were higher than that of the commercial
sample. The score for flavor of the prepared sample
was lower, although not significant, due to the
specific flavor of hybrid catfish. However, the
scores for taste and overall acceptability were
significantly higher (P£0.05).
Table 4 Sensory evaluation scores of prepared fish strip and commercial sample.
Attribute Appearance Color Flavor Taste1/ Texture Overall1/
acceptability
Prepared sample 6.90±0.81 6.80±0.94 6.33±0.79 7.40±0.66a 7.10±0.91 7.17±0.75 a
Com. sample 6.70±0.75 6.83±1.25 6.80±0.70 6.60±0.95b 6.80±1.19 6.33±0.96 b
1/ Values in the same column followed by different letters are significantly different (P< 0.05)
64 Kasetsart J. (Nat. Sci.) 37 (1)
CONCLUSION
1. Sample dried at 80∞C for 50 minutes
then cooked in a microwave oven at high for 35
seconds contained 14-16 % moisture content.
2. The addition of konjac flour should not
be higher than 1%.
3. Sodium bicarbonate increased the linear
expansion of the sample and softened its texture.
Therefore addition of 0.1 - 0.2% sodium
bicarbonate in sample with 1% konjac flour was
recommended.
4. Prepared fish strip has higher sensory
evaluation score than the commercial sample in
taste and overall acceptability (P£0.05) but
appearance, color, flavor and texture were not
significantly different.
ACKNOWLEDGEMENTS
This work was partially supported by thesis
and Dissertation Support Fund, Graduate School,
Kasetsart University.
LITERATURECITED
AOAC. 1995. Official Methods of Analysis. 16th
ed. Association of Official Analytical
Chemists. Arlington, Virginia.
Boonyasirikul, P. 1998. Production of Snacks at
the Institute of Food Research and Product
Development. Kasetsart University, Bangkok,
pp. 47-52. In 30 years, the Institute of FoodRescarch and Product Development,Kasetsart University. Kasetsart University,
Bangkok.
Kongpun, O. 1996. Yield and quality of surimi
from hybrid Clarias catfish and effect of
food additives on gel forming ability.
Fisheries Gazette 49 (1) : 48-54.
Mireles DeWitt, C.A. and M.T., Morrissey. 2002.
Pilot plant recovery of catheptic proteases
from surimi wash water. BioresourceTechnology 82 : 295-301.
Park, J.W. and M.T., Morrissey. 2000.
Manufacturing of surimi from light muscle
fish, pp 23-59. In J.W. Park (ed.). Surimi andSurimi Seafood. New York.
Kasetsart J. (Nat. Sci.) 37 : 65 - 71 (2003)
Antiaflatoxigenic Effect of Lactic Acid Bacteria IsolatedFrom Some Thai Fermented Foods
Siriporn Stonsaovapak1, Ladda Wattanasiritham1
and Aree Shuvisitkul2
ABSTRACT
Eighty – seven isolates of lactic acid bacteria (LAB) were isolated from some Thai fermented
foods. They comprised Lactobacillus, Pediococcus, Leuconostoc, Lactococcus, Streptococcus, and
Enterococcus. Each of these isolates was tested for its antifungal activity against Aspergillus flavus. Of
eighty – seven LAB isolates, the two isolates with high antifungal activity were chosen for further
identification. They were identified as Lactobacillus plantarum and L. brevis. The effects of LAB
supernates on growth and aflatoxin production in culture of A. flavus grown in malt extract broth for 14
days at 25∞C were also studied. Both of them showed inhibitory ability on growth and aflatoxin
production in cultures.
Key words: lactic acid bacteria, Thai fermented foods, antiaflatoxigenic
1 Institute of Food Research and Product Development, Kasetsart University, Bangkok 10900, Thailand.
2. Department of Science Service, Ministry of Science, Technology and Environmental, Bangkok 10400, Thailand.
Received date : 16/01/03 Accepted date : 26/03/03
INTRODUCTION
Aflatoxins are secondary metabolites
produced by Aspergillus flavus, A. flavus subsp.
parasiticus, and A. nomius in various foods and
agricultural commodities. Aflatoxins have been
shown to be toxigenic, carcinogenic, mutagenic,
and teratogenic to different species of animals
(Campbell and Stoloff, 1974). Aflatoxin B1 is the
most potent hepatocarcinogen in many animal
species (Chu, 1977). Aflatoxins have been reported
to be produced in cereal grains, peanuts, tree nuts,
figs, seeds and fermented products including cheese
and fermented meats such as salami, sausage, and
country cured hams (Gourama and Bullerman,
1995). Therefore, the presence of aflatoxins in
foods presents a potential hazard to human health.
Lactic acid bacteria (LAB) are gram
positive, non – sporulating microaerophilic bacteria
whose main fermentation product from
carbohydrates is lactate. They comprise both
cocci and rods. LAB are commonly found in foods
including fermented meat, vegetables, fruits,
beverages and dairy products (De Vuyst and
Vandamme, 1994). They are also of paramount
importance in food technology because of their
contribution to flavour and aroma development
and to spoilage retardation. The inhibition of
growth of food spoiling bacteria can be due to one
or more of the antibacterial substances produced
by LAB namely organic acids, hydrogen peroxide
and proteinaceous substances with a bactericidal
or bacteriostatic mode of action, such as
bacteriocins (Vandenbergh, 1993). The
antibacterial effects of LAB and their metabolites
are well documented and have been extensively
66 Kasetsart J. (Nat. Sci.) 37 (1)
investigated, but more research on the antifungal
effects is needed (Klaenhammer, 1988;
Stonsaovapak et al. , 1994).
The present study was undertaken to
demonstrate the inhibition of aflatoxitgenic fungi
by LAB isolated from some Thai fermented foods,
in order to reduce the health hazard of aflatoxins.
The inhibition of toxigenic molds by LAB could
be of great public health significance.
MATERIALS AND METHODS
Mold cultureThe organism used in this study was
Aspergillus flavus, obtained from the Department
of Agriculture, Ministry of Agriculture and
Cooperatives, Bangkok, Thailand. It was
maintained on slants of potato dextrose agar (PDA
; Merck, Darmstadt) at 4∞C until further use.
Preparation of spore suspensionCulture of the fungi was grown on PDA
slants for 7 to 10 days at 25∞C until well sporulated.
The spores were harvested by adding 10 ml of
sterile water and aseptically dislodging the spores
with a sterile inoculating loop. Spore suspensions
were aseptically filtered through sterile cheesecloth
to remove mycelial debris. The spore suspensions
were further adjusted with sterile water to give a
final spore concentration of approximately 104
spores / ml. The spore concentration was
determined on PDA plates using standard pour
plate technique at 25∞C for 2 to 3 days. The PDA
used in this study was not acidified, and the pH of
this medium after sterilization was 5.6 ± 0.2
Bacterial strains and culture conditionsLAB used in this study were isolated from
locally available Thai fermented foods including
fish and shellfish, pork, vegetables, and rice (Table
1). 25 g of each sample was added to 225 ml of
sterile phosphate buffer pH 7.0 and thoroughly
homogenized for 1 minute in a stomacher. 0.1 ml
of the appropriate dilutions were spread onto the
surface of MRS plates (MRS medium; Merck,
Darmstadt) and incubated for 3 days at 30∞C.
Colonies of LAB were randomly selected from
MRS plates. They were propagated and maintained
in MRS broth.
Preparation of culture supernatantsFor preparation of culture supernatants, the
randomly selected isolates LAB were grown in
MRS broth at 30∞C for 18 h without shaking. Cells
were removed by centrifugation at 8,000 rpm for
10 minutes, followed by filtration of the culture
supernatants through a 0.45 mm pore size filter
(Millipore).
Table 1 Thai fermented foods used in the experiment.
Vegetable Fish and shellfish Pork Rice
Pak-Sian-Dong Pla-Som Nham Khao-Mak
Naw-Mai-Dong Pla-Paeng-Daeng Sai-Krok-Prieo
Pak-Kard-Dong Pla-Ra
Tua-Ghog-Dong Nam-Bu-Du
Sa-Tau-Dong Kung-Som
Hom-Dong Tai-Pla
Kung-Jom
Hoi-Dong
Kasetsart J. (Nat. Sci.) 37 (1) 67
Screening of antifungal activity by LABApproximately 104 spores / ml of the A.
flavus (indicator organisms) were used for testing
the antagonistic activity. A. flavus was spread with
a swab on PDA plates, 5 ml of LAB culture
supernantant was spotted on freshly prepared lawn
of A. flavus (Mayr – Harting et al., 1972). After
incubated plates for 3 – 5 days at 25∞C, the plates
were checked for inhibition zones. The culture
supernatant which were qualified as positive were
neutralized to pH 7 with 0.1 N NaOH and were
tested again for antifungal activity. LAB that had
high antifungal activity were further identified
and were used in inhibition test.
Identification of LABLAB were identified by gram staining,
catalase test, cell morphology, growth at selected
temperatures, thermal resistance, and carbohydrate
fermentation pattern (Weiss, 1992).
Inhibition test of fungal growth and aflatoxinproduction
Tests for inhibition of fungal growth and
aflatoxin production were assayed in flask cultures.
One millilitre of the final spore suspension
containing about 104 spores / ml of A. flavus was
inoculated in 125 ml conical flasks containing 10
ml of malt extract broth (Merck, Darmstadt).
Different concentrations of selected LAB supernate
were added to the flask. The flask cultures were
then incubated for 14 days at 25∞C. After 14 days
of incubation, the survival of mold growth were
determined on PDA plates. Duplicate samples
were taken for each assay, and experiments were
replicated three times to reduce variability
Determination of approximate aflatoxin
content in the cultures were carried out according
to the method reported by Bullerman et al., (1977).
Flasks were samples aseptically by removing
duplicate portions of 0.1 ml of broth for aflatoxin
determination. The culture filtrate was extracted
with 5 ml of chloroform by liquid / liquid extraction.
Total aflatoxin content was then determined by
measuring UV absorption at 362 nm using a
spectrophotometer and calculating total aflatoxin
content using the molar extinction coefficient of
21,800 reported for aflatoxin B (Asao et al., 1963).
The approximate aflatoxin content was calculated
from three replicate experiments.
RESULTS AND DISCUSSION
Eighty – seven isolates of lactic acid bacteria
were isolated from locally available Thai fermented
foods including vegetables, fish and shellfish,
pork and rice. The genus of all LAB isolates were
identified according to the method described by
Weiss (1992). The results showed that LAB
isolated from Thai fermented foods were
Lactobacillus (73 isolates), Pediococcus (6
isolates), Leuconostoc (2 isolates), Lactococcus
(2 isolates), Streptococcus (2 isolates), and
Enterococcus (2 isolates) (Table 2).
The results showed that many kinds of
LAB can be found in Thai fermented foods. It was
also shown that Lactobacillus was the predominant
genus among LAB isolated in this study. This
finding agreed with those of Charernjiratrakul and
Rodpradit (1997), who studied on the isolation and
identification of lactic acid bacteria from Thai
fermented foods.
Each of these isolates were tested for
antifungal activity against A. flavus by using spot-
on-lawn assay. The result showed that of the 87
LAB isolates studied, 47 isolates did not show any
inhibitory ability against A. flavus. Twenty – three
isolates had low inhibitory ability producing
inhibition zones of less than 6 mm. Ten isolates
were considered to have low inhibitory ability too,
by producing 6-10 mm inhibition zones. Five
isolates were considered to have moderate
inhibitory ability producing 10-18 mm inhibition
zones. Two isolates had high inhibitory ability
producing inhibition zones of more than 20 mm
(Table 3).
68 Kasetsart J. (Nat. Sci.) 37 (1)
Table 2 The genus of lactic acid bacteria isolated from Thai fermented foods.
Genus Number of LAB
Isolates %
Lactobacillus 73 83.90
Pediococcus 6 6.90
Leuconostoc 2 2.30
Lactococcus 2 2.30
Streptococcus 2 2.30
Enterococcus 2 2.30
Table 3 Antifungal activity of lactic acid bacteria
isolated from Thai fermented foods
against A. flavus.
Number of isolates A. flavus
Inhibition zone
47 -
23 +
10 ++
5 +++
2 ++++
- = no inhibition zone
+ = inhibition zone of less than 6 mm
++ = inhibition zone of 6 – 10 mm
+++ = inhibition zone of 10 – 18 mm
++++ = inhibition zone of more than 20 mm
When the pH of the culture supernatants of
the two isolates which gave high inhibitory were
adjusted to 7 with 0.1 N NaOH before testing their
antifungal activity, the supernatants remained their
ability to inhibit the growth of A. flavus. It indicated
that fungal inhibition was not due to the lactic acid
produced.
Antifungal activities of LAB had been
reported by some investigators (Batish et al., 1991),
and the inhibitory compound was polypeptide.
Two isolates of LAB with high inhibitory
ability were morphologically, physiologically, and
biochemically characterized and identified
according to the method described by Weiss (1992).
The result showed that L1 isolate identified as
Lactobacillus plantarum and L2 isolate was L.
brevis (Table 4).
The effects of L1 and L2 supernates on
growth and aflatoxin production in culture of A.
flavus grown in malt extract broth for 14 days at
25∞C were presented in Table 5. No growth or
aflatoxin could be detected in the culture to which
10% of L1 supernate had been added, whereas
slightly growth and trace of aflatoxin production
were obtained when 10% of L2 supernate was
added to the cultures.
It has also been reported previously that
Lactobacillus cell-free supernatant inhibited the
production of aflatoxin (Karunaratne et al., 1990).
It was shown that the aflatoxin inhibition was
probably due to an inhibitory metabolite other
than hydrogen peroxide and low pH. The aflatoxin
reduction was due to low-molecular-weight
inhibitory compounds. Partial purification and
characterization of the inhibitor showed that it was
a heat-stable compound.
From the available literature and also this
study on the effect of LAB on mold growth and
mycotoxin production, it would appear that LAB
have the potential as biological control agents in
foods to prevent mold growth. The antifungal
biopreservatives have the potential to constitute
suitable food preservatives that are safe, effective,
and acceptable to consumers, regulatory agencies,
Kasetsart J. (Nat. Sci.) 37 (1) 69
Table 4 Morphological, physialogical, and biochemical characteristics of the 2 isolates of lactic acid
bacteria having high inhibitory ability.
Characteristics Lactic acid bacteria isolates
L1 L2
Morphology Rod Rod
Gram stain + +
Catalase test - -
Growth at 15∞C + +
Gas production - +
Hydrolysis of arginine - +
Fermentation of
Arabinose - +
Cellubiose + -
Esculin + -
Galactose + +
Gluconate + +
Glycerol - -
Inulin - -
Lactose + +
Maltose + +
Mannitol + -
Melezitose + -
Melibiose + +
Raffinose + -
Rhamnose - -
Ribose + +
Salicin + -
Sorbitol + -
Sucrose + -
Trehalose + -
Xylose - +
L. plantarum L. brevis
and the food industries. Many reports showed that
the inhibition of mycotoxins by LAB was due to
factors other than acidity, and there is a strong
indication that some inhibitory compounds are
protein in nature. It is recommended that in future
studies more research is needed to purify and
identify inhibitory compounds.
ACKNOWLEDGEMENTS
The authors would like to acknowledge the
Kasetsart University Research and Development
Institute for provided funding this study.
70 Kasetsart J. (Nat. Sci.) 37 (1)
LITERATURE CITED
Asao, T., G. Buchi, M.M. Abdel – Kadir, S.B.
Chang, E.I. Wick and G.N. Wogan. 1963.
Aflatoxin B and G. J. Am. Chem. Soc. 85 :
1706 – 1707.
Batish, V.K., L. Ram, and S. Grover. 1991.
Interaction of Streptocccus lactis subsp.
diacetylactis DRC – 1 with Aspergillus
parasiticus and A. fumigatus in milk. Cult.Dairy Prod. J. 26 : 13 – 14.
Bullerman, L.B. , F.Y. Lieu, and S.A. Seier.
1977. Inhibition of growth and aflatoxin
production by cinnamon and clove oils,
cinnamic aldehyde and eugenol. J. Food Sci.42 : 1107 – 1109.
Campbell, T.C. , and L. Stoloff. 1974. Implication
of mycotoxins for human health. J. Agric.Food Chem. 22 : 1006 – 1015.
Charernjiratrakul, W. and A. Rodpradit. 1997.
Isolation, screening and identification of lactic
acid bacteria from Thai fermented foods.
Songklanakarin J. Sci Technol. 19 : 181 –
188.
Chu, F.S. 1977. Mold of action of mycotoxins and
related compounds. Adv. Appl. Microbiol.40 : 352 – 357.
De Vuyst, L. , and E.J. Vandamme. 1994. Lactic
acid bacteria and bacteriocins : their practical
importance, pp.1 – 11. In L. De Vuyst and
E.J. Vandamme (eds.). Bacteriocins ofLactic Acid Bacteria. Blackie Academic &
Professional, Glasgow.
Gourama, H., and L.B. Bullerman. 1995.
Antimycotic and antiaflatoxigenic effect of
lactic acid bacteria : A review. J. Food Prot.58 : 1275-1280.
Karunaratne, A., E. Wezenberg and L.B.
Bullerman. 1990. Inhibition of mold growth
and aflatoxin production by Lactobacillus
spp. J. Food Prot. 53 : 230 – 236.
Klaenhammer, T.R. 1988. Bacteriocins of lactic
acid bacteria. Biochimie. 70 : 337 – 349.
Mayr – Harting, A., A.J. Hedges and R.C.W.
Table 5 Growth and aflatoxin production of A. flavus grown in malt extract broth containing inoculum
level of 104 spores / ml and inhibitor (selected LAB supernate) after 14 days of incubation at
25∞C.
Inhibitor Concentration A. flavus
(%) Log CFU/g Aflatoxin (mg/ml)
Control 6.80 ± 0.02a 2.75 ± 0.10a
L1 supernate 1 4.02 ± 0.03 1.84 ± 0.04
(L. plantarum) 5 2.28 ± 0.01 0.08 ± 0.02
10 NGb NDc
L2 supernate 1 5.00 ± 0.03 2.02 ± 0.06
(L. brevis) 5 3.28 ± 0.08 1.25 ± 0.04
10 1.20 ± 0.01 1.08 ± 0.01
a Values are mean ± SD, n = 3b NG, no growthc ND, not detected
Kasetsart J. (Nat. Sci.) 37 (1) 71
Berkeley. 1972. Methods for studying
bacteriocins, pp. 315-422. In J.R. Noris and
D.W. Ribbons (eds.). Methods inMicrobiology, vol. 7 A. Academic Press,
Inc., New York.
Stonsaovapak, S., J. Kaneko, and K. Izaki. 1994.
Characterization of bacteriocin produced by
Pediococcus acidilactici isolated from
fermented pork in Thailand. Kasetsart J.(Nat. Sci.) 28 : 310 – 313.
Vandenbergh, P.A. 1993. Lactic acid bacteria,
their metabolic products and interference with
microbial growth. FEMS Microbiol. Rev.12 : 221 – 237.
Weiss, N. 1992. The Genera Pediococcus and
Aerococcus, pp. 1502-1507. In A. Balows,
H.G. Truper, M. Dworkin, W. Harder and
K.H. Schlesifer (eds.). The Prokaryotes, volII Springer Verlag New York Inc., New York.
Kasetsart J. (Nat. Sci.) 37 : 72 - 83 (2003)
Using of Extrusion Process for Preparation of Instant CerealBeverage Powders based on Corn and Soybean
Chulaluck Charunuch, Pracha Boonyasirikooland Chowladda Tiengpook
ABSTRACT
Preparation of the instant cereal beverage powders based on corn and soybean from extrusion
process has been studied. To examine the effect of particle size of corn grit (13, 23 and 33 mesh) and the
composition between corn grit and isolated soy protein (84:10, 74:20 and 64:30) on the properties of
product and evaluate nutritional value of acceptable product. The results showed that the differences in
particle size of corn grit were not significant effect (p > 0.05) on the chemical composition (moisture and
protein content) and most of the physical properties of product but the differences in the composition
between corn grit and isolated soy protein were significant effect (p £ 0.05) on the protein content and
the physical properties of product (bulk density, reconstitution index, water absorption index, water
solubility index and viscosity). The highest acceptable product consists of particle size of corn grit
equaled to 13 mesh and the composition between corn grit and isolated soy protein equaled to 84:10 which
reconstituted well, good soluble and moderate viscosity had adequate protein content and appropriate
pattern of essential amino acid for good nutritive consuming.
Key words: instant cereal beverage powders,extrusion process,corn,isolated soy protein
Received date : 27/01/03 Accepted date : 27/03/03
Institute of Food Research and Product Development, Kasetsart University, Bangkok 10900, Thailand.
INTRODUCTION
In the present Thai social condition is
competitive, the way of life is urgent and urban
citizens are faced with chronic traffic problems.
Hence their need for food which can be easily
prepared and convenient for consumption is ever
increasing. In the aspect of food industry, more
technologies for food product research and
development are needed satisfy needs of
consumers. Apart from being convenient to prepare
and easy for consumption, these food products
should also have sufficiently high nutrition, to
result in good quality of life for the consumers.
Especially for school age children who are often
faced with traffic problems, causing them not to
have time for breakfast before going to school.
And not having breakfast reduces the sugar level in
the blood, resulting in learning, and working
effiency in working age people are also reduced.
With this reason, instant beverage powders are
another choice for consumers who need
convenience and quickness in food preparation for
family members. They are also health food for
consumers in all gender and age groups.
In the current bad economic condition,
agro - industry promotion is vital for the country’s
economic development. Because the agricultural
sector is the source of principle income for the
country, and be the economic sector creating large
number of employment. Therefore, according to
the 8th National Economic and social Development
Plan (Year 1997-2001), the government policies
stress increased value of agricultural goods
according to market demands, and to promote
agricultural goods processing. Because of this
reason, the research work stresses development of
food products from corn and soybean, which are
important agricultural raw materials in Thailand,
whose prices are low and production quantities are
sufficient for domestic consumption. They are
processed into instant beverage powders which
can be prepared in short length of time by dissolving
in water. The products are suitable for those who
have no time for food preparation. Moreover, they
are also developed into high nutrition protein
drinks for those who are health conscious. In the
aspect of instant food processing from cereals
which can dissolve well in water, the traditional
process is to make the food hot, cooked and dried
by drum drier. Flaked product is obtained, and the
product is then grounded and sifted through a
mesh with required size. After extrusion, cooking
technology was introduced in the food industry,
diverse production processes and various instant
food products from cereals were developed (Hauck,
1980), including instant beverage powders. This is
because extrusion system (Harper, 1981) has the
ability to make cereals gelatinize and form
expanded products with the property of good water
absorptibility. Moreover, it is also beneficial in the
aspects of its high productivity, energy efficient
and production step reduction.
Concerning foreign research works related
to instant beverage powder production, most of
raw materials used are in the form of liquid or high
viscosity liquid. Therefore they tend to be made
hot and dried by using spray drier (Holsinger et al.,
1974; Guy and Vetterl 1975; King, 1985). But if
the main raw materials used were cereals and in
characteristics of powders, the process used tend
to be one of the two systems (Anderson et al.,
1971) which one is the drum drying system, making
them hot and then dry by using roller machine, and
the another is extrusion cooking system, making
them hot and reduce moisture within the extruder,
such as in the research work “Instant Beverage
Mixes” (Bookwalter et al., 1971) which used cereals
as raw materials, and they are made hot and
cooked by using single screw extruder. The product
obtained is then grounded and flavored and
improved nutritive value by mixing with other
food materials such as milk powder. This product
can be dissolved in hot water and ready for
consumed. The research works in Thailand are
rather few and often use drum drying system in
production, such as the research work “
Development of instant high fiber processed food”
(Tangkanakul et al., 2000) which boiled and
steamed agricultural raw materials mix, after which
water was added and grounded until fine. The food
was then dried by using double drum drier, and
made into powder which was also consumed as
instant beverage powder. And from the result of
survey on instant cereal beverage powders available
in Thailand, it was found that most of the products
use drum drier production system. Imported
products such as the brand names “GOLD
ROAST”, “SUPER” and “VITAMAX” are
imported from Singapore, while other products
manufactured locally are “NESVITA”, “INNA”,
“MONIEGOLD” and “GOOD TIME”. With
“NESVITA”, which is a rather popular brand
manufactured by Nestle Foods (Thailand) Co.,
Ltd., being produced by using cereal mix and
made hot, cooked and dried by using double drum
drier. After which it is grounded to the required
size, obtaining the instant cereal powders (Cereal
Base Type 02) which can be flavored with other
ingredients and be consumed as instant beverage
powders. Moreover, the Cereal Base Type 02 is
also sold to other manufacturers for flavored and
sold as instant cereal beverage powders with brand
names “MONIEGOLD” and “GOOD TIME”.
For this reason the research work used
extrusion technology to produce instant cereal
Kasetsart J. (Nat. Sci.) 37 (1) 73
74 Kasetsart J. (Nat. Sci.) 37 (1)
beverage powders, in order to develop domestic
production and make them more diverse. This can
also help to reduce import quantity of this type of
products and is also greatly beneficial for solving
the country’s economic problems.
MATERIALS AND METHODS
Preparation of raw materialsCorn grit (13 and 33 mesh) were supplied
by Thai Maize Products Ltd. Corn grit (23 mesh),
getting from corn grit (13 mesh) which was
grounded and sieved for screening the required
size. Isolated soy protein (Profam 974), full fat soy
flour and flavorings were supplied by Heinz Win
Chance Ltd., the Royal Project and Givaudan
Roure Ltd. respectively. After preparation, raw
materials were examined by proximate analysis
(A.O.A.C., 1990) and particle size distribution.
Experimental designTo study the production of instant cereal
beverage powders from extrusion process, the 3¥3 factorial in randomized complete block design
was employed with two independent variables at
three levels of variation. The independent variables
were size of corn grit (13, 23 and 33 mesh) and the
composition between corn grit and isolated soy
protein (84 : 10, 74 : 20 and 64 : 30). Dependent
variables were moisture and protein content, bulk
density, reconstitution index, water absorption
index, water solubility index and viscosity.
Experimental data were analyzed by using the
Statistical Analysis System (SAS) and a second
order polynomial equation was fitted to each
response variable.
Extrusion processFor each test run of experimental design (9
experimental units/1 replicate; 3 replicates), the
weighed raw materials (the composition between
corn grit and isolated soy protein equaled to 84 :
10, 74 : 20 or 64 : 30, full fat soy flour 4%,
vegetable oil 1% and mixture of vitamins and
minerals 1%) at each size of corn grit were
thoroughly mixed by a mixer before fed into a
laboratory co – rotating twin – screw extruder
(Hermann Berstorff Laboratory Co-rotating Twin
Screw Extruder ZE25¥33D). This extruder
comprises of 7 parts of barrel ended with a 24.5
mm thick die plate with one circular die hole
(diameter 3.0 mm). The barrel length – to – diameter
ratio (L/D) of the extruder was 870 : 25. The
mixture of raw materials were fed into the extruder
with a volumetric twin screw feeder (K- Tron
soder AG5702, type 20, Switzerland) and water
was pumped to the ingredients to achieve required
moisture content. Temperature of barrel 1-7 and 9
was 30, 35, 65, 135, 155, 175, 130 and 125∞Crespectively. The other operating condition were
adjusted at screw speed 350 rpm, feed rate 319-
375 g/min, water rate 19-26 g/min, feed moisture
15-17% and melting temperature 152-155∞C. After
extrusion, the extruded samples were dried in the
electric oven at 80∞C for 10 min and grounded by
Fitz Mill (mesh size 0.6 mm) to obtain instant
cereal powders. Finally, the instant cereal powders
(50%) was mixed with sugar (25%), skim milk
powder (10%), creamer (14.4%), malt flavor
(0.2%) and milk cream flavor (0.4%) to produce
the instant cereal beverage powders.
Chemical and physical properties examinationThe final products, instant cereal beverage
powders were examined chemical and physical
properties as below.
Moisture and protein content (A.O.A.C.
1990).
Bulk density (Akpapunum and Markakis,
1981). The loose bulk density of product was
determined by transferring 50 g product into a 250
ml graduated glass cylinder and measuring the
volume of the products off the scale. The packed
bulk density was determined in a similar way, but
the volume was measured after tapping the cylinder
until the products settled (about 2 min). Both of the
Kasetsart J. (Nat. Sci.) 37 (1) 75
loose and packed bulk density were calculated as:
Bulk density (g/ml) = mass of sample
Volume occupied by sample
Reconstitution index (Ihekoronye and
Oladunjoye, 1988). The reconstitution index was
determined by mixing 7.5 g of products with 50
ml. of warm water (50∞C) for 90 sec and measuring
the sediment formed in a graduated cylinder, 10
min after the mixing.
Water absorption index and Watersolubility index (Anderson et al., 1969 and
Damardjati and Luh, 1987). A 2.5 g of the ground
sample was suspended in 30 ml of water in a 50 ml
tared centrifuge tube. The sample was stirred
intermittenly over a 30 min period and centrifuged
at 3000¥g for 10 min. The supernatant was poured
carefully into a tared evaporating dish. The
remaining gel was weighed and the WAI was
calculated as follows:
Water absorption index (WAI) =
Weight of gel - Weight of ground dry sample
Weight of ground dry sample
The supernatant liquid from the WAI study
was vacuum dried at 70∞C until constant weight
was reached. The amount of dried solid (%)
recovered from evaporating the supernatant was
expressed as water solubility index.
Viscosity. The viscosity of dispersions
containing 7.5 g of product in 50 ml of water was
measured by Brookfield Digital Viscometer, model
RVDV-III (Operating conditions:- U-L Adaptor,
ULA Spindle, 16 ml sample, 25∞C and 10 rpm).
Sensory evaluationThe final products, instant cereal beverage
powders at each size of corn grit and each
composition between corn grit and isolated soy
protein were conducted with trained panels (18) in
balanced incomplete block experimental design
(t=9, k=4, r=8, b=18, l=3) who have experienced
with food product development by using 9-point
hedonic scale (1-extremely dislike to 9-extremely
like) to determine the preference in color, odor,
flavor, texture and overall acceptant of products.
Nutrition labeling and protein qualityThe nutritive value of the most appropriate
instant cereal beverage powder was evaluated in
the forms of nutrition labeling and pattern of
essential amino acids. The nutrition labeling based
on the Announcement of the Public Health Ministry
No.182, 1998. Additionally, the protein quality
was assessed by comparing essential amino acids
of this product with standard pattern of essential
amino acids set by joint FAO/WHO committee.
RESULTS AND DISCUSSION
Chemical composition and particle size of rawmaterials using for instant cereal powders fromextrusion process
The principal raw materials using for
production of instant cereal powders from extrusion
process in this research work was corn grit. This is
because apart from being an important agricultural
raw material in Thailand with cheap price and
sufficient production quantity for domestic
consumption, corn also has properties suitable for
extrusion process. Because it can expand well and
gives good corn flavor retained after extrusion
(Moore, 1993). The raw material used together
with corn was soybean which improve extruded
product for higher nutritive value in case of protein
content and pattern of essential amino acids than
product made from only one type of cereal.
Moreover, the heat from extrusion process also
reduced trypsin inhibitor which is a toxic substance
in soybean not required by the body (Konstance et
al., 1998). Types of soybean using in this research
were in the form of isolated soy protein and full fat
soy flour. Usage of isolated soy protein gave
benefits in the aspects of increasing protein quantity
(Table 1), without the disadvantage of bean smell
in the product. While apart from being raw material
with high nutritional value concerning protein and
76 Kasetsart J. (Nat. Sci.) 37 (1)
Table 1 Chemical composition and particle size of raw materials.
Chemical composition (%) Average
Raw materials Moisture Fat Protein Ash Dietary 1/ particle size
fiber (mesh)
Corn grit (Large) 11.95 1.43 6.26 0.40 3.89 13
Corn grit (Medium) 11.67 1.30 6.46 0.45 2.42 23
Corn grit (Small) 11.80 1.64 6.36 0.54 2.88 33
Isolated soy protein 3.46 3.02 86.75 4.94 4.60 > 100 2/
Full fat soy flour 2.65 22.10 40.14 5.06 17.20 > 100 3/
Source : 1/ Food and Nutrition Technical Services, Institute of Nutrition, Mahidol University.
2/ Protein Specialties Division, Archer Daniels Midland Company, USA.
3/ Sahaviriya Pure Science Co., Ltd.
fat, full fat soy flour is also source of dietary fiber
(Table 1). Furthermore, usage of oil from full fat
soy flour together with vegetable oil which added
to the raw materials about 1-2 percent, was also
beneficial in the aspect of food material lubrication,
helping the food product to expand well and
consistently, and have good texture
(Boonyasirikool and Charunuch, 1999)
The effect of particle size of corn grit and thecomposition between corn grit and isolated soyprotein on the product qualities
Due to the interactions between particle
size of corn grit (13, 23 and 33 mesh) and the
composition between corn grit and isolated soy
protein (84:10, 74:20 and 64:30) did not have
significant effect (P>0.05) on the moisture content
and the physical properties of product (bulk density,
reconstitution index, water absorption index, water
solubility index and viscosity) but only had
significant effect (P£0.05) on the protein content
as shown in Table 2, so it should be considered
additionally on the effect of main factors (particle
size of com grit or the composition between corn
grit and isolated soy protein) as shown in Table 3
and 4. It was found that particle size of com grit did
not have significant effect (P>0.05) on the chemical
composition (moisture and protein content) and
most of the physical properties of product, but the
differences in the composition between corn grit
and isolated soy protein had significant effect
(P£0.05) on the protein content and the physical
properties of product , except the moisture content.
Isolated soy protein has increased protein content
which caused the product less soluble and
reconstitute not well, reduced viscosity also.
Because of this, raw material which consists of
starch molecules such as corn can expand and
absorb water well, while raw material which consist
of protein molecules such as isolated soy protein
has less expand after extrusion and the property of
dissolving into homogeneous solution with
difficulty (Moore, 1993). Thus, the composition
between corn grit and isolated soy protein was an
important factor for producing high quality of
instant cereal beverage powders.
Because the studied factors (particle size of
corn grit and the composition between corn grit
and isolated soy protein) were quantitative factors,
hence response surface could be studied to show
trends of response when levels of studied
quantitative factors changed as shown in Table 5.
Moreover, the effect of particle size of corn
grit and the composition between corn grit and
isolated soy protein caused the product difference
significantly (P£0.05) on sensory evaluations as
Kasetsart J. (Nat. Sci.) 37 (1) 77
Tab
le 2
Eff
ect o
f int
erac
tions
bet
wee
n pa
rtic
le s
ize
of c
orn
grit
and
the
com
posi
tion
betw
een
corn
gri
t and
isol
ated
soy
pro
tein
on
som
e ch
emic
al a
nd
phys
ical
pro
pert
ies
of in
stan
t cer
eal b
ever
age
pow
ders
.
Tre
atm
ent
Bul
k de
nsity
(g/
ml)
Rec
onst
itutio
n in
dex
(ml)
Wat
erW
ater
Size
of
corn
Cor
n gr
it :
Moi
stur
ePr
otei
nL
oose
bul
kPa
cked
Sedi
men
tC
lear
abso
rptio
nso
lubi
lity
Vis
cosi
ty
grit
(mes
h)Is
olat
ed s
oy(%
)(%
db)
dens
itybu
lk d
ensi
tyin
dex
inde
x(C
ps)
prot
ein
(%)
1384
:10
3.33±0
.39A
12:9
8±0.
30D
0.44±0
.01A
0.52±0
.04A
53.0
0±0.
.25A
1.00±0
.25A
1.95±0
.05A
55.9
7±2.
78A
168.
33±9
.95A
1374
:20
3.15±0
.42A
17.6
1±0.
32C
0.40±0
.06A
0.47±0
.08A
52.0
8±0.
14A
1.92±0
.14A
1.40±0
.18A
56.7
9±2.
20A
94.9
7±9.
12A
1364
:30
3.27±0
.24A
20.4
5±0.
77B
0.42±0
.03A
0.49±0
.06A
49.5
8±1.
59A
4.42±1
.59A
1.54±0
.26A
53.7
9±2.
65A
48.4
3±8.
73A
2384
:10
3.19±0
.37A
12.6
5±0.
31D
0.43±0
.03A
0.52±0
.06A
52.9
2±0.
14A
1.08±0
.14A
2.00±0
.02A
56.1
3±2.
67A
175.
13±1
9.92
A
2374
:20
3.11±0
.49A
17.2
6±0.
69C
0.40±0
.04A
0.48±0
.06A
51.7
5±0.
25A
2.25±0
.25A
1.39±0
.12A
56.4
0±1.
03A
88.0
7±20
.90A
2364
:30
3.34±0
.14A
21.4
5±0.
27A
0.40±0
.04A
0.48±0
.06A
48.1
7±2.
36A
5.83±2
.36A
1.68
v0.1
2A52
.59±
0.37
A30
.97±
6.85
A
3384
:10
3.17±0
.22A
12.6
0±0.
26D
0.44±0
.02A
0.54±0
.05A
52.5
8±0.
29A
1.42±0
.29A
1.86±0
.04A
57.7
5±0.
81A
140.
57±1
5.40
A
3374
:20
3.14±0
.02A
17.2
3±0.
20C
0.42±0
.05A
0.52±0
.08A
50.8
3±0.
76A
3.17±0
.76A
1.39±0
.18A
56.1
4±0.
91A
87.0
7±28
.53A
3364
:30
2.82
±0.2
4A21
.45±
0.48
A0.
41±0
.05A
0.50
±0.0
9A48
.08±
2.27
A5.
92±2
.27A
1.66
± 0.2
8A53
.98±
1.69
A28
.60±
5.47
A
In a
col
umn,
mea
ns w
ith th
e sa
me
lette
r ar
e no
t sig
nifi
cant
ly d
iffe
rent
at 0
.05
sign
ific
ance
leve
l.
78 Kasetsart J. (Nat. Sci.) 37 (1)T
able
3E
ffec
t of
mai
n fa
ctor
(si
ze o
f co
rn g
rit)
on
som
e ch
emic
al a
nd p
hysi
cal p
rope
rtie
s of
inst
ant c
erea
l bev
erag
e po
wde
rs.
Size
of
Bul
k de
nsity
(g/
ml)
Rec
onst
itutio
n in
dex
(ml)
Wat
erW
ater
corn
gri
tM
oist
ure
Prot
ein
Loo
se b
ulk
Pack
edSe
dim
ent
Cle
arab
sorp
tion
solu
bilit
yV
isco
sity
(mes
h)(%
)(%
db)
dens
itybu
lk d
ensi
tyin
dex
inde
x(C
ps)
(%)
133.
25±0
.32A
17.0
1±3.
29A
0.42
±0.0
4A0.
49±0
.06B
51.5
6±1.
73A
2.44
±1.7
3A1.
63±0
.03A
55.5
1±2.
59A
103.
91±5
2.96
A
233.
21±0
.33A
17.1
2±3.
84A
0.41
±0.0
3A0.
49±0
.05B
50.9
4±2.
45A
3.05
±2.4
5A1.
69±0
.28A
55.0
4±2.
34A
98.0
6±64
.60A
B
333.
04±0
.24A
17.0
9±3.
85A
0.42
±0.0
4A0.
52±0
.07A
50.5
0±2.
30A
3.50
±2.3
0A1.
64±0
.26A
55.9
6±1.
94A
85.4
1±51
.21B
In a
col
umn,
mea
ns w
ith th
e sa
me
lette
r ar
e no
t sig
nifi
cant
ly d
iffe
rent
at 0
.05
sign
ific
ance
leve
l.
Tab
le 4
Eff
ect
of m
ain
fact
or (
com
posi
tion
betw
een
corn
gri
t an
d is
olat
ed s
oy p
rote
in)
on s
ome
chem
ical
and
phy
sica
l pr
oper
ties
of i
nsta
nt c
erea
l
beve
rage
pow
ders
.
Cor
n gr
it :
Bul
k de
nsity
(g/
ml)
Rec
onst
itutio
n in
dex
(ml)
Wat
erW
ater
Isol
ated
soy
Moi
stur
ePr
otei
nL
oose
bul
kPa
cked
Sedi
men
tC
lear
abso
rptio
nso
lubi
lity
Vis
cosi
ty
prot
ein
(%)
(% d
b)de
nsity
bulk
den
sity
inde
xin
dex
(Cps
)
(%)
84:1
03.
23±0
.30A
12.7
4±0.
31C
0.44±0
.02A
0.52±0
.04A
52.8
3±0.
28A
1.17
±0.2
8C1.
94±0
.07A
56.6
2±2.
15A
161.
34±2
0.85
A
74:2
03.
13±0
.32A
17.3
6±0.
43B
0.41
±0.0
4B0.
49±0
.07B
51.5
6±0.
69B
2.44
±0.6
9B1.
39±0
.14C
56.4
4±1.
33A
90.0
3±18
.64B
64:3
03.
14±0
.31A
21.1
2±0.
69A
0.41
±0.0
3B0.
49±0
.06B
48.6
1±1.
96C
5.39±1
.96A
1.63±0
.21B
53.4
5±1.
71B
36.0
0±11
.24C
In a
col
umn,
mea
ns w
ith th
e sa
me
lette
r ar
e no
t sig
nifi
cant
ly d
iffe
rent
at 0
.05
sign
ific
ance
leve
l.
Kasetsart J. (Nat. Sci.) 37 (1) 79
shown in Table 6. That is difference in products,
when the composition between corn grit and
isolated soy protein changed, could be seen more
clearly when compared to changing of the particle
size of corn grit. Product with the composition
between corn grit : isolated soy protein equaled to
84:10 had more trend of higher liking scores of
product concerning color, odor, flavor, texture and
overall acceptance, when compared to product
with the composition between corn grit : isolated
soy protein equaled to 74:20 and 64:30, for all
values of particle size of corn grit (13, 23 and 33
mesh). Because of increasing protein quantity
such as the result in Table 4, it caused the product
to have the property of dissolving into
homogeneous solution with difficulty or poor
reconstitution which brought the organoleptic
properties of product get worse.
Nutritive value of instant cereal beveragepowders in the forms of nutrition labeling andpattern of essential amino acids
Choose the representative product of instant
cereal beverage powders from extrusion process
for nutritional evaluation by using size of corn grit
equaled to 13 mesh and composition between corn
grit and isolated soy protein equaled to 84:10 due
to the results of the effect of main factors on Table
4 which stated that the product using composition
between corn grit and isolated soy protein equaled
to 84:10 had more trend for good reconstitution
with less separation and sensory evaluation on
Table 6 which showed that the product using size
of corn grit equaled to 13 mesh and composition
between corn grit and isolated soy protein equaled
to 84:10 had higher score of preference in color,
odor, flavor, texture and overall acceptance. From
nutritional evaluation of this products in the forms
of nutrition labeling (Announcement of the Pulbic
Health Ministry, No.182, 1998), it was found that
this product has good nutrition condition for health
(The Committee, 1989) because it consists of
higher protein quantity (4g per one serving) when
compared to other available products. And the
quantity of protein is equaled to 8 percent of Thai
RDI which is nearly to protein quantity in food
Table 5 Response surface function of some chemical composition and physical properties of products
when particle size of corn grit and the amount of isolated soy protein changed.
Chemical composition and Response surface function
physical properties
Moisture Y = 3.0213+0.0352A-0.0086B-0.0007A2-0.0007AB+0.0005B2
Protein Y = 8.4514-0.0348A+0.5124B-0.0007A2+0.0035AB-0.0043B2
Bulk density
- Loose bulk density Y = 0.5225-0.0041A-0.0065B+0.0001A2-0.00004AB+0.0002B2
- Packed bulk density Y = 0.6076-0.0037A-0.0085B+0.0001A2-0.00005AB+0.0002B2
Reconstitution index
- Sediment Y = 52.7978-0.0369A+0.1845B+0.0008A2-0.0027AB-0.0083B2
- Clear Y = 1.2022+0.0369A-0.1845B-0.0008A2+0.0027AB+0.0083B2
Water absorption index Y = 3.2531+0.0147A-0.1842B-0.0006A2+0.0006AB+0.0039B2
Water solubility index Y = 54.8528-0.2184A+0.4963B+0.0070A2-0.0040AB-0.0141B2
Viscosity Y = 264.6380+0.2398A-10.1789B-0.0339A2+0.0198AB+0.0864B2
When A = particle size of corn grit
B = amount of isolated soy protein
80 Kasetsart J. (Nat. Sci.) 37 (1)
claimed as source of protein (according to Nutrition
claim, appendix to announcement of the Public
Health Ministry No.182, 1998, which stated that
food claimed as source of protein must consist of
10-19 percent of protein quantity required for Thai
RDI). Furthermore, the product was considered to
have suitable protein quantity, because nutritional
regulation stated that approximately 12 percent of
total energy should be received from protein
(Whitney and Hamilton, 1981). In the aspects of
quantities of fat, saturated fat, and sodium, they
are in “low” of nutrition claim standard, and there
was no cholesterol. This product also had Vitamin
A, B1, B2, Ca and Fe in the quantities of 20, 4, 8,
8 and 4 percent of Thai Recommended Daily
Intakes respectively. Concerning with dietary fiber,
it was found that there was rather little (0.4 g per
100 g of product) which is stated to zero value in
the form of nutrition labeling. Hence for further
product development, more dietary fiber
reinforcement raw materials should be added.
Moreover, the protein quality was assessed
by comparing essential amino acids of this product
with standard pattern of essential amino acids set
by joint FAO / WHO committee, as shown in
Table 8. It was found that this product has good
quality of protein because of nearly every type of
essential amino acids be according to the standard
set by FAO/WHO, except threonine, which is
deficient in small amount and showed the chemical
score equaled to 97.5 percent.
CONCLUSION
Production of instant cereal beverage
powders based on corn and soybean by using
extrusion process showed that the differences in
particle size of corn grit (13, 23 and 33 mesh) did
not have significant effect (P>0.05) on the chemical
composition (moisture and protein content) and
most of the physical properties of products but the
differences in the composition between corn grit
and isolated soy protein have significant effect
(P£0.05) on the protein content and the physical
properties of product (bulk density, reconstitution
index, water absorption index, water solubility
index and viscosity). The suitable product should
have the composition between corn grit and isolated
soy protein equaled to 84:10 because it can
reconstitute well, good soluble and moderate
Table 6 Sensory evaluation of instant beverage powders based on corn and soybean from extrusion
process.
Treatment Organoleptic properties
Size of Corn grit : Overall
corn grit Isolated soy Color Odor Flavor Texture acceptance
protein
13 84:10 7.42±0.49A 7.14±0.63A 7.19±0.78A 7.26±0.39A 7.39±0.43A
13 74:20 7.32±0.34AB 6.76±1.06AB 6.67±0.80B 6.42±0.88B 6.64±0.79B
13 64:30 7.12±0.21AC 6.67±0.55AC 6.47±0.44BC 6.59±0.68BC 6.50±0.35B
23 84:10 7.40±0.35A 7.11±0.64A 7.12±0.65AD 6.90±0.46ACD 7.02±0.51AB
23 74:20 7.19±0.53AD 6.96±0.68A 6.72±0.94BD 6.76±0.52BDE 6.74±0.84BC
23 64:30 6.69±0.49E 6.20±0.58C 6.04±0.53CE 6.07±0.84B 6.01±0.59D
33 84:10 7.34±0.54AF 6.92±0.59A 6.80±0.57AB 7.01±0.53ACE 6.91±0.40B
33 74:20 6.92±0.59BCDEF 6.78±0.44AD 6.62±0.46B 7.06±0.30AE 6.80±0.39B
33 64:30 6.89±0.54CDE 6.31±0.58BCD 6.40±0.50BE 6.11±0.48B 5.90±0.40CD
In a column, means with the same letter are not significantly different at 0.05 significance level.
Kasetsart J. (Nat. Sci.) 37 (1) 81
Tab
le 7
Nut
ritio
n la
belin
g of
inst
ant b
ever
age
pow
ders
bas
ed o
n co
rn a
nd s
oybe
an f
rom
ext
rusi
on p
roce
ss c
ompa
red
with
mar
keta
ble
prod
ucts
.
Nut
riti
on f
acts
A1B
11/M
arke
tabl
e Pr
oduc
ts
NE
SVIT
AG
OO
D T
IME
P.P.
CO
RN
MIL
K
Serv
ing
size
: 1
pack
age
(30
g)Se
rvin
g si
ze :
1 pa
ckag
e (3
0 g)
Serv
ing
size
: 1
pack
age
(30
g)Se
rvin
g si
ze :
1 pa
ckag
e (3
0 g)
Serv
ing
per
pack
age
: 1Se
rvin
g pe
r pa
ckag
e : 1
Serv
ing
per
pack
age
: 1Se
rvin
g pe
r pa
ckag
e : 1
Am
ount
per
ser
ving
Am
ount
per
ser
ving
Am
ount
per
ser
ving
Am
ount
per
ser
ving
Cal
orie
s 12
0 C
alor
ies
from
Fat
20
Cal
orie
s 12
0 C
alor
ies
from
Fat
20
Cal
orie
s 13
0 C
alor
ies
from
Fat
16
Cal
orie
s 14
0 C
alor
ies
from
Fat
40
% D
aily
Val
ue*
% D
aily
Val
ue*
% D
aily
Val
ue*
% D
aily
Val
ue*
Tot
al F
at 2
g3
%T
otal
Fat
2 g
3 %
Tot
al F
at 2
g3
%T
otal
Fat
4.5
g7
%Sa
tura
ted
Fat 0
.5 g
3 %
Satu
rate
d Fa
t 1.5
g7
%Sa
tura
ted
Fat 0
g0
%Sa
tura
ted
Fat 4
g20
%C
hole
ster
ol 0
mg
0 %
Cho
lest
erol
0 m
g0
%C
hole
ster
ol 0
mg
0 %
Cho
lest
erol
Les
s th
an 5
mg
1 %
Prot
ein
4 g
Prot
ein
2 g
Prot
ein
3 g
Prot
ein
2 g
Tot
al C
arbo
hydr
ate
23 g
8 %
Tot
al C
arbo
hydr
ate
23 g
8 %
Tot
al C
arbo
hydr
ate
20 g
7 %
Tot
al C
arbo
hydr
ate
22 g
7 %
Die
tary
Fib
er 0
g0
%D
ieta
ry F
iber
Les
s th
an 1
g4
%D
ieta
ry F
iber
3 g
12 %
Die
tary
Fib
er 1
g4
%Su
gar
11 g
Suga
r 13
gSu
gar
5 g
Suga
r 9
gSo
dium
60
mg
3 %
Sodi
um 1
50 m
g6
%So
dium
120
mg
3 %
Sodi
um 1
30 m
g5
%%
Dai
ly V
alue
*%
Dai
ly V
alue
*%
Dai
ly V
alue
*%
Dai
ly V
alue
*V
itam
in A
20 %
• V
itam
in B
14
%V
itam
in A
0 %
• V
itam
in B
12
%V
itam
in A
0 %
• V
itam
in B
112
%V
itam
in A
Les
s th
an 2
% •
Vita
min
B1 4
%V
itam
in B
28
%•
Cal
cium
8 %
Vita
min
B2
4 %
• C
alci
um20
%V
itam
in B
212
%•
Vita
min
C0
%V
itam
in B
2 4
% •
Cal
cium
Les
s tha
n 4
%Ir
on4
%Ir
on 2
0 %
• Fo
lic A
cid
20 %
Cal
cium
20 %
• Ir
on4
%Ir
on L
ess
than
2 %
*Per
cent
Dai
ly V
alue
s ar
e ba
sed
on a
200
0 ca
lori
e di
et.
You
r da
ily v
alue
s m
ay b
e hi
gher
or
low
er d
epen
ding
on
your
cal
orie
nee
ds.
Tot
al F
atL
ess
than
65g
Satu
rate
d Fa
tL
ess
than
20g
Cho
lest
erol
Les
s th
an30
0m
gT
otal
Car
bohy
drat
e30
0g
Die
tary
Fib
er25
gSo
dium
Les
s th
an2,
400
mg
Cal
orie
s pe
r gr
am:
Fat
= 9
;C
arbo
hydr
ate
= 4
;Pr
otei
n =
4
1/In
stan
t bev
erag
e po
wde
rs o
pera
te a
t par
ticle
siz
e of
cor
n gr
it eq
uale
d to
13
mes
h an
d th
e co
mpo
sitio
n be
twee
n co
rn g
rit a
nd is
olat
ed s
oy p
rote
in e
qual
ed to
84:
10
82 Kasetsart J. (Nat. Sci.) 37 (1)
viscosity. Moreover, the acceptable score is the
highest also. Even though the protein content is
less than other products but it is still more than
marketable products, and it has adequate protein
content and appropriate pattern of essential amino
acids for good nutritive consuming, Therefore,
this research work is beneficial in the aspects of
application of extrusion process for diversity of
products in food industry and promote Thai
agricultural raw materials by giving them value
added.
ACKNOWLEDGEMENTS
The authors gratefully acknowledge the
financial support of the Kasetsart University
Research and Development Institute (KURDI).
LITERATURE CITED
Akpapunum, M.A. and P.Markakis. 1981.
Physicochemical and nutritional aspects of
cowpea flour. J. Food. Sci. 46 : 972-973.
A.O.A.C. 1990. Official Methods of Analysis.
Vol. II, 15th ed., Association of Official
Analytical Chemists, Inc., Arlington, Virginia.
1298 P.
Anderson, R.A., H.F. Conway, V.F. Pfeifer and
E.L. Griffin. 1969. Gelatinization of corn
grits by roll-and extrusion-cooking. CerealScience Today 14 : 4-12.
Anderson, R.A., V.F. Pfeifer, G.N. Bookwalter,
and E.L. Griffin. 1971. Instant CSM food
blends for world-wide feeding. Cereal ScienceToday 16 : 5 – 11.
Bookwalter, G.N., H.F. Conway, and E.L. Griffin.
1971. Instant beverage mixes, United States
Patent.
Boonyasirikool, P. and C. Charunuch. 1999.
Development of broken rice-based ready-to-
eat breakfast cereal by extrusion process.
Kasetsart J. (Nat. Sci.) 33 : 415-429.
Damardjati, D.S. and B.S. Luh. 1987.
Physicochemical properties of extrusion-
cooked rice breakfast cereals, pp. 251-263. In
Trends in Food Processing I : MembraneFiltration Technology and ThermalProcessing and Quality of Foods.
Table 8 Comparison of essential amino acid contents between instant beverage powders (A1B1) and
FAO/WHO standard (1972) in milligrams per gram of protein.
Essential amino acids A1B11/ FAO/WHO2/
Isoleucine 43 40
Leucine 104 70
Lysine 57 55
Methionine + Cystine 55 35
Phenylalanine + Tyrosine 78 60
Threonine 39 (97.5)3/ 40
Tryptophane 15 10
Valine 50 50
Source : 1/ Division of Nutrition, Department of Health, Ministry of Public Health,2/ Food Composition Table for use in East Asia (FAO, 1972)3/ Limiting amino acid with chemical score in parenthesis
amino acid content in foodChemical score = ¥ 100
amino acid content in FAO/WHO standard
Kasetsart J. (Nat. Sci.) 37 (1) 83
Proceedings of the 7th World Congress of
Food Science and Technology. October 1987.
Singapore.
Guy, E.J. and H.E. Vetterl. 1975. A high quality
protein, vitamin, and mineral fortified
chocolate flavored powder for beverage use.
J. Dairy Sci. 58 : 432-435.
Harper, J.M. 1981. Extrusion of Foods. Vol. I,
CRC Press Inc., Boca Raton, Florida. 212 p.
Hauck, B.W. 1980. Marketing opportunities for
extrusion cooked products. Cereal FoodsWorld 25 : 594-595.
Holsinger, V.H., C.S. Sutton, L.F. Edmondson,
P.R. Crowley, B.L. Berntson, and M.J.
Pallansch. 1974. Production and properties of
a nutritious beverage base from soy products
and cheese whey, pp. 16-17. In Proceedingsof International Congress of Food Scienceand Technology. Philadelphia, Pennsylvania,
USA.
Ihekoronye, A.I. and M.G. Oladunjoye. 1988.
Formulation and Physicochemical properties
of high-protein food beverage powders based
on protein concentrate from the Nigerian “red
skin” groundnut. Trop. Sci. 28 : 219-237.
King, V. 1985. Studies on the production of banana
juice powder using spray drying. J. ChineseAgr. Chem. Soc. 23:62-72.
Konstance, R.P., C.I. Onwulata, P.W. Smith, D.
Lu, M.H. Tunick, E.D. Strange, and V.H.
Holsinger. 1998. Nutrient-based corn and soy
producls by twin-screw extrusion. J. FoodSci. 63 : 864-868.
Moore, G. 1993. Raw materials and in extrusion.
Ingredients Extra 2 : 2-5.
Tangkanakul, P., N. Vatanasuchart, M.
Pongpipatpong, and P. Tangtrakool. 2000.
Development of Instant high fiber processed
food. Kasetsart J. (Nat. Sci.) 34 : 117-124.
The committee on recommended daily dietary
allowance for Thais. 1989. RecommendedDaily Dietary Allowance for Healthy Thais.Department of Health, Ministry of Public
Health. 161 p.
Whitney, E.N. and E.M.N. Hamilton. 1981.
Understanding Nutrition. 2nd ed., West
Publishing Co., St. Paul, Minnesota. 629 p.
Kasetsart J. (Nat. Sci.) 37 : 84 - 89 (2003)
The Optimum use of Salinity, Nitrate and Pond Depth forbbbbb-Carotene Production of Dunaliella salina
Orapin Bhumibhamon1, Udom Sittiphuprasert2, Naiyana Boontaveeyuwat1
and Jantana Praiboon1
ABSTRACT
Dunaliella salina, halotorelant green algae was collected from the East Coast of Thailand. It has
a massive accumulation of b-carotene when grown under defined growth conditions such as high light
intensity, high salt concentration and nitrate deficiency. The present study investigated the optimization
of salinity, nitrate and pond depth for cell growth and b-carotene production of the alga in question.
Cultivation was done in three stages. These were indoor cell growth cultivation, outdoor cell growth
cultivation and outdoor b-carotene production. The optimum salinity for cell growth of indoor and
outdoor cultivation (5 l) was 9% NaCl, which has specific growth rate (m) of 0.579 (d-1) and 0.981 (d-1).
The optimum salinity for outdoors b-carotene production (5 l) when use 40% inoculum (2.16 ¥ 106 cell
ml-1) was 12% NaCl. This produced b-carotene content of 51.73 mg ml-1. In addition, the concentrations
of medium used were 100%, 75% and 50% to decrease nitrate concentration in the starter ponds for
increasing b-carotene production in the next step. The results showed that 50% medium gave minimum
nitrate concentration of 4.5 mg l-1. For the effect of pond depth, the light expose of the alga were used
9, 11, 13 and 18 cm the ratios of carotenoid to chlorophyll were 7.48, 6.25, 5.54 and 3.35, respectively.
Therefore the suitable pond depth for b-carotene production from D. salina was 9 to 11 cm.
Key words: b-carotene production, Dunaliella salina, pond depth, salinity, nitrate
Received date : 23/04/02 Accepted date : 06/01/03
1 Department of Biotechnology, Faculty of Agro-industry, Kasetsart University, Bangkok 10900, Thailand.2 Sriracha Fishery Research Station, Faculty of Fisheries, Kasetsart University, ChonBuri 20130, Thailand.
INTRODUCTION
Dunaliella is a unicellular green algae
capable of growing in a wide range of salt
concentrations from 0.2% to saturation (around
35%). It produces and accumulates large amounts
of b-carotene when cultivated under high light
intensity, high salt concentration and nitrate
deficiency conditions. More than 10% of the dry
weight of D. salina is b-carotene (Ben-Amotz and
Avron, 1983). b-carotene has important nutritional
characteristics, as it is the most effective precursor
of vitaminA. Moreover, b-carotene is also used as
food and cosmetics coloring agent; as pro-vitaminA
in animal feed; in medical treatment of disease
such as erythropoietic protoporphyria (EPP) (Ben-
Amotz and Avron, 1990); and as a potent
antioxidant which reduced the incidence of cancer
in humans (Ziegler, 1989). The aim of the present
study was to optimized the culture conditions for
D. salina b-carotene production.
MATERIALS AND METHODS
StainD. salina DS1197 was collected from the
Eastcoast of Thailand. It was isolated and cultured
in Borowitzka’s medium (Borowitzka,1988).
Optimum salinity for indoor cell growthThe algae were cultured in 150 ml
transparent plastic cone tubes placed in a water
bath. The inoculum was approximately 0.5 ¥ 106
cell ml-1. Cells were grown in a modified
Borowitzka’s medium having 0.5 g l-1 of KNO3 at
30∞C. Light intensity was supplied to the culture
tube surface at 8 klx on daylight for 16 hrs. A
mixture of CO2 and air (2% CO2) was provided at
12 ml min-1. Salinity of 6%, 9% and 12% NaCl
were used for cell growth.
Optimum salinity for outdoor cell growthThe cells from indoor cell growth
(maximum cell density) were centrifuged at 2,000
rpm for 10 min. The living cell pellets were
transfered to culture medium to make up a starting
cell of about 0.5 ¥ 106 cell ml-1. The cells were
grown in a 5 l plastic tray with controlled shaking
of 12 rpm in the open air outdoor. Pure CO2 was
supplied to the culture at the rate of 72 ml min-1 for
8 hr daylight. As for indoor culture, cells were
grown in a medium of 9% salinity.
Optimum salinity for outdoor bbbbb-caroteneproduction
Cell culture of outdoor cell growth was
used to inoculate 40% of the culture volume (2.16
¥ 106 cell ml-1) for further study of b-carotene
production. The outdoor culture was carried out in
5 l plastic trays at 100% outdoor light exposure.
Pure CO2 was supplied at the rate of 72 ml min-1
for 8 hr daylight. The cultures were cultivated in a
Borowitzka’s medium without KNO3 at different
salinity of 9%, 12%, 15% and 18% NaCl.
Optimum nitrate concentration for outdoorcell growth
The cells from indoor cell growth
cultivation (maximum cell density) were transfered
to culture medium to make up a starting cell of
about 2 ¥ 105 cell ml-1. The cultures were grown
in 300 l of outdoor raceway pond under 100%
outdoors light exposure. Culture agitation was
provided by a paddle wheel. Three different
Borowitzka’s media concentration of 100%, 75%
and 50% were supplied to brine (9% NaCl) to
reduce nitrate concentration in order to increase b-
carotene production in the next step.
Optimum pond depth for outdoor bbbbb-caroteneproduction
The cells from outdoor cell growth
(optimized nitrate concentration) were transferred
to culture medium (without KNO3) to make up
starting cell of about 2 ¥ 105 cell ml-1. The cells
were grown in an outdoor raceway pond under
100% outdoors light exposure. CO2 was bubbled
into the pond to maintain the culture pH of 8.0.
There were 2 separated sets of experiment.
Experiment 1: The pond depths of 9 cm
(250 l working volume) and 18 cm (500 l working
volume).
Experiment 2: The pond depths of 11 cm
(300 l working volume) and 13 cm (350 l working
volume).
Pigment analysisChlorophyll and carotenoid were extracted
from the alga pellet using 90% acetone and assayed
as described by Borowitzka (1991).
bbbbb-carotene analysisThe filtrate of 5-10 ml of culture through
whatman GF/C filter was wrapped in an aluminum
foil and frozen at - 20∞C until analysis. The
extraction was done in the dim light 10-15 ml cold
90% acetone with gentle grinding. The supernatant
was collected by centrifuging at 3,000 rpm for 15
min. b-catrotene in supernatant was detected by
HPLC as described by Borowitzka (1991).
Kasetsart J. (Nat. Sci.) 37 (1) 85
86 Kasetsart J. (Nat. Sci.) 37 (1)
RESULTS AND DISCUSSION
1. Effect of salinity for indoor cell growthThe results showed that higher salinity
medium affected the intracellular mechanism by
inhibit cell division of D. salina more than lower
salinity medium (Figure 1). The specific growth
rates (m) of 6%, 9% and 12% NaCl were 0.463,
0.597 and 0.511 d-1, respectively. Thus, the optimal
salinity for indoor cell growth of D. salina were
9% and 12% NaCl same in the previous report
found by Borowitzka (1988).
2. Effect of salinity on outdoor cell growth (5liter)
The problem of outdoor culture was
protozoan contamination when growth under low
salinity that effected cell growth and yield.
Although the 9% NaCl were optimal for cell
growth of the indoor culture, it also good for
outdoor cell growth. The cultures at 9% and 12%
NaCl were investigated for cell growth and
protozoan contamination. The results were similar
to those of the indoor cultures at the same salinity.
The specific growth rate of culture at 9% NaCl was
higher than that of 12% NaCl. Specific growth
rates of the cultures at 9% and 12% NaCl were 0.98
and 0.51 d-1, respectively (Figure 2). Protozoan
contamination was not found in either culture. The
salinity of 9% NaCl was therefore considered
optimal for outdoor cell growth culture of D.
salina DS1197.
3. Effect of salinity on outdoor b-caroteneproduction (5 liter)
The culture was cultivated by using
inoculum size of 40% of the culture. The inoculum
culture was 2.16 ¥ 106 cell ml-1. The culture was
investigated for b-carotene production at different
salinity of 9%, 12%, 15% and 18% NaCl for 15
days. The highest b-carotene of the culture at 12%
NaCl was 51.73 mg ml-1 (Table 1).
4. Effect of nitrate concentration on outdoorcell growth (300 liter)
The source and concentration of nitrogen
can provoke important change in the growth an
biochemical composition of microalgal.
Manipulation of nitrogen concentration of the
culture medium was found to be a simple technique
to effect significant differences in the protein,
carbohydrate, lipid and pigment content of
Dunaliella (Uriarte et. al., 1993). D. salina can
accumulate highest b-carotene when growth under
nitrate deficiency. Thus, the medium concentration
of 100%, 75% and 50% were used to reduce nitrate
Figure 1 Effect of salinity on cell growth in
indoor cultivation of D. salina.
Figure 2 Effect of salinity on outdoor cell growth
of D. salina.
Cultivation period (day)
0 2 4 6 8 10
Cel
l gro
wth
(Ct/C
0)
0
2
4
6
8
10
12
14
16
9% NaCl12% NaCl
Kasetsart J. (Nat. Sci.) 37 (1) 87
concentration were 36, 12 and 4.5 mg.l-1
respectively (Figure 3) and increase b-carotene
production. There were non-significant differences
in the cell concentration is shown in Figure 4. The
medium concentration selected for further culture
in the present study was 50% of Borowitzka’s
medium due to gave minimum nitrate
concentration.
5. Effect of pond depth on bbbbb-carotene productionPond depth is an one factor for b-carotene
production which there has relationship with light
quality and intensity absorbed by this alga. Thus,
different pond depths were use to search for
optimum b-carotene production. The results were
as follows:
Experiments 1: The cultivation was carried
out during August 1999. Pond depths of 9 and 18
Table 1 b-carotene production of outdoor cultivation in different salinity.
Salinity
9 % NaCl 12 % NaCl 15 % NaCl 18 % NaCl
Cultivation period (d) 15 15 15 15
Initial cell ¥ 106 cell ml-1(C0) 2.16 2.16 2.16 2.16
Final cell ¥ 106 cell ml-1(Ct) 1.79 1.66 1.38 1.12
Initial b-carotene (mg ml-1) 9.48 9.01 7.58 6.32
Final b-carotene (mg ml-1) 48.71 51.73 43.33 38.04
cm were used gave carotenoid to chlorophyll ratios
to be 7.48 and 3.35, respectively (Figure 5).
Experiment 2: The cultures were carried
out during September 1999. Pond depths of 11 and
13 cm were used gave carotenoid to chlorophyll
ratios of 6.25 and 5.54, respectively (Figure 6).
According to the result of these experiments,
the pond depth suitable for further culture of b-
carotene production was 9 to 11 cm due to gave
highest carotenoid to chlorophyll ratios.
Large scale outdoor mass culture where the
system is more complex and other factors interact
to affect growth and carogenesis. These factors
included perdition by protozoa, variable mixing of
the culture and the interactions of these factors
with nutrient supply, salinity, temperature and
light. In addition, cell density and pond depth as an
important factor for b-carotene production due to
Cultivation peroid (day)1 2 3 4 5 6 7 8
Nitr
ate
conc
entr
atio
n (m
g.l-1
)
0
20
40
60
80
100
120
100% of medium75% of medium50% of medium
Cultivation period (day)
1 2 3 4 5 6 7 8
Cel
l con
cent
ratio
n (¥
10-5
cel
l.ml-1
)
0
5
10
15
20
25
30
100% of medium75% of medium50% of medium
Figure 3 Effect of medium concentration on ni-
trate concentration.
Figure 4 Effect of medium concentration on cell
concentration.
88 Kasetsart J. (Nat. Sci.) 37 (1)
relationship with light quality and intensity
absorbed by this alga. The optimum cell density is
not fix, but is influenced by the type of algae
culture, culture depth (pond depth), turbulence
and environmental conditions (temperature a
available irradiant). At cell density below the
optimum, productivity decreases, because the
biomass present cannot absorb all the available
light energy. Above optimum cell density
productivity decrease, because a portion of the
culture is in the dark and biomass is lost due to
respiration (Grobbelaar, 1995). When b-carotene
production in plastic tray (lab scale) and in raceway
pond (pilot scale) were compared. The results
(Table 2) show that b-carotene production of lab
scale was higher than that of pilot scale because of
the difference in cell density and pond depth. The
lab scale had higher cell density and less pond
depth than pilot scale. Thus, light energy absorbed
by this alga would increase to give maximum b-
carotene accumulation and production.
CONCLUSION
The optimal conditions for cell growth and
b-carotene production of D. salina DS1197 as
follows: The optimum salinity of indoor and
outdoor cell growth was 9% NaCl while the
optimum salinity for outdoor b-carotene production
was 12% NaCl. The minimum nitrate concentration
Table 2 Comparison of b-carotene production lab scale (plastic tray, 5 l) and pilot scale (raceway pond,
250-300 l).
Laboratory scale Pilot scale
(5 L) 9 cm (250 l) 11 cm (300 l)
Cultivation period (d) 15 14 15
Initial cell (cell ml-1) 2.16 ¥ 106 2.03 ¥ 105 1.95 ¥ 105
Final cell (cell ml-1) 1.66 ¥ 106 3.70 ¥ 105 5.12 ¥ 105
Initial beta-carotene (mg ml-1) 9.01 1.36 0.95
Final beta-carotene (mg ml-1) 51.73 3.65 3.84
beta-carotene (pg cell-1) 31.10 9.80 7.29
Cultivation peroid (day)
0 2 4 6 8 10 12 14 16
Car
oten
oid
to c
hlor
ophy
ll ra
tio
0
1
2
3
4
5
6
7
8
9 cm18 cm
Cultivation period (day)
0 2 4 6 8 10 12 14 16
Car
oten
oid
to c
hlor
ophy
ll ra
tio
0
1
2
3
4
5
6
7
11 cm13 cm
Figure 5 Effect of pond depth, 9 and 18 cm. on
carotenoid to chlorophyll ratios.
Figure 6 Effect of pond depth, 11 and 13 cm. on
carotenoid to chlorophyll ratios.
Kasetsart J. (Nat. Sci.) 37 (1) 89
was 4.5 mg l-1 when growth under 50%
Borowitzka’s medium and optimum of raceway
pond depth for b-carotene production was 9 to 11
cm.
ACKNOWLEDGEMENTS
The research was supported by KURDI,
Kasetsart University under National Research
Council, Bangkok, Thailand.
LITERATURE CITED
Ben-Amotz,A. and M. Avron. 1983. On the factor
which determine massive b-carotene
Accumulation in the halotolerant alga
Dunaliella bradawil. Plant Physiol. 72 : 593-
597.
Ben-Amotz,A. and M. Avron. 1990. The
biotechnology of cultivation the halotolerant
alga Dunaliella. Trends Biotechnology 8 :
121-126.
Borowitzka,M.A. 1988. Modified Johnson’sMedium for Dunaliella spp., Cited by
S.Powtongsook. Cultivation of MicroalgaeDunaliella salina for Beta-caroteneProduction M.Sc. Thesis, Chulalongkorn
University, Bangkok.
Borowitzka, M.A. 1991. Standard methods for
total carotenoid assay suitable for Dunaliella
salina, pp. 243-248. In A. Vonshak and M.A.
Borowitzka (eds.). Laboratory Manual:Research Seminar and Workshop on MassCulture of Microalgae. Silpakorn University,
Thailand, Nov. 1991.
Grobbelaar, J.U. 1995. Influence of areal density
on b-carotene production by Dunaliella salina.
J.Appl.Phycol. 7 : 69-73.
Uriarte, I., A., Farias, A.J.S. Hawkins and B.L.
Bayne. 1993. Cell characteristics and
biochemical composition of Dunaliella
primolecta Butcher condition at different
concentration of dissolved nitrogen.
J.Appl.Phycol. 5 : 447-453.
Ziegler, R.G. 1989. A review of epidemiological
evidence that carotenoids reduce the risk of
cancer. J.Nutrition 119 : 116-122.
Kasetsart J. (Nat. Sci.) 37 : 90 - 100 (2003)
Quantity and Distribution of Plant Nutrients on Eutrophicationin Bang Pra Reservoir, Chonburi Province
Ratcha Chaichana1, Chumlong Arunlertaree11, Boonsong Srichareondham2
and Narong Veeravaitaya3
ABSTRACT
The main objectives of this study were to study the quantity and variation of plant nutrients in water
bodies supplied to Bang Pra reservoir including the characteristics of distribution and variation of plant
nutrients and phytoplankton in Bang Pra reservoir. This study was conducted during March 2001 –
February 2002.
In the inflowing brooks, the quantity of nitrite and total ammonia were significantly different
(p<0.01) both in each brook and in each month. It was demonstrated that the quantity of nitrate and
orthophosphate were significantly different (p<0.01) in each month but not different in each brook
(p>0.05).
In Bang Pra reservoir, the quantity of nitrite in each water sample was different (p<0.05) and the
quantity of total ammonia was significantly different (p<0.01). When considering both quantity of nitrite
and total ammonia in each month, it was shown that they were significantly different (p<0.01). Statistical
analysis indicated the significant difference of othophosphate quantity (p<0.01) in each month but not in
each water sample station (p>0.05). Given these conditions, Bang Pra reservoir can be classified as a
eutrophic lake.
High quantity of plant nutrients in Bang Pra reservoir was mainly found at water sample stations
of water receiving areas located at the mouth of brooks.
The biological analysis revealed that phytoplankton, which was mostly found in Bang Pra
reservoir was Aulacoseira, in Division Chromophyta. Moreover, in June, November 2001, and January
2002, Aulacoseira was found in such large quantity compared to other months that these periods could
be regarded as periods of phytoplankton bloom.
Key words: eutrophication, plant nutrients, phytoplankton, reservoir
1 Faculty of Environment and Resources Studies, Mahidol University, Nakhon Pathom 73170, Thailand.2 Inland Fishery Resources Development and Research Institute, Department of Fisheries, Bangkok 10900, Thailand.3 Department of Fishery Biology, Faculty of Fisheries, Kasetsart University, Bangkok 10900, Thailand.
Received date : 20/01/03 Accepted date : 31/03/03
INTRODUCTION
Bang Pra reservoir is greatly affected by
unsustainable developments such as the excessive
utilization of chemical fertilizers by farmers and
inadequate soil and water conservation in
agricultural areas that directly cause ecological
transformation, especially from eutrophication.
Eutrophication occurred in 1984 and exterminated
a number of fish from the decomposition of
exceeding algae blooms. Setkit et al. (1987)
conducted a research on the types and nutritive
Kasetsart J. (Nat. Sci.) 37 (1) 91
importance of plant nutrients in Bang Pra reservoir.
His study emphasized on the selection of
appropriate species of fish released in the reservoir
in order to eradicate excessive algae and aquatic
plant blooms, which propounded the problem of
exaggerated productivity and distribution of algae
in the reservoir. This evidence apparently showed
that Bang Pra reservoir was encountering with the
substantial amount of phytoplankton. Furthermore,
Chookajorn et al. (1991), reported to the Royal
Irrigation Department, responsible for the reservoir,
that in the dry season the excessive algae blooms
had killed a number of fishes.
Accordingly, the importance of the
eutrophication problem induced to this study, which
was conducted based on the study on quantity and
distribution of plant nutrients on eutrophication in
Bang Pra reservoir in the Province of Chonburi.
This research studied ecological characteristics of
Bang Pra reservoir that leads to the eutrophication
phenomena. This study justified the characteristics
of plant nutrients and aquatic plant dispersions in
the reservoir, including the environment that
appeals to eutrophication.
MATERIALS AND METHODS
The conditions of water sample collection
were considered according to these followings.
1. A study on quantity and variation of
plant nutrients in each area and season was
investigated from five inflowing brooks supplying
water into Bang Pra reservoir; the brook number
one (A1 : Sukreap brook), the brook number two
(A2 : Ruam brook), the brook number three (A3 :
Tha Sai brook), the brook number four (A4 : Kru
brook), and the brook number five (A5 : Nong Kor
– Bang Pra brook). There were five water sample
stations from five inflowing brooks and water
sample composed of an equal mixture of surface
was taken from each station.
2. A study on distribution and variation of
plant nutrients in each area and season was
conducted by collecting water samples in Bang
Pra reservoir. The conditions of water sample
collection were considered from;
- Four samples were collected from the
water receiving area (the water sample station
number one (B1), two (B2), three (B3) and four
(B4)).
- One sample was collected from the
reservoir with eutrophication problem (the water
sample station number five (B5)).
- One sample was collected in front of
the dam (the water sample station number six
(B6)).
- One sample was collected from the
center of the reservoir (the water sample station
number seven (B7)).
- One sample was collected from the
pumping station of the Royal Irrigation Department
that supplies raw water for consumption (the water
sample station number eight (B8)).
Water samples from five inflowing brooks
and from reservoir were collected throughout the
year from March 2001 – February 2002.
The thermal stratification in Bang Pra
reservoir was also examined according to area and
season. There were eight study stations that were
the same areas as the study on distribution of plant
nutrients and phytoplankton in Bang Pra reservoir.
All data collected in situ were depths, temperature
and dissolved oxygen. Measurements were made
at a series of depth intervals at every one-meter
throughout water column at all stations.
Biological data examined phytoplankton
taxa and their quantitative distribution in Bang Pra
reservoir were collected at the same selected
stations as water quality (B1, B2, B3, B4, B5, B6,
B7, B7, and B8). At each station, ten liters of
sample was equally taken from the surface of
water (approximately one metre deep) using 37-
micrometer mesh size of phytoplankton net every
month from March 2001- February 2002. The ten
ml. of phytoplankton sample taken from each
station was immediately preserved with five % of
92 Kasetsart J. (Nat. Sci.) 37 (1)
formalin solution.
Water samples collected from brooks were
analyzed for their physical and chemical properties
whereas water samples collected from Bang Pra
reservoir were investigated physical, chemical
and biological properties as shown in Table 1.
Analytical procedures used for quantitative
determination of the chemical properties were
based on standard methods for the examination of
water and wastewater (APHA, AWWA and WPCP,
1980)
The quantitative statistical determination
was investigated by cluster analysis and
multidimensional scaling (MDS) ordination (Clark
and Warwick, 1994 and Ludwig and Renold,
1988).
RESULTS
Water quality of supplying brooks and BangPra reservoir
The results of the variation of plant nutrients
in the five brooks demonstrated that the maximum
average quantity of nitrate (3.16±4.01 mg/l) was
found in the brook number two while the maximum
average quantity of nitrite (1.20±1.63 mg/l), total
ammonia (2.14±1.51 mg/l) and orthophosphate
combined (1.15±2.82 mg/l) was found in the brook
number three.
When considering the variation of plant
nutrients of the five brooks by month, it revealed
that the maximum average quantity of nitrate
(6.03±3.30 mg/l) reached its peak in December
whereas the maximum average quantity of nitrite
(1.80±2.97 mg/l) reached its peak in July. For the
maximum average quantity of total ammonia
Table 1 Parameters and analytical methods of samples.
Parameters Analytical methods
Physical
Depth* (m) Plummet
Temperature* (∞C) Thermometer
Dissolved Oxygen* (mg/l) DO meter
Turbidity (NTU) Nephelometric method
Transparency* (m) Secchi disc
pH* pH meter
Conductivity* (ms/cm) Conductivity meter
Chemical
Nitrate (mg/l) Cadmium reduction column method
Nitrite (mg/l) Griess-Ilosvay diazotization
Total ammonia (mg/l) Nesslerization
Orthophosphate (mg/l) Ascorbic acid method
Biological
Chlorophyll a (mg/l) Fluorescent techniques
Genus composition and abundance Sedqewick rafter counting chamber
of phytoplankton
* Remark; Field study.
Kasetsart J. (Nat. Sci.) 37 (1) 93
Figure 1 The monitoring stations of field data collection in the five brooks located around Bang Pra
reservoir and the monitoring stations of field data collection in Bang Pra reservoir.
Water sample station
B1
B8
B6
B2
B7B3
B4B5
A1
A2
A3
A5
A4
(3.93±0.72 mg/l) and orthophosphate (4.52±3.79
mg/l), the results showed that both of them reached
their peaks in October.
The study on the variation of plant nutrients
in Bang Pra reservoir showed that nitrate at every
water sample station was undetectable. However,
both nitrite (0.68±0.53 mg/l) and total ammonia
(1.38±1.25 mg/l) were found at the water sample
station number one whereas orthophosphate
(0.22±0.47 mg/l) was found at the water sample
station number three.
When considering the variation of plant
nutrients in Bang Pra reservoir for each month, it
revealed that nitrite (2.05±0.59 mg/l), total
ammonia (2.82±1.02 mg/l) and orthophosphate
(0.80±0.41 mg/l) reached their peaks in September,
November and October, respectively.
The biological study in Bang Pra reservoir
demonstrated that there were seven divisions of
phytoplankton in total: Cyanophyta, Chlorophyta,
94 Kasetsart J. (Nat. Sci.) 37 (1)
Figure 2 The average quantity of plant nutrients in the five brooks (A) and in Bang Pra reservoir (B).
-1
0
1
2
3
4
5
6
7
Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb
mg/
l
NO3 NO2
NH3 PO4
-0.5
0.0
0.5
1.0
1.5
2.0
2.5
3.0
Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb
mg/
l
NO2
NH3
PO4
Figure 3 The characteristic of Aulacoseira.
(http://keisou.hp.infoseek.co.jp/chuusin/
Aulacose/aulsei.html)
Chromophyta, Chrysophyta, Bacillariophyta,
Euglenophyta, Pyrrophyta and four unidentified
genera. Both identifiable and unidentifiable genera
totaled to 75 genera. The most prevalent
phytoplankton found in Bang Pra reservoir was in
genus Aulacoseira, Division Chromophyta. In
addition, it was discovered that 84.47% of
phytoplankton found in Bang Pra reservoir was
Aulacoseira.
DISCUSSION
Water quality and seasonal distribution of plantnutrients in the inflowing brooks and Bang Prareservoir
The consequences of the variation of plant
nutrients; nitrate, nitrite, total ammonia and
orthophosphate in the brooks carrying water into
Bang Pra reservoir, showed that the quantity of
plant nutrients in the hot season (March to May)
was low compared with those in the rainy (June to
October) and cold (November to February) season.
During the rainy season, plant nutrients in the five
brooks would first increase in June and incresae a
second time in October due to the high rainfall in
the beginning and the end of the rainy season that
vastly carried plant nutrients into the five brooks.
During the cold season, plant nutrients in each
brook would decrease but remained higher than
that during the hot season. Therefore, it could be
concluded that the rain was a significant factor of
washing and carrying plant nutrients remaining in
the surrounding areas into the five brooks.
However, it could not be clearly concluded
why each brook had different amount of plant
nutrients. After surveying the surrounding areas of
the five brooks located around Bang Pra reservoir,
since most areas are agricultural areas having
Kasetsart J. (Nat. Sci.) 37 (1) 95
similar characteristics. Consequently, it might be
likely that different agricultural activities such as
kinds and quantity of fertilizers used in agricultural
area might cause plant nutrients remaining in
agricultural area to be carried into the five brooks
in different quantities.
Another assumption considering different
quantities of plant nutrients in each brook might be
that agriculturists have inappropriate water and
soil conservation plan causing different remaining
plant nutrients in the agricultural area.
The water analyses results at Bang Pra
reservoir showed that the physical and chemical
quality of water met the level of water quality
standard of Thailand (Water quality division, 1991)
and water quality for fishery purposes
(Duangsawasdi and Somsiri, 1985). Despite the
change in seasons from hot to rainy season and
from rainy to cold season, water quality in Bang
Pra reservoir remained in acceptable standard but
slightly changed.
During the hot season, nitrate in the reservoir
was very low and undetectable. This was because
nitrate could not be washed from the surrounding
areas into Bang Pra reservoir due to lack of rain.
Moreover, nitrate found in each brook was rather
low as well. Considering the variation of nitrite,
total ammonia and orthophosphate in various
seasons, it showed that those plant nutrients were
lowest during the hot season whereas they had
large amount in the beginning and the end of the
rainy season. This was because plant nutrients
found in the five brooks carrying water into Bang
Pra reservoir during those periods were high too.
During the cold season, plant nutrients began to
decrease and with little change in scattering in
every water sample station.
Although each water sample station had
similar trend in changing and distributing of plant
nutrient, it still had different amount of plant
nutrients due to its location. For instance, water
sample stations that were the representatives of
water receiving areas mostly had larger amount of
plant nutrients than other stations located far from
that area.
Apart from that, this study also revealed
that phosphorus was the limiting factor in the
water quality of Bang Pra reservoir. This was
because when considering the N:P ratio referring
to the criteria of Sven-Olof and Walter (1989), it
showed that the N:P ratio of Bang Pra reservoir,
which was equal to 9.477 was higher than the
criteria of Seven-Olof and Walter (1989) who
stated that if a ratio of N:P exceeding seven,
phosphorus would be a limiting factor.
Furthermore, when using chlorophyll a in
order to compare with Helmut (1991) for classifying
the fertility of water in Bang Pra reservoir, it
revealed that a range of chlorophyll a in Bang Pra
reservoir was between 0.6062 – 1.8146 mg/l,
which was higher than that in a eutrophic lake,
0.01 – 0.50 mg/l (Helmut, 1991).
The change of phytoplankton in each water
sample station was not different at 0.5 limit.
Nevertheless, phytoplankton found each month
were different at a significant level of 95 %.
Phytoplankton in Bang Pra reservoir were scattered
in the similar quantity in almost every water sample
station whereas they had exponentially different
quantity in each month. Phytoplankton were low
during the hot season whereas they were relatively
high during the rainy and cold season. This was
because plant nutrients in Bang Pra reservoir during
the hot season were lower than those during the
rainy and cold season.
In June or the rainy season, phytoplankton
swiftly increased in every water sample station
and its total amount equaled to 784,260,000 units
per cubic metre. The main genus of phytoplankton
found was Aulacoseira, Division Chromophyta.
This increase of phytoplankton was a phenomenon
of phytoplankton bloom. This was due to the large
amount of rainfall in June that carried the remaining
plant nutrients in the agricultural area into Bang
Pra reservoir. Moreover, plant nutrients
substantially supplied from the five brooks were
96 Kasetsart J. (Nat. Sci.) 37 (1)
also a vital factor that increased plant nutrients in
Bang Pra reservoir during this period.
After June, phytoplankton in every water
sample station began to decrease until October.
However, in November, quantity of phytoplankton
suddenly increased to the maximum, equaling
1,786,430,000 units per cubic metre. This showed
that there was phytoplankton bloom again. This
study also revealed that phytoplankton at the water
sample station number two, four and seven had
considerably increased, equaling to 3,444,700,000,
325,095,000 and 256,655,000 units per cubic metre,
respectively. The main genus of blooming
phytoplankton, Aulacoseira was most commonly
found. The significant cause of the blooming of
this genus was that during the end of the rainy
season, Bang Pra sub-watershed received the most
rainfall, thereby causing large amount of plant
nutrients carried into the brooks and subsequently
into the reservoir. When water in the five brooks
containing a large amount of plant nutrients flowed
into the reservoir, it undoubtedly caused a swift
growth of phytoplankton.
During the cold season, phytoplankton
decreased again in December. This was because
some parts of plant nutrients in Bang Pra reservoir
began to sink into the bottom of the reservoir while
other parts were used by living organisms.
However, in January, there was a tremendous
increase in the amount of phytoplankton equaling
1,252,185,000 units per cubic metre. There were
largest amount of phytoplankton, equaling
189,135,000 units per cubic metre in the water
sample station number two. The main genus of
phytoplankton found was still Aulacoseira, which
was the same genus appearing in June and
November, when the blooming occurred.
Aulacoseira bloom occurred in January because
some parts of plant nutrients in Bang Pra reservoir
still remained from the rainy season. This enabled
phytoplankton to use these plant nutrients for their
growth. Moreover, in January, total ammonia in
Bang Pra reservoir in every water sample station
increased again because total ammonia found in
the five brooks during the mentioned period
increased simultaneously. This might possibly
bring about phytoplankton bloom in Bang Pra
reservoir in January.
Another potential assumption that might
lead to phytoplankton bloom in Bang Pra reservoir
in January was a phenomenon of thermal
stratification. This study discovered that in
December, there was a trend of thermal
stratification in the reservoir. This caused the
Figure 4 The average quantity of phytoplankton in the Bang Pra reservoir.
0.00E+00
5.00E+07
1.00E+08
1.50E+08
2.00E+08
2.50E+08
Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb
unit/
cubi
cmet
re
Kasetsart J. (Nat. Sci.) 37 (1) 97
lower part of the water mass to be unmixable with
the upper part of water mass. Accordingly, the
remaining plant nutrients in the bottom of reservoir
could not be carried to mix on the surface of the
reservoir. This caused little amount of plant
nutrients in the surface of the reservoir in December
when compared with those in January. In January,
there was no thermal stratification in Bang Pra
reservoir. Consequently, plant nutrients existing
in the bottom of the reservoir could be carried to
mix with the upper part of the water mass. This
caused the surface of the reservoir to have large
amount of plant nutrients again in January and
Figure 5 The dendrogram for hierarchical clustering of phytoplankton found in Bang Pra reservoir
(above) and the MDS ordination of phytoplankton, which were separated as two groups, stress
value = 0.01 (below).
Jan
Jun
No
v
Oct
Dec
Sep
Feb Ju
l
Au
g
May
Mar
Apr
100
80
60
40
Sim
ilar
ity
MarAprMay
Jun
JulAugSep
OctNov
Dec
Jan
Feb
Stress: .01
phytoplankton bloom occurred once again.
The study on the variation of phytoplankton
was consistent with the determination of cluster
analysis and multidimensional scaling (MDS)
ordination. Cluster analysis (above) and MDS
(below) showed that the groups of phytoplankton
found in June, November and January were highly
diversified and the most well distributed when
compared with other phytoplankton groups.
Therefore, the diversity and distribution of
phytoplankton in each month could be divided
into two groups as shown into Figure 5; the first
group consisted of June, November and January
98 Kasetsart J. (Nat. Sci.) 37 (1)
whereas the second group comprised March, April,
May, July, August, October, December and
February.
When considering the quantity and
dominant species of phytoplankton found in the
reservoirs in Thailand (Chantsavang et al., 1989,
Dumrongtripob and Janesirisak, 1996, Kasisuwan
and Sukkasem, 1994, Mapairoj and
Traichaiyaporn, 1996, Pitaktansakul, 2000, Somsiri
et al., 1995 and Sukollapun and Chabjinda, 1997),
it showed that the amount of phytoplankton were
normally somewhat low when compared with
those found in Bang Pra reservoir, except at the
Lumtakong reservoir, Nakhon Ratchasima
province (Kakkaeo et al., 2002) where it contained
large quantity of phytoplankton similar to Bang
Pra reservoir. The Lumtakong reservoir is known
as a eutrophic reservoir. In addition, there were
other reports concerning a phenomenon of
phytoplankton bloom. For instance, the study of
Kakkaeo et al. (2002) at the Lumtakong reservoir
found that in December 1998, there was a rapid
increase in quantity of blue green algae, equaling
2,200,000,000 units per cubic metre. This amount
approximated to quantity of phytoplankton that
bloomed mostly in Bang Pra reservoir in November,
equaling 1,786,430,000 units per cubic metre.
After studying dominant species of
phytoplankton found in various reservoirs in
Thailand (Chantsavang et al., 1989,
Dumrongtripob and Janesirisak, 1996, Kasisuwan
and Sukkasem, 1994, Mapairoj and
Traichaiyaporn, 1996, Pitaktansakul, 2000, Somsiri
et al., 1995 and Sukollapun and Chabjinda, 1997),
it was found that phytoplankton, which was the
dominant species was mostly in Division
Cyanophyta, genus Oscillatoria, Anabaena and
Microcystis; these are dramatic bloom species or
dominant species found in a eutrophic lake. This
was consistent with the study of Sven-Olof and
Walter (1989) and Maitland (1978) who stated
that phytoplankton, in Division Cyanophyta, genus
Oscillatoria, Aphanizomenon and Microcystis or
Diatoms, genus Melosira, Fragilaria,
Stephanodiscus and Asterionella, are the main
groups of phytoplankton found in a eutrophic lake.
However, Aulacoseira, the dominant genus of
phytoplankton in Bang Pra reservoir, has never
been found or reported to bloom in any eutrophic
lake before.
CONCLUSION
The seasonal change played an important
role in the amount and variation of plant nutrients
in the five brooks.
The quantity and change of plant nutrients
in Bang Pra reservoir mainly depended on plant
nutrients carried from the five brooks that supply
water to Bang Pra reservoir. The trophic state of
Bang Pra reservoir was a eutrophic lake and the
distribution of plant nutrients in this reservoir was
mostly found at the inflowing stations to the
reservoir than other water sample stations located
far away from the water receiving areas.
The biological consequences showed that
Aulacoseira was the dominant genus found in
Bang Pra reservoir, particularly with the high
peaks in June, November 2001 and January 2002.
ACKNOWLEDGEMENTS
This study has been completed with the
help and encouragement of my supervisor,
Assistant Professor Dr. Chumlong Arunlertaree,
Faculty of Environment and Resources Studies,
Mahidol University, Mr. Boonsong
Srichareondham of the Inland Fishery Resources
Development and Research Institute, Department
of Fisheries and Mr. Narong Veeravaitaya,
Department of Fishery Biology, Faculty of
Fisheries, Kasetsart University. I also wish to
thank Mr. Chirdsak Vongkamolchoon, the director
of Chonburi Inland Fishery Development and
Research Center. Thanks to the Department of
Environmental Science, Faculty of Science,
Kasetsart J. (Nat. Sci.) 37 (1) 99
Kasetsart University and the Postgraduate
Education, Training and Research Program in
Environmental Science, Technology and
Management, Mahidol University for providing
me with a grant to study and conduct my thesis.
LITERATURE CITED
APHA, AWWA and WPCP. 1980. StandardMethod for the Examination of Water andWaste Water. 15th edition. American Public
Health Publisher, New York. 1134 p.
Chantsavang, B., T. Chookajorn, S. Duagsawasdi
and P. Sordsuk. 1989. Hydrobiological andFishery Resource Survey in Kang KrachanReservoir Phetchaburi Province. Technical
Paper Number. 108. National Inland Fisheries
Institute, Department of Fisheries, Bangkok.
36 p. (in Thai)
Chookajorn, T., B. Chansavang, S. Tharnsuthus
and P. Kaewjaroon. 1991. Fishery ResourceSurvey in Bang Pra Reservoir, Chon BuriProvince. Technical Paper Number. 120.
National Inland Fisheries Institute,
Department of Fisheries, Bangkok. 22 p. (in
Thai)
Clark, K.R. and R.M. Warwick. 1994. Change inMarine Community: an Approach toStatistical Analysis and Interpretation.Plymouth Marine Laboratory, Plymouth.
144 p.
Dumrongtripob, J. and S. Janesirisak. 1996.
Hydrobiological and Fishery ResourceSurvey in Siridthon Reservoir in 1993.Technical Paper Number 17. Ubonratchathani
Freshwater Fisheries Development Center,
Ubonratchathani. 67 p. (in Thai)
Duangsawasdi, M. and C. Somsiri. 1985. WaterProperties and Water Analytical Methodsfor Fishery Research. National Inland
Fisheries Institute, Department of Fisheries,
Bangkok. 115 p. (in Thai)
Helmut, K. 1991. Control of Eutrophication in
Inland Waters. Redwood Press, Wiltshire.
337 p.
Kakkaeo, M., P. Kaeojaruen, M. Aeimsub, N.
Promkrouy and W. Somchan. 2002.
Abundance, Density and Distribution ofFishery Resources in LumtakongReservoir, Nakhon Ratchasima Province.Technical Paper Number. 212. National Inland
Fisheries Institute, Department of Fisheries,
Bangkok. 42 p. (in Thai)
Kasisuwan, S. and R. Sukkasem. 1994.
Hydrobiological and Fishery ResourceSurveys in Khlongkhla Reservoir, SongkhlaProvince. Technical Paper Number.3. Pattani
Inland Fisheries Development Center, Pattani.
31 p. (in Thai)
Ludwig, J.A. and J.F. Renold. 1988. StatisticalEcology; a Primer on Methods andComputing. John Wiley & Sons, New York.
337 p.
Maitland, PS. 1978. Biology of Freshwater.Blackie and Son Ltd., London. 243 p.
Mapairoj, P. and S. Traichaiyaporn. 1996. UsingPhytoplankton as Bio-Indicator in StandingWaters, Chiang Mai. Department of Biology,
Faculty of Science, Chiang Mai University,
Chiang Mai. 85 p. (in Thai)
Somsiri, C., S. Suravit and C. Mesuk. 1995. WaterQuality and Biodiversity of Plankton inRajjaprabha Reservoir, Surat ThaniProvince. Technical Paper Number. 173.
National Inland Fisheries Institute,
Department of Fisheries, Bangkok. 87 p. (in
Thai)
Pitaktansakul, R. 2000. Diversity of FreshwaterAlgae in Eutrophic Waters and OptimumConditions for the Growth of Mycrocystisaeruginosa Kutzing. MS. Thesis. Kasetsart
University, Bangkok. (in Thai)
Setkit, S., P. Sitasit and S. Manusmongkol. 1987.
Species and Nutritive Values of SomeNatural Food Plants in Bang Pra Tank.Technical Paper Number. 69. National Inland
100 Kasetsart J. (Nat. Sci.) 37 (1)
Fisheries Institute, Department of Fisheries,
Bangkok. 22 p. (in Thai)
Sukollapun, S. and K. Chabjinda. 1997.
Hydrobiological and Fishery ResourceSurveys in Maekuang Reservoir, Chiang-Mai Province. Technical Paper Number.1.
Inland Fisheries Division, Bangkok. 32 p. (in
Thai)
Sven-Olof, R. and R. Walter.1989. The Control
of Eutrophication of Lakes and Reservoirs.vol.1. The Parthenon Publishing Group, New
Jersey. 314 p.
Water Quality Division. 1991. Water QualityStandard of Thailand. Department of
Environmental Quality Standard. The Bureau
of National Environmental Committee.
Bangkok 135 p. (in Thai)
Kasetsart J. (Nat. Sci.) 37 : 101 - 116 (2003)
Fisheries in the Mun River: A One-Year Trial of Openingthe Sluice Gates of the Pak Mun Dam, Thailand
Tuantong Jutagate, Chaiwut Krudpan, Praneet Ngamsnae, Kanjana Payoohaand Thanatip Lamkom
ABSTRACT
The changes in fisheries during the trial on the opening of sluice-gates of Pak Mun Dam (July 2001
to June 2002) were investigated. There were 184 fish species from 44 families found, with some species
recognized to extirpate from the Mun River. Shannon’s diversity index ranged from 1.92 to 3.14. Catch
per unit of fishing effort ranged from 0.38 to 1.70 and 0.61 to 2.71 kg set-1 night-1 in down- and up-stream,
respectively. Fish upstream migrations during the rainy season were observed. Incomes from fishing
activities were 16,366 Thai Baht yr-1 per household. Traditional activities, especially related to fisheries,
returned and income from fishing also increased during the study period.
Key words: Pak Mun Dam, fishes and fisheries
Received date : 27/01/03 Accepted date : 31/03/03
Fisheries Programme, Faculty of Agriculture, Ubon Ratchathani University, Ubon Ratchathani 34190, Thailand.
INTRODUCTION
Fisheries in the Mun River, the largest
Mekong River tributary in Thailand, have been an
issue of interest since the construction of Pak Mun
Dam in 1990. The dam is about 22 m high (with the
operating head of 17 m) and 300 m wide. The
length of the reservoir outflow from the dam to the
Mekong River is 4.5 km and at the full storage
level, water flowing into the dam is backed up 35-
km upstream (Roberts, 2001). The dam was
inaugurated to impound in 1994. After the 1994
impoundment, there were major concerns on the
potamodromous behavior of many antipodal
species, the transformation from rheophilic- to the
limnophilic- environment, as well as changes and
lost in fishing activities (Roberts, 1994).
The Mun River is the longest river in the
north-east of Thailand, 641 km from its origin to
the Mekong confluence, with a 117,000-km2
catchment area (Duangswasdi and Chookajorn,
1991). Schouten et al. (2000) reported 265 fish
species recorded in the Mun watershed before
1994 and about 10 were introduced species. Fish
are the cheapest source of animal protein and
source of income for the local people, who live in
the vicinity to inland water bodies in Asia (De
Silva, 2001) and the migratory fishes of the Mekong
River Basin support many important community-
based artisanal fisheries (Roberts, 1993; Ahmed et
al., 1996). Warren and Mattson (2000) stated that
most of Mekong fishes were migratory species,
albeit to different degrees, for reproductive, trophic
or dispersal purposes. Poulsen and Jørgensen
(2000) also reported that many Mekong indigenous
species have to move to the Mekong tributaries
such as the Mun River in Thailand for their
reproductive purpose. However, since the
construction of the Pak Mun Dam, it is likely to be
a bio-geographic barrier and has a major impact
102 Kasetsart J. (Nat. Sci.) 37 (1)
for the upstream movement of migratory fishes
from the Mekong River to the Mun River (Roberts,
2001). Schouten et al. (2000) reported that after
the completion of the Pak Mun Dam, fishes and
fisheries was haphazard and performance of the
fish ladder, pool and weir type, had never been
properly evaluated.
In June 2001, The Royal Thai Government
tried to solve these controversies and ordered the
Electric Generation Authority of Thailand (EGAT)
to open all the sluice gates to monitor the changes
during the one-year trial (from July 2001 to June
2002) and to investigate the methods for
rehabilitation of fishes and fisheries. The objective
of the study was get the information of changes in
fish species and fisheries in the Mun River for a
compromised management.
MATERIALS AND METHODS
Sampling sitesThe sampling sites were divided into two
main areas, a downstream site (from Mun
confluence to dam) and an upstream site (from
dam to Pibun Mungsaharn District), by using the
dam as the barrier. Many rapids, slightly sharp
curves and narrower width were found in the
downstream site, while the bottom was flatter and
wider at the upstream site. The downstream and
upstream sites were subdivided into 11 and 17
stations, respectively (Figure 1).
Data collection and analysisEach station had its own data collector. The
study period was from July 2001 to June 2002
since the Thai Government had allowed opening
of sluice gates for only one year. Fishers were free
to decide when they went to fish as well as what
fishing gear(s) should be used in their given areas
while the sampling dates were set by the project.
Two field-staff members meet with the data
collectors fortnightly, to check on data collected
and brought the samples back. Fish samples were
packed in 10% formalin and were taken to the
Faculty of Agriculture, Ubon Ratchathani
University (70 km from the Pak Mun Dam).
Samples were weighed, measured and
taxonomically classified.
Figure 1 Map of the sampling area and stations.
Note Sampling stations
Kasetsart J. (Nat. Sci.) 37 (1) 103
Species diversity was calculated by using
Shannon’s diversity index (H’) and the relative
evenness (J’);
H’ = Â Pi ln Pi ----------------------------- (1)
and
J’ = H’/Hmax ------------------------------ (2)
where, Pi was the relative abundance, i.e.
the number of individuals for each species divided
by the total number of individuals for all species
(S) in each sample and Hmax was the natural
logarithm of S (Begon et al., 1990).
Non-parametric chi-square (c2) was used
for comparing catch per unit of fishing effort
(CPUE; kg set-1 night-1) between the main sampling
sites. Analysis of variance (ANOVA) and the
least-significant different (LSD) were used as tools
for analyzing the difference among CPUE in each
month, which was transformed to ln(1+CPUE)
(Green, 1979), by equation
Yij = m + ai + Œij ------------------- (1)
where, Yij was ln(1+CPUE) of the ith month
in the jth station, m was the grand mean ln(1+CPUE),
ai was the month effect and Œij was the error
term. The SYSSTAT program (Wilkinson, 1989)
was used as a tool in statistical analysis.
Information of incomes from fishing
activities, from 1990 to 1999, was derived from
the data, collected by the Interior Ministry staff for
development planning. In this study, the 2002
income was calculated from the payment, paid to
the data collectors. Changes in their fisheries and
fishery-related activities were from group
discussions with representatives, local fishers, in
the study area.
RESULTS
Fish species compositionDuring the study period, there were 184
fish species from 44 families found. Among these,
34 species were Mekong endemic species, 11 were
introduced species and 48 were species claimed by
the fishers that they were not seen in the study
areas for a long time, therefore were defined as
uncommon species (Table 1). Most catches were
from five families viz. Cyprinidae, Pangasidae,
Bagridae, Siluridae and Cobitidae. Also included
in the catches were two common stocking fishes
namely carp, Cyprinus carpio (Linn.) and Nile
tilapia, Oreochromis niloticus (Linn.) as well as a
stocking shellfish, giant freshwater shrimp,
Macrobrachium rosenbergii (De man). After the
opening of the sluice gates, H’ values continuously
increased until November, when the water receded,
and then tended to decline slightly. The lowest H’
value was in July and the peak was in November,
and the index ranged from 1.92 to 3.14 (Table 2).
Species, that probably extirpated from the
Mun River before construction of the dam
(Schouten et al., 2000; Roberts, 2001) were also
caught viz. mad barb, Leptobarbus hoeveni
(Bleeker), giant mottled eel, Anguilla marmorata
(Quoy & Gaimard), Laotian shad, Tenualosa
thibaudeaui (Durand), Mekong giant catfish,
Pangasinodon gigas (Chevey) and sheathfish,
Wallagonia leeri (Bleeker). Moreover, many
species, which were not in the list of reportedly
utilized fishes of the Pak Mun fish ladder
(Pholprasith et al., 1997), were also found in the
upstream area.
FisheriesCatch per unit of fishing effort (CPUE)
ranged from 0.38 to 1.70 and 0.61 to 2.71 kg
set-1 night-1 in down- and up-stream, respectively
(Table 3). From the c2-test, there was difference in
CPUE between the two main sampling areas (P-
value = 0.039) and CPUE tended to increase after
the gate-opening, especially in the upstream area
(Figure 2). However, a similar decline was observed
in CPUE from February to April and an increase,
again in June, in both down- and up-stream areas.
From ANOVA, there was no statistical difference
in terms of monthly ln (1+CPUE) in the down- and
up-stream areas, where P-values are 0.087 and
0.558, respectively. However, from LSD-test, ln
104 Kasetsart J. (Nat. Sci.) 37 (1)
(1+CPUE) in downstream in February and June
were significant different from each other (P-
value < 0.05) (Table 3). When categorized into
groups, Pangasiisd, Bagriids, Siluriids and some
Cyprinids, a homogenous group in the wet season
showed statistical difference (P-value < 0.05) to
the other months (Jutagate, accepted). The black
shark minnow, Morulius chrysophekadion
(Bleeker) and Pangasiids largely contributed in all
catches in terms of weight and number, respectively
(Figure 3).
For the changes in the fishing-gear use by
discussing with the local fishers and observing,
decreasing of the water level in the upstream area
allowed the resumption of trap fisheries, especially
in the rapid areas. On the other hand, during the
normal condition of sluice gate closing, well
operated fishing gear such as small lift net
(“Dahng” in Thai), used to fish Thai river sprat,
Clupeichthys aesarnensis (Wongratana) and small
shrimps, could not be employed during the trial
period, since the amount of target species and
shrimps decreased. No such changes were observed
in the use of longline and gillnet but the fishers
mentioned that the yields were higher when the
gates were opened than during the closing of sluice
gate period.
Socio-economics aspectsThe income from fishing activities alone
showed a remarkable change in the past ten years
(1992-2002) from 4,336 (±783) Thai Baht yr-1 per
household in 1992 to 16,366 (±116) Thai Baht
yr-1 per household in 2002. During this period, the
trend of increasing income continued from 1990 to
1996 and then declined from 1999 to date (Figure
4). Peak income was in 1996, two years after
impoundment.
In terms of fishery-related traditional
activities, the interviewees, from the group of
fishers, claimed that the benefits gained from this
trial period were that when they helped one another
to fish, they had strengthened their relationships
among neighbors and locals on joint use of fishing
gears techniques and fishing maneuvers were
transfered to the younger generation. Furthermore,
household members, who went to work in other
cities came back home to fish again.
DISCUSSION
Fish species diversity in the Mun River,
especially in Ubon Ratchathani Province area has
fluctuated considerably from 115 (Tantong and
Siripan, 1969), 75 (Team Consulting Engineers,
1982), 68 (Duangsawasdi and Chookajorn, 1991),
70 (Duangsawasdi and Duangsawasdi, 1992), 152
(Schouten et al., 2000) and, recently, 59 species in
the reservoir area (Jutagate et al., 2001). The
differences in number may have been from
misidentified fishes and misuse of sampling
techniques. Unfortunately, specimens from
previous studies were not maintained for further
re-checking. However, in this study, all specimens
were collected and maintained at the Ubon
Ratchathani University Museum of Fisheries
(UBUMF).
The high Shannon diversity (H’) index in
November, which was the period of the start of the
dry season, meant that the fishers could use many
types of gear. Moreover, this was also the time that
the adult fishes and new recruits migrated back to
the main stream (Poulsen and Jørgensen, 2000).
Continuous increasing of CPUE at the upstream
area indicated the migration of the downstream
fishes from the Mekong River. Homogeneous
grouping of CPUE data refers to the occurrence of
the migration (Warren, 1999). It is believed that
the three main purposes of migration, in this river
system, are reproductive, trophic and dispersal
(Warren et al., 1998). In Mekong River system,
indigenous fish species present more or less
migratory habits in both longitudinal and lateral,
where a raising of the water level and changes in
water color and turbidity are among the main
triggers to migrate upstream and then move back
Kasetsart J. (Nat. Sci.) 37 (1) 105
to the main stream when the water level recedes
(Poulsen and Jorgensen, 2000). The remarkably
high CPUEs in June and February were good
indicators, respectively, of the upstream and
downstream migration. Dry season upstream
migrations of some species were also observed by
Warren et al. (1998).
Contributions of P. gigas, Bagrid catfish,
Hemibagrus nemurus (Val. in Cuv. & Val.) and M.
rosenbergii implied the success of fish stocking
program of the EGAT cooperating with Department
of Fisheries (DOF). One of P. gigas was found
with a labeled tag in its first dorsal fin base and the
two latter market-species were stocked annually.
Meanwhile, Java barb, Barbodes gonionotus
(Bleeker) and minnow Labiobarbus leptocheilus
(Val. in Cuv. & Val.), which were stocked from
1999-2000 at a high rate (Head of Pak Mun Fishery
Conservation Unit, pers. com.), were never found
in large numbers in any catches. It could imply that
the rapid areas were not the suitable niches for
these two species.
Tongkum (1991) reported that the income
from fisheries of the main two impacted districts,
Khong Jiem and Pibun Mungsaharn, was 16,893
Thai Baht yr-1 per household. Peak income from
fishery occupation was in 1996, due to the increase
in fish production after impoundment, and this
was always lapper in newly dammed reservoirs
elsewhere in Thailand (for example, Ubolratana
and Sirinthorn), before income dropped and then
stabilized (Fishery Extension Division, 1995). The
slight increase in income from 1990 to 1994 was
due to the increase of fish prices from the changes
of the value of Thai Baht. The fluctuation in 1999
and 2002 was probably caused by the closing and
opening the sluice gates.
In regard to any optimized fishery
management which can be measured, Charles
(2001) stated that there were three main paradigms
in fishery management viz., conservation,
rationalization and social/community. A proper
management scheme should balance these three
paradigms. However, with the management of the
Pak Mun Dam, fishes and fisheries were on one
side and the electric generation was on another
side. In terms of conservation and social/
community paradigms, the fish migratory issue
must get priority. Meanwhile, the power supply
was amongst the most important in the
rationalization paradigm.
From the fisheries viewpoint, since the fish
ladder does not perform well and is not suitable for
many species found in the Mun River (Schouten et
al., 2000), the fishes should have a chance to
migrate upstream to complete their life cycle.
Allowing the opening of all sluice gates at a
particular time, especially during the rainy season,
this should be considered by the authorized
organizations and the Thai Government. However,
the dilemma occured because from July until 15th
September was still in the closed fishing season
but from the observation during the study period,
the fishers fished heavily during this period.
Therefore, the Pak Mun Fishery Conservation
Unit should concentrate on patrolling and stopping
any forbidden fishing gear uses during this time to
let the fishes have a chance to move upstream.
CONCLUSIONS
1. During the study period, the number of
fish species and income from fisheries increased
considerably compared to the previous closed
sluice gate period.
2. Most fish species likely migrated
upstream in the beginning of the rainy season and
migrated down stream after the water receded in
beginning of the dry season.
3. If any compromised management is
implemented to meet the requirements of both
fisheries and power supply, in terms of fisheries,
the period of opening the sluice gates, which
covers the rainy season, should be considered.
106 Kasetsart J. (Nat. Sci.) 37 (1)
Table 1 Species found during the opening the Pak Mun Dam sluice gate’s trial.
No. Scientific name Common name A B C D
Family Dasyatidae (stingrays)
1 Himantura polylepis (Bleeker) Freshwater giant stingray *
Family Notopteridae (featherbacks)
2 Notopterus notopterus (Pallas) Bronze featherback
3 Chitala blanci (Aubenton) Royal featherback *
4 Chitala lopis (Bleeker) Giant featherback *
5 Chitala ormata (Gray) Clown featherback
Family Anguillidae (true eels)
6 Anguilla marmorata Quoy & Guimard Giant mottled eel *
Family Clupeidae (herrings)
7 Clupeichthys aesarnensis Wongratana Thai river sprat * *
8 Tenualosa thibaudeaui (Durand) Mekong shad *
Family Engraulidae (anchovies)
9 Setipinna melanochir (Bleeker) Freshwater anchovy
Family Cyprinidae (carps or barbs)
10 Barilius koratensis Smith Korat barilius
11 Cyprinus capio Linnaeus Common carp * *
12 Hypophthalmichthys molitrix Valenciennes Bighead carp *
13 Paralaubuca typus Bleeker Silver knife barb *
14 Paralaubuca barroni (Fowler) Barron knife barb
15 Luciosoma bleekeri (Steindachner) Bleeker Apollo shark
16 Macrochirichthys macrochirus (Valenciennes) Laotain sword barb *
17 Parachela maculicauda (Smith) Scissortail Asian hatchet
18 Parachela oxygastroides (Bleeker) Giant Asian hatchet
19 Raiamas guttatus (Day) Trout barb *
20 Amblypharyngodon chulabhornae Chao Fah rasbora
Vidthayanon & Kottelat
21 Esomus metallicus Ahl Striped flying barb *
22 Rasbora sumatrana (Bleeker) Sidestripe rasbora
23 Rasbora myersi Brittan Silver rasbora
24 Rasbora rubrodorsalis Donoso-Buchner & Red fin rasbora
Schmidt
25 Rasbora borapetensis Smith Red tail rasbora
26 Rasbora spilocerca Rainboth & Kottelat Dwarf scissortail rasbora
27 Rasbora trilineata Steindachner Scissortail rasbora
28 Leptobarbus hoeveni (Bleeker) Mad barb
29 Probarbus jullieni Sauvage Seven-line barb *
30 Thynnichthys thynnoides (Bleeker) Tiny scale barb *
31 Amblyrhynichthys truncatus (Bleeker) Bigeye barb *
Kasetsart J. (Nat. Sci.) 37 (1) 107
Table 1 (cont.) Species found during the opening the Pak Mun Dam sluice gate’s trial.
No. Scientific name Common name A B C D
32 Cosmocheilus harmandi Sauvage Bala shark
33 Cyclocheilichthys heteronema (Bleeker) Branched barbel *
sensory barb
34 Cyclocheilichthys apogon (Val. in Cuv. & Beardless sensory barb *
Val.)
35 Cyclocheilichthys armatus (Val. in Cuv. & Silver sensory barb
Val.)
36 Cyclocheilichthys repasson (Bleeker) Pointed nose sensory *
barb
37 Cyclocheilichthys enoplos Bleeker Giant sensory barb *
38 Cyclocheilichthys furcatus Sontirat Mekong sensory barb * *
39 Mystacoleucus marginatus (Val. in Cuv. & Yellowtail hook barb *
Val.)
40 Mystacoleucus atridorsalis Fowler Spotted black tip hook * *
barb
41 Mystacoleucus ectypus Kottelat Black tip hook barb *
42 Puntioplites proctozysron (Bleeker) Cubic barb *
43 Puntioplites falcifer Smith Longfin cubic barb *
44 Sikukia gudgeri (Smith) Gudger barb * *
45 Barbodes altus (Gunther) Golden barb *
46 Barbodes gonionotus (Bleeker) Java barb *
47 Barbodes schwanenfeldi (Bleeker) Tinfoil barb *
48 Hypsibarbus malcomi (Smith) Malcom barb
49 Hypsibarbus suvatti Rainboth Suvatti barb
50 Hypsibarbus wetmorei (Smith) Wetmore barb
51 Hypsibarbus lagleri Rainboth Lagler barb * *
52 Discherodontus ashmeadi (Fowler) Red tail barb * *
53 Poropuntius deauratus (Val. in Cuv. & Val.) Yellow tail brook * *
Barb
54 Scaphognathops bandanensis Boonyaratpalin Bandan sharp-mouth * *
& Sirungroj barb
55 Scaphonathops stejnergeri Smith Stejnerger sharp- mouth * * *
barb
56 Hampala dispar Smith Spotted wolf barb * *
57 Hampala macrolepidota (Kuhl & van Hasselt Banded wolf barb *
in van Hasselt)
58 Puntius chola Hamilton Chola common barb
59 Puntius aurotaeniatus Tirant Samet common barb
60 Puntius binotatus (Val. in Cuv. & Val.) Spotted common barb
108 Kasetsart J. (Nat. Sci.) 37 (1)
Table 1 (cont.) Species found during the opening the Pak Mun Dam sluice gate’s trial.
No. Scientific name Common name A B C D
61 Puntius orphoides (Val. In Cuv. & Val.) Red cheek common barb *
62 Puntius partipentazona Fowler Siamese tiger barb
63 Bangana behri Fowler Mekong dolphin labeo *
64 Henicorhynchus siamensis (Sauvage) Common Siamese barb
65 Henicorhynchus lineatus (Smith) Striped Siamese barb * *
66 Henicorhynchus lobatus (Smith) Pointed nose Siamese
barb
67 Henicorhynchus ornatipinnis Roberts Red fin Siamese barb * *
68 Cirrhinus microlepis Sauvage Giant violet Siamese * *
barb
69 Cirrhinus chinensis Gunther Mud carp *
70 Cirrhinus migrala (Hamilton) Mrigal *
71 Morulius chrysophekadion (Bleeker) Crow Labeo *
72 Labeo dyocheilus (McClelland) Thick lip labeo *
73 Labeo rohita (Hamilton) Rohu *
74 Labiobarbus leptocheilus (Val. in Cuv. & Striped longfin labeo *
Val.)
75 Lobocheilus melanotaenia (Fowler) Bluegill labeo *
76 Osteochilus hasselti (Val. in Cuv. & Val.) Red spotted robust labeo *
77 Osteochilus melanopleura (Bleeker) Black eye robust labeo
78 Osteochilus lini Fowler Lin robust labeo *
79 Osteochilus microcephalus (Val. in Cuv. & Black striped robust *
Val.) labeo
80 Osteochilus waandersi (Bleeker) Black striped robust
labeo
81 Crossocheilus oblongus Kuhl & van Hasselt Oblong algae eater * *
in van Hasselt
82 Crossocheilus reticulates (Fowler) Reticulated algae eater
83 Crossocheilus atrilimes Kottelat Mekong algae eater *
84 Epalzeorhynchos munense (Smith) Mun red tail shark * *
85 Epalzeorhynchos frenatus (Fowler) Red fin shark * *
86 Mekongina erythrospila Fowler Mekong Labeo * *
Family Characidae
87 Myletes bidens (Spinx & Agassiz) Pacu *
Family Gyrinocheilidae (algae eater)
88 Gyrinocheilus pennocki Fowler Spotted algae eater * *
Family Cobitidae (loaches)
89 Acanthopsis sp.1 (large spotted) Horse face loach *
90 Acanthopsis sp.2 (small spotted) Horse face loach *
Kasetsart J. (Nat. Sci.) 37 (1) 109
Table 1 (cont.) Species found during the opening the Pak Mun Dam sluice gate’s trial.
No. Scientific name Common name A B C D
91 Acanthopsoides sp.1 Pygmy Horse face loach
92 Botia helodes Sauvage Tiger botia *
93 Botia eos Taki Sun botia * *
94 Botia lecontei Fowler Silver botia
95 Botia morleti Tirant Skunk botia *
96 Botia modesta Bleeker Redtail botia *
97 Lepidocephalichthys hasselti (Val. in Cuv. & Hasselt sand loach
Val.)
98 Lepidocephalichthys sp.1 Sand loach
Family Balitoridae (river loaches)
99 Homaloptera smithi Hora Smith climbing loach *
100 Nemacheilus pallidus Kottelat Spotted brook loach *
Family Bagridae (Bagrid catfishes)
101 Pseudomystus siamensis (Fowler) Bubble bee mystus
102 Mystus atrifasciatus Fowler Mekong striped mystus *
103 Mystus mysticaetus Roberts Southeast Asia striped
mystus
104 Mystus singaringan (Bleeker) Long adipose mystus
105 Mystus bocourti (Bleeker) High fin mystus
106 Hemibagrus sp.1 White bagrus *
107 Hemibagrus nemurus (Val. in Cuv. & Val.) Yellow bagrus *
108 Henmibagrus filamentus (Fang & Chaux) Filamentous bagrus
109 Hemibagrus wyckii (Bleeker) Black bagrus
110 Hemibagrus wyckioides (Chaux & Fang) Red fin bagrus
111 Bagriichthys obscurus Ng Shortfin blunt-nose
catfish
112 Bagriichthys macracanthus (Bleeker) High fin blunt-nose
Family Pangasiidae (river catfishes) catfish
113 Pangasianodon gigas Chevey Mekong giant catfish * *
114 Pangasianodon hypophthalmus (Sauvage) Iridescent shark *
catfish
115 Helicophagus waandersi Bleeker Rat mouth shark
catfish
116 Pangasius pleurotaenia (Sauvage) Big eye shark catfish *
117 Pangasius conchophilus Roberts & Snail eating shark
Vidthayanon catfish
118 Pangasius bocourti Sauvage Bocourt shark catfish *
119 Pangasius macronema Bleeker Long barbel shark
catfish
110 Kasetsart J. (Nat. Sci.) 37 (1)
Table 1 (cont.) Species found during the opening the Pak Mun Dam sluice gate’s trial.
No. Scientific name Common name A B C D
120 Pangasius larnaudii Boucourt Black eye shark
catfish
121 Pangasius sanitwongsei Smith Sanitwong shark catfish *
Family Schilbeidae (Schilbeid catfishes)
122 Laides longibarbis (Bleeker) Flatted barbel shark
catfish
Family Siluridae (sheathfish)
123 Belodontichthys truncatus (Bleeker) Dracula sheathfish
124 Hemisilurus mekongensis Bornbursh & Mekong sheathfish * *
Lundberg
125 Micronema apogon (Bleeker) Bronze sheathfish
126 Micronema bleekeri (Gunther) Blue sheathfish
127 Micronema micronema (Bleeker) Gray sheathfish *
128 Kryptopterus cheveyi Durand Chevey sheathfish
129 Kryptopterus palembangensis Bleeker Giant glass catfish *
130 Kryptopterus cryptopterus (Bleeker) Riverine sheathfish *
131 Ompok siluroides (Lecepede) Black ear sheathfish
132 Wallago attu (Schneider) Crocodile sheathfish
133 Wallagonia leeri Bleeker Black sheathfish *
Family Sisoridae (Sisorid catfishes)
134 Bagarius yarrelli Sykes Crocodile catfish
135 Glyptothorax lampris Fowler Torrent catfish
Family Clariidae (walking catfishes)
136 Clarias batrachus (Linnaeus) Walking catfish
137 Clarias macrocephalus Gunther Broad-head walking
catfish
138 Clarias sp.1 (hybrid) Hybrid walking catfish *
Family Loricariidae (sucker armer cat)
139 Hypostomus plecostomus (Linnaeus) Lorica sucker catfish *
Family Mochokidae
140 Synodontis eupterus Boulenger Longfin upside-down *
catfish
Family Salangidae
141 Neosalanx sp.1 Mekong salang * *
Family Sundasalangidae (Noodlefish)
142 Sundasalanx mekongensis Kottelat & Ng Mekong noodlefish *
Family Poecilidae
143 Poecilia reticulata (Peters) Guppy *
Kasetsart J. (Nat. Sci.) 37 (1) 111
Table 1 (cont.) Species found during the opening the Pak Mun Dam sluice gate’s trial.
No. Scientific name Common name A B C D
Family Oryziidae (rice fish)
144 Oryzias minutilus Smith Pygmea rice fish
145 Oryzias sinensis Chen, Uwa & Chu Chinese rice fish *
Family Hemirhamphidae (halfbeaks)
146 Dermogenys siamensis Fowler Siamese half beak
Family Belonidae (needlefishes)
147 Xenentodon canciloides (Bleeker) Long beak tropical gar *
Family Syngnathidae (pipefishes)
148 Doryichthys contiguus Kottelat Pygmy pipefish * *
Family Indostomidae
149 Indostomus spinosus Brite & Kottelat Spiny tropical * *
Family Synbranchidae (swamp eels) stickleback
150 Monopterus albus (Zieuw) Swamp eel
Family Mastacembelidae (spiny eels)
151 Macrognathus semiocellatus Roberts Ocellated spiny eel
152 Macroghathus siamensis (Gunther) Peacock spiny eel
153 Mastacembelus favus Hora Tire track spiny eel
154 Mastacembelus armatus (Lacepede) Zig-zag spiny eel
Family Chaudhuriidae (dwarf swamp eels)
155 Chaudhuria caudata Annandale Burmese spineless eel *
Family Ambassidae (glassfishes)
156 Parambassis siamensis (Fowler) Siamese glassfish *
Centropamidae
157 Lates calcarifer (Bloch) Barramundi *
Family Scienidae (drums)
158 Bosemania microlepis (Bleeker) Smallscale croaker *
Family Coiidae (Tiger fish)
159 Coius undecimradiatus Roberts & Kottelat Narrow-band tigerfish *
Family Toxotidae (archerfishes)
160 Toxotes chatareus (Hamilton) Largescale archerfish
Family Cichlidae (cichlids)
161 Oreocromis niloticus (Linnaeus) Nile tilapia *
Family Eleotridae (sleepers)
162 Oxyeleotris marmorata Bleeker Marbled sleeper goby
Family Gobiidae (gobies)
163 Branchygobius mekongensis Larson & Mekong Bubble bee * *
Vidthayanon goby
164 Glossogobius giuris (Hamilton) Gangetic tank goby * *
112 Kasetsart J. (Nat. Sci.) 37 (1)
Table 1 (cont.) Species found during the opening the Pak Mun Dam sluice gate’s trial.
No. Scientific name Common name A B C D
165 Tridentiger ocellatus (Fowler) Mekong ocellate goby *
166 Gobiopterus chuno (Hamilton) Glass goby *
167 Uniden. goby Deep water goby *
Family Nandidae (leaffishes)
168 Nandus oxyrynchus Ng, Vidthayanon & Ng Leaf tigerfish *
169 Pristolepis fasciatus (Bleeker) Compressed perch *
Family Anabantidae (climbing perch)
170 Anabas testudineus (Bloch) Climbing perch *
Family Belontiidae (gouramies)
171 Betta smaragdina Ladiges Mekong fighting fish *
172 Trichogaster pectoralis (Regan) Snakeskin gourami
173 Trichogaster trichopterus (Pallas) Three spot gourami
174 Trichopsis schalleri Ladiges Colorful croaking
gourami
175 Trichopsis vittatus (Cuv. in Cuv. & Val.) Croaking gourami
Family Osphronemidae (giant gouramies)
176 Osphronemus goramy Lacepede Giant gourami * *
Family Channidae (snakeheads)
177 Channa limbata (Cuvier) Red tail snakehead
178 Channa lucius (Cuv. in Cuv. & Val.) Marble snakehead
179 Channa striata (Bloch) Green tail snakehead *
180 Channa micropeltes (Cuv. in Cuv. & Val.) Giant snakehead *
Family Soleidae (soles)
181 Brachirus harmandi (Sauvage) Ovate sole
Family Tetraodontidae (puffers)
182 Chonerhinus nefastus Roberts Green bottle puffer
183 Tetraodon leiurus Bleeker Spotted green puffer
184 Tetraodon cambodgensis Chabanaud Ocellated puffer
Note: A: Species, which reportedly utilize fish-ladder (Pholprasith et al., 1997)
B: Mekong endemic species
C: Uncommon species
D: Introduced species
Kasetsart J. (Nat. Sci.) 37 (1) 113
Table 2 Shanon’s diversity indice and relative evenness during the study periods.
Month Shanon’s index ± SE Relative evenness ± SE
July 2001 1.92 ± 0.65 0.55 ± 0.20
August 2001 2.92 ± 0.18 0.81 ± 0.50
September 2001 2.12 ± 0.57 0.58 ± 0.17
October 2001 3.10 ± 0.18 0.81 ± 0.04
November 2001 3.14 ± 0.13 0.82 ± 0.02
December 2001 2.70 ± 0.32 0.76 ± 0.08
January 2002 2.35 ± 0.33 0.70 ± 0.09
February 2002 2.45 ± 0.27 0.73 ± 0.07
Martch 2002 2.16 ± 0.33 0.66 ± 0.09
April 2002 2.49 ± 0.23 0.71 ± 0.07
May 2002 2.44 ± 0.37 0.66 ± 0.09
June 2002 2.50 ± 0.23 0.74 ± 0.06
Table 3 Average CPUE at Pak Mun Reservoir from July 2001 to June 2002.
Month CPUE ± SD (kg set-1 night-1) ln (1+CPUE)
Downstream Upstream Downstream Upstream
July 0.43 ± 0.10 1.40 ± 0.95 0.358ab 0.875ab
August 0.38 ± 0.17 1.71 ± 0.94 0.322b 0.998ab
September 0.64 ± 0.35 0.61 ± 0.18 0.495ab 0.476a
October 0.59 ± 0.17 1.17 ± 0.27 0.464ab 0.775ab
November 0.85 ± 0.28 1.67 ± 0.34 0.615ab 0.982ab
December 0.69 ± 0.28 1.94 ± 0.70 0.525ab 1.078ab
January 0.50 ± 0.17 2.62 ± 0.97 0.405ab 1.287ab
February 1.62 ± 0.69 2.71 ± 1.06 0.963c 1.312b
Martch 0.98 ± 0.39 2.28 ± 0.77 0.683ab 1.188b
April 0.79 ± 0.14 1.54 ± 0.45 0.584ab 0.932ab
May 0.73 ± 0.22 2.04 ± 0.45 0.548ab 1.112ab
June 1.70 ± 0.16 2.19 ± 0.77 0.993c 1.160b
Note: the same letter, in each column, mean that there is no significant different (µ = 0.05)
114 Kasetsart J. (Nat. Sci.) 37 (1)
Downstream
0.00
0.50
1.00
1.50
2.00
2.50
J A S O N D J F M A M J
Month
CPU
E (
kg s
et-1
nig
ht-1
)
Upstream
0.00
0.50
1.00
1.50
2.00
2.50
3.00
3.50
J A S O N D J F M A M J
Month
CPU
E (
kg s
et-1
nig
ht-1
)
Figure 2 Temporal changes in CPUE ± SD (kg set-1) during the study periods.
Figure 3 Contribution of catches during the study periods.
Kasetsart J. (Nat. Sci.) 37 (1) 115
ACKNOWLEDGEMENTS
This research was funded by the Royal
Thai Government. We gratefully acknowledged
all in situ data collectors and the fishers who were
involved in this study. We thank our field staff,
Sangkom Yaowachai and Ekapot Puekpan for
their brilliant work and a special thank to Dr.
Michael D. Hare for the English editing of the
manuscript.
LITERATURE CITED
Ahmed, M., T.S. Tana and N. Thuok. 1996.
Sustaining the gifts of the Mekong: fisheries
in Cambodia. Watershed 1 : 33-38.
Begon, M., J.L. Harper and C.R. Townsend. 1990.
Ecology: Individuals, Populations andCommunities: 2nd ed. Blackwell Sciet. Publ.,
London. 945 p.
Charles, A. T. 2001. Sustained Fishery Systems.Blackwell Sci. Inc., London. 527 p.
De Silva, S.S. 2001. Reservoir fisheries: broad
strategies for enhancing yields, pp. 7-15. In
S.S. De Silva (ed.). Reservoir and Culture-based Fisheries: Biology and Management.Canberra: ACIAR.
Duangswasdi, S. and T. Chookajorn. 1991.
Fisheries Characteristic, Species andDistribution of Fishes in the Mun River.Tech. Pap. No. 125, National Inland Fisheries
Institute, Department of Fisheries. 12 p. (In
Thai)
Duangswasdi, M. and S. Duangswasdi. 1992.
Fishery Resources and Fisheries Activitiesin Mun River. Tech. Pap. No. 136. National
Inland Fisheries Institute, Department of
Fisheries. 53 p. (In Thai)
Fishery Extension Division 1995. Damming andFishery Resources. Royal Thai Department
of Fisheries, Bangkok. 41 p. with annex. (In
Thai)
Green, R.H. 1979. Sampling Design andStatistical Methods for EnvironmentalBiologists. A Wiley-Interscience Publication,
New York. 257 p.
Jutagate, T., C. Krudphan, P. Ngamsnae, T.
Lamkom and K. Payooha. Catch per unit of
fishing effort as the evidence in fish migratory
in the Mekong tributary in Thailand. J. Fish.Mgmnt. and Ecol.
Jutagate, T., T. Lamkom, K. Satapornwanit, W.
Naiwinit and C. Petchuay. 2001. Fish species
diversity and ichthyomass in Pak Mun
Figure 4 Changes in income ± SD (Thai Baht yr-1) per household from fisheries at the study area from
1990-2002.
0
5000
10000
15000
20000
1988 1990 1992 1994 1996 1998 2000 2002 2004
Year
Inco
me
(Tha
i Bah
t yr-
1 )
3,693 – 606
4,336 – 9365,737 – 1,545
14,248 – 2,914
8,718 – 1,621
16,367 – 402
116 Kasetsart J. (Nat. Sci.) 37 (1)
Reservoir, five years after impoundment.
Asian Fish. Sci. 14 : 417-425.
Pholprasith, S., P. Sihapitukgiat, B.
Sricharoendham and K. Su-aroon. 1997.
Fishes Passing through the Pak Mun FishLadder and Some Factors AffectingMigration. National Inland Fisheries Institute
Tech. Pap. No.193. Bangkok, Department of
Fisheries. 119 p. (In Thai)
Poulsen, A.F. and J.V. Jorgensen 2000. FishMigration and Spawning Habit in theMekong Mainstream: A Survey UsingLocal Knowledge (Basin-Wide). Mekong
River Commission, Vientiane. 134 p.
Roberts, T. R. 1993. Artisanal fisheries and fish
ecology below the great water falls of the
Mekong River in Southern Laos. Nat. Hist.Bull. of Siam Soc. 41 : 31-62.
Roberts, T.R. 1994. Just another dammed river?
Negative impacts of Pak Mun Dam on fishes
of the Mekong Basin. Nat. Hist. Bull. ofSiam Soc. 41 : 105-133.
Roberts, T.R. 2001. On the river of no returns:
Thailand ‘s Pak Mun Dam and its fish ladder.
Nat. Hist. Bull. of Siam Soc. 49 :189-230.
Schouten, R., P. Sripatraprasit, S. Amornsakchai
and C. Vidthayanon. 2000. Fish, andFisheries Up- and Downstream of the PakMun Dam. World Commission on Dams,
Pak Mun Dam case study. 51 p.
Tantong, A. and N. Siripan. 1969. A survey on
fishes and fishing gears in the Mun River,
Ubon Ratchathani, pp. 10-35. In AnnualReport of Ubon Ratchathani FreshwaterFisheries Station, Department of Fisheries.
(In Thai)
Team Consulting Engineers 1982. Environmentaland Ecological Investigation of Pak MunProject. Vol. 2: Main Report, Part IV:Fishes and Fisheries. Electric Generation
Authority of Thailand, Bangkok. 47 p.
Tongkum, T. 1991. A Study on the FisheryResources and Socio-economics Status inthe Lower Mun River. Electric Generation
Authority of Thailand, Bangkok. 27 p. (In
Thai)
Warren, T.J. 1999. A Monitoring Study to Assessthe Localized Impacts Created by the NamTheun-Hinboun Hydro-Scheme onFisheries and Fish Populations. Final Report.
The Theun-Hinboun power company.
Vientiane, Lao PDR. 68 p.
Warren, T.J., Chapman, G.C. and Sinhanouvong,
D. 1998. The upstream dry-season migration
of some important fish species in the lower
Mekong River of Southern Lao PDR. AsianFish. Sci. 11 : 239-251.
Warren, T.J. and Mattson, N.S. 2000. Fish passes
and migrations: Can fish passes mitigate the
impacts of water related development on fish
migrations in the Mekong Basin? Mekong
Fish: Catch and Culture 6(2) : 1-4.
Wilkinson, L. 1989. SYSSTAT: the System forStatistics. Evanston Inc., IL. 882 p.
Kasetsart J. (Nat. Sci.) 37 : 117 - 121 (2003)
Synthesis of Barium Titanate as an Electroceramic Raw Materials
Nuchnapa Tangboriboon
ABSTRACT
Nowadays, most electronic and electrical parts of equipment in Thailand such as substrates,
magnetics, capacitors, ferroelectric, piezoelectric, RAMs, DRAMs, FERAMs, loudspeakers and devices
in ultrasonic cleaning are imported. Barium titanate powder is one of electroceramic raw materials. It is
used to produce parts of electroceramic products. In this project, barium titanate was produced by
hydrothermal synthesis and thermal treatment process. The mol ratios of titanium dioxide to barium
hydroxide in the thermal treatment process were 0.5:1, 1:1, and 1:0.5 at 700, 1000 and 1200∞C ,for 3 and
5 hours. Results of all experiments were analysed by x-ray diffraction (XRD), scanning electron
microscope (SEM), particle size distribution and liquid pycnometer technique. A good condition for
barium titanate synthesis is from the hydrothermal reaction at the weight ratio of 5:20, 90∞C , and 72
hours. The obtained powders possessed high purity, perovskite structure and a density of 6.2520 g/cm3.
In addition, an average particle size at the accumulated particle size of 50 percent (d50) is less than 1
micron. For the thermal treatment process, the appropriate condition is 0.5 mol titanium dioxide to 1 mol
barium hydroxide at 700∞C for 3 hours. An average particle size at d50 is larger than 5 microns and the
density is 4.7100 g/cm3 because its structure is composed of another composition.
Key words: barium titanate, perovskite structure, hydrothermal synthesis, thermal treatment process
INTRODUCTION
Panne et al.(1992) reported that Barium
titanate (BaTiO3) is an extensively studied and
widely utilized perovskite-type electroceramics.
There are two important crystalline phases of
barium titanate being used in the microelectronics
industry as reported in William (2002). The
tetragonal phase of barium titanate is used in
a broad array of electronic devices due to its
ferroelectric properties, while the cubic form,
although not ferroelectric, has a high dielectric
constant that makes it suitable as capacitors. The
main objective in barium titanate synthesis is to
create smaller, more uniform particles to allow for
finer ceramic layers to be used in multilayer
capacitors, piezoelectric, capacitor and actuator
(and, thus, achieve device miniaturization) without
the loss of dielectric properties as reported in
Kingery et al.(1992). Controlling the phase,
composition homogeneity, particle size, density
and mono-dispersity, microstructure, and the cost
of particle production are important concerns in
developing techniques for synthesizing barium
titanate. In this research, two methods of barium
titanate synthesis are studied. One method is
thermal treatment process and the other is
hydrothermal process. The hydrothermal process
is based on Michael (2000).
Department of Material Engineering, Faculty of Engineering, Kasetsart University, Bangkok 10900, Thailand.
Received date : 09/01/03 Accepted date : 26/03/03
118 Kasetsart J. (Nat. Sci.) 37 (1)
MATERIALS AND METHODS
The synthesis of barium titanate as an
electroceramic raw materials consisted of two
methods. The principle of mol ratio mixing of two
components are based on Ree and Dippel .(1992).,
as follows :
Method 1 Thermal treatment process (Figure 2)
1. Mix titanium hydroxide and barium
hydroxide at the mol ratios of 0.5:1, 1:1, and 1:0.5.
2. Pour the mixture from the first step into
a ceramic crucible and heat in a furnace at
temperatures of 700,1000 and 1200∞C for 3 and 5
hrs.
3. Characterize the powder obtained from
the second step by XRD, SEM, particle size
analyzer, and liquid pycnometer technique.
Figure 1 Perovskite structures in Ferroelectric materials.
Figure 2 Flow chart of barium titanate synthesis by the thermal treatment process.
+
mol ratios of TiO2 : Ba(OH)2 0.5:1, 1:1, 1:0.5
Ba(OH)2TiO2
A ceramic crucible
Heat at temperatures of 700,1000, and 1200∞C for 3 and 5 hrs.
Barium titanate powder
Kasetsart J. (Nat. Sci.) 37 (1) 119
Method 2 Hydrothermal synthesis (Figure 3)
1. Mix 20 g. of barium hydroxide with 5 g.
of titanium hydroxide(Ba:Ti equals to 1:1 mol
ratio) in a Teflon bottle.
2. Add 30 ml. of distillate water into the
mixture in the Teflon bottle, cover and shake
vigorously.
3. Heat the mixture from the second step
in an oven at 90∞C for 24 and 72 hrs to activate
the reaction.
4. Wash the precipitate from step 2 with
100 ml. of 1 molar of formic acid and filter.
5. Dry the filtered cake at 90∞C for 24 hrs.
6. Characterize the powder as received by
XRD, SEM, particle size analyzer, and liquid
pycnometer technique.
RESULTS AND DISCUSSION
The suitable condition for barium titanate
synthesis by thermal treatment process is 0.5 mol
of titanium dioxide and 1 mol of barium hydroxide
at 700∞C for 3 hrs. The powder obtained has a
density of 4.7100 g/cm3 which is less than
theoretical density value because of Al4Ti2SiO12
mixed in perovskite phase.
Hydrothermal synthesis for barium titanate
powder is a condition of 5 g. of titanium dioxide
Figure 3 Flow chart of barium titanate synthesis by the hydrothermal synthesis.
weight ratio 20 g : 5 g (1:1 mol ratio of Ba:Ti)
Temperature 90∞C for 24 and 72 hrs
Ba(OH)2TiO2
Add 30 ml. of water
in a Teflon bottle
Dilute with 100 ml. of 1M. formic acid
Filter
Dry the filtered cake at 90∞C
Barium titanate powder
120 Kasetsart J. (Nat. Sci.) 37 (1)
mixed with 20 g. of barium hydroxide (mol ratio
1:1), dried at 90∞C for 72 hrs. Barium titanate
powder has characteristic close to the theory. The
powder has less aggregation and better defined
microspherical shape (solid sphere with smooth
surface) than that of thermal treatment process.
Figure 4 shows crystalline phase compositions,
most of them are perovskite structure, as Hung and
Riman.(1998). The average particle size is smaller
than 1 micron, as shown in Figure 5. The
microstructure of barium titanate powder, as-
prepared by SEM is shows in Figure 6. In this
method, 100 ml. of 1 M. of formic acid was added
to reduce the barium carbonate impurity level in
the barium titanate suspension, the procedure was
slightly modified from the work of Eckert et
al.(1996). Formic acid was added immediately
during the suspension was still hot. The suspension
was allowed to stand for 15 min at room
temperature; then it was centrifuged and washed
with deionized water twice, and was removed by
pipette. The remaining white paste was air dried to
form a cake, and dried in an oven overnight. The
other hydrothermal synthesis condition is to use 5
g. of titanium dioxide to 20 g. of barium hydroxide,
dry at 90∞C for 24 hrs., but the crystalline phase
compositions are composed of the perovskite,
cubic and tetragonal. The density was reduced to
3.1191 g/cm3
CONCLUSION
Hydrothermal synthesis is a suitable method
to make barium titanate from 5 g. of titanium
dioxide of 20 g. of barium hydroxide (Ti:Ba equals
1:1) at 90∞C for 72 hrs. Barium titanate powder
obtained is filtered with formic acid during
hydrothermal process to purify. The powder
obtained has monodispersed-nanocrystalline
structure, high density, no aggregation and high
purity.
ACKNOWLEDGEMENTS
The author is grateful to the Faculty of
Engineering, Kasetsart University for the grant
support of this research and L.M.S Instrument
Co.ltd. for analysing the particle size distribution.
Figure 4 Crystalline phase compositions.
(a) X-ray diffraction of barium hydroxide.
(b) X-ray diffraction of titanium dioxide.
(c) X-ray diffraction of the mixture of titanium
dioxide and barium hydroxide at a ratio of
5:20 at 90∞C for 72 hrs.
Kasetsart J. (Nat. Sci.) 37 (1) 121
LITERATURE CITED
Eckert J.O.Jr., C.C. Hung-Houston, B.L. Gersten,M.M. Lencka, and R.E. Riman.1996. Kineticsand mechanisms of hydrothermal synthesisof barium titanate. J. Am. Ceram. Soc. 79 :2929-2939.
Hung C.C. and R E. Riman. 1998. X-rayspectroscopy investigation of hydrother maland commercial barium titanate powders. J.Am. Ceram. Soc. 81(6) :1589-1599.
Kingery. W.D., H. K Bowenz. and Uhlann. 1992.Introduction to Ceramics. John Wiley andSons., Inc., New York. 1032 p.
Michael Z.C. Hu. 2000. Wet-chemical synthesisof monodispersed barium titanate particleshydrothermal conversion of TiO2 micro-spheres to nanocrystalline BaTiO3 PowderTechnology 110 : 2-14.
Panne A. D., D J. Eichorst. and L F.Francis.1992.Molecular Precursors for the ChemicalProcessing of Advanced ElectricalCeramics. John Wiley and Sons, Inc., NewYork. 14 p.
Ree W.S.,Jr. and K A. Dippel. 1992. New Group2 Organometallic Precursors to Metal Oxides.,John Wiley and Sons, Inc., New York. 6 p.
William D.C.,Jr. 2002. Introduction of MaterialsScience and Engineering. John Wiley andSons, Inc., New York. 871p.
Percent cumulative of particle size
particle size (micron)
Figure 5 Particle size distribution of barium titanate (hydrothermal synthesis at 90∞C for 72hrs.) by
particle size analyzer.
Figure 6 Particle size distribution of barium
titanate (hydrothermal synthesis at
90∞C, 72 hrs.) by SEM manification
5,000 and 10,000.
NOTICE TO CONTRIBUTORS
The Kasetsart Journal (Natural Science) is published by Kasetsart University Research and
Development Institute (KURDI) under authorization of Kasetsart University to serve the interest of
scientists and researchers. Research articles must be a report of the original work in any aspects of natural
sciences. The Journal emphasizes and promotes the highest standards of ethics in the conduct of reporting
research. Appropriateness is judged by the scientific approach to study the problems related to natural
sciences. The governing operational factor is the general soundness and integrity of science being reported
as judged by peer reviewers and/or the scientific editors. The Journal is published quarterly and is issued
in March, June, September and December.
GENERAL EDITORIAL POLICIES
Authorship criteria and author responsibilitiesKasetsart Journal is proud of its high quality research journals and is dedicated to maintaining
its high level of professionalism. However, because of reports of fraud and plagiarism in the scientific
literature, we remind authors of their obligations when submitting manuscripts for publication.
Authorship criteria. Authorship is restricted to those who (1) have contributed substantially to one or
more of the following aspects of the work (conception, planning, execution, writing, interpretation, and
statistical analysis) and (2) are willing to assume public responsibility for the validity of the work.
Exclusivity of work. The corresponding author must verify, on behalf of all authors (if more than one),
that neither this manuscript nor one with substantially similar content has been published, accepted for
publication, or is being considered for publication elsewhere.
CopyrightCopyright to published manuscripts becomes the sole property of the KURDI. In instances where
the work cannot be copyrighted (works authored solely by government employees as part of their
employment duties), this requirement is waived.
Reproduction of all or a portion of a Kasetsart Journal article by anyone, excluding authors, is
prohibited, unless permission is received from KURDI. Authors have the right to reproduce extracts from
the paper with proper acknowledgment and retain the right to any patentable subject material that might be
contained in the article.
DisclaimerOpinions expressed in articles published in this journal are those of the author(s) and do not
necessarily represent opinions of the KURDI. KURDI does not guarantee the appropriateness for any
purpose, of any method, product, process, or device described or identified in an article. Trade names, when
used, are only for identification and do not constitute endorsement by KURDI.
Criteria for manuscript acceptanceManuscript acceptability is based primarily on appropriateness and importance of the topic;
clarity of objectives; originality; appropriateness of the experimental design, methods and statistical
analysis; depth of the investigation; substance of the results; thoroughness with which the results are
discussed ; and appropriateness of the conclusions.
ReprintsFollowing acceptance of a paper and prior to publication, the author will be given appropriate
number of reprints free of charge.
MANUSCRIPT REQUIREMENTS
Unless otherwise stipulated, the style and format of manuscripts submitted to Kasetsart Journal
(Natural Science) should follow the “Scientific Style and Format: The CBE Manual for Authors, Editors
and Publishers” 1994, 6th ed. (Cambridge University Press, New York). For convenience, refer to articles
in the latest issue of the journal or for more details, contact the Kasetsart Journal editorial office.
Use the English language (American spelling and usage) and the SI system (Système International
d’Unitès, often referred to as “International Units”) for measurements and units.
Manuscripts preparationManuscripts on original research should include the following elements.
Title page, as p. 1. Include:
• Full title (be concise)
• Name(s) of author(s) and author affiliation(s) with complete address(es)
• Contact information for the corresponding author, including full name, complete mailing address,
telephone, fax, and electronic mailing address.
• Previous address of author(s) if research was conducted at a place different from current affiliation.
Abstract, as p. 2. Include:
• An abstract not exceeding 200 words; all acronyms and abbreviations defined; no references cited.
State what, where and how it was done, major results.
• Five key words.
Introduction. In two pages or less, review pertinent work, cite key references, explain importance of
the research, and state objectives of your work.
Materials and Methods. Provide sufficient detail so work can be repeated. Describe new methods in
detail; accepted methods briefly with references. Use subheadings as needed for clarity.
Use of trade names. Trade names are to be avoided in defining products whenever possible. If
naming a product trade name cannot be avoided, the trade names of other like products also should be
mentioned, and first use should be accompanied by the superscript symbol TM followed in parentheses by
the owner’s name. If a product trade name is used, it is imperative that the product be described in sufficient
details so the nature of the product will be understood by professionally trained readers. Do not use trade
names in titles.
Use of abbreviations and acronyms. At first text use, define in parentheses. Do not use
abbreviations and acronyms in titles.
Statistical analysis. If variation within a treatment (coefficient of variation, the standard
deviation divided by the mean) is small (less than 10%) and difference among treatment means is large
(greater than 3 standard deviations), it is not necessary to conduct a statistical analysis. If the data do not
meet these criteria, appropriate statistical analysis must be conducted and reported.
Results. Present results concisely using figures and tables as needed. Do not present the same
information in figures and tables.
Discussion. Discuss principles and relationship, point out exception. Show agreement with published
research work. The significance of the work or conductions should be presented in the end of discussion.
Conclusion. State conclusions (not a summary) briefly.
Literature Cited. List only those references cited in the text. Required format of references is described
below.
Acknowledgments. List sources of financial or material support and the names of individuals whose
contributions were significant but not deserving of authorship. Acknowledgment of an employer’s
permission to publish will not be printed.
Appendix. This section is rarely needed in a research paper but can be added if deemed necessary (e.g.,
complicated calculations, detailed nomenclature).
Tables. Number each table with Arabic numerals. Place a descriptive caption at the top of each table.
Print one table per page. Columns and their headings are usually (but not always) used to display the
dependent variable(s) being presented in the table. Foot-notes should be identified by lower case letters
appearing as superscripts in the body of the table and preceding the footnote below the table.
Figures (graphs, charts, line drawings, photographs). Supply one illustration per page with the figure
number indicated under the illustration. Figure captions should be double-spaced and listed consecutively
on page(s) separate from figures: use Arabic numerals. Include one original set of illustrations with an
original manuscript, marked, “ORIGINAL.” Illustrations for other copies of the manuscript may be
photocopies, provided they are clear. Exceptions are photomicrographs, gel electrophoretic patterns, etc.;
furnish four glossy photographs for each of these.
Authors are responsible for obtaining permission to reproduce previously copyrighted illustrations.
Proof or certification of permission to reproduce is required.
Lettering, data lines, and symbols must be sufficiently large so as to be clearly visible when the figure
is reduced to a size commonly used in the journal. When a color presentation is deemed necessary, please
note this in the cover letter of the submission.
LITERATURE CITED FORMAT
Manuscripts should follow the name-year reference format of the Council of Science Editors
(formerly Council of Biology Editors). Cite only necessary publications. Primary rather than secondary
references should be cited, when possible. It is acceptable to cite work that is “in press” (i.e., accepted but
not yet published) with the pertinent year and volume number of the reference. Work that is “submitted”
but not yet accepted should not be cited.
In text. Cite publications in text with author name and year. Three or more authors use “et al.”
In parenthetical citations, separate author and year with a comma. Use suffixes a, b and c to separate
publications in same year by the same author. Semi-colons separate citations of different authors. Cite two
or more publications of different authors in chronological sequence, from earliest to latest. For example:
• The starch granules are normally elongated in the milk stage (Brown, 1956).
• Smith et al. (1994) reported growth on vinasse.
• …and work (Dawson and Briggs, 1984,1987) has shown that . . .
• …and work (Dawson, 1984; Briggs, 1999) has shown that . . .
In Literature Cited section. List only those literature cited in the text. References should be
listed alphabetically by the first author’s last name. Single author precedes same author with co-authors.
Type references flush left as separate paragraphs. Do not indent manually. Write the names of book and
journal in bold letters. Let the text wrap with first line hanging indented. Use the following format.
• Journal articles: Author(s). Year. Article title. Journal title, volume number: inclusive pages.
Example: Citation in text: (Smith et al., 1999)
Smith J.B., L.B. Jones and K.R. Rackly. 1999. Maillard browning in apples. J. Food Sci. 64 : 512-518.
• Books: Author(s) or editor(s). Year. Title. Publisher name. Place of publication. Number of pages.
Example: Citation in text: (Spally and Morgan, 1989)
Spally M.R. and S.S. Morgan. 1989. Methods of Food Analysis. 2nd ed. Elsevier. New York. 682 p.
• Chapter: Author(s) of the chapter. Year. Title of the chapter, pages of the chapter. In author(s) or editor(s).
Title of the book. Publisher. Place of publication.
Example: Citation in text: (Rich and Ellis, 1998)
Rich R.Q. and M.T. Ellis 1998. Lipid oxidation in fish muscle, pp. 832-855. In J.J. Moody and W. Lasky,
(eds.). Lipid Oxidation in Food. 6th ed. Pergamon. New York.
For journal abbreviations and other examples of reference formats please refer to articles in a
2000 issue of this journal or contact the editorial office at KURDI.
EDITORIAL REVIEW AND PROCESSING
Peer Review. All submitted manuscripts are screened by the Scientific Editor for importance,
substance, appropriateness for the journal, general scientific quality, and amount of new information
provided. Those failing to meet current standards are rejected without further review. Those meetings these
initial standards are sent to expert referees for peer review. Referees identities are not disclosed to the author.
Author identities are also not disclosed to the referees. Referee comments are reviewed by an Associate
Editor and he/she, often after allowing the author to make changes in response to the referee’s comments,
advises the Scientific Editor to either accept or reject the manuscript. The Scientific Editor informs the
author of the final decision. The review process ordinarily is completed within 3 months. If the process is
delayed beyond that point, authors will be notified.
Rejected manuscripts. Rejected manuscripts may, in some instances, be appropriate for
publication in other journals. Rejected manuscripts including original illustrations and photographs will be
returned to authors.
Accepted manuscripts. The author(s) will be asked to review a copyedited pageproof. The
author(s) is responsible for all statements appearing in the galley proofs. The author will be informed of the
estimated date of publication.
Inquiries regarding status of the manuscript. Direct inquiries to: Orawan Wongwanich,
Manager, Kasetsart University Research and Development Institute (KURDI), Kasetsart University, 50
Pahonyothin Road, Chatuchak, Bangkok 10900, Tel. 66-2-579-0032, 579-5548, 561-1474, Fax. 66-2-
561-1474, E-mail: rdi@nontri.ku.ac.th.
SUBMISSION MANUSCRIPT
Submit the following items.
Cover letter. Identify the corresponding author and provide his/her full name, address, numbers
for telephone and fax, and e-mail address.
Manuscript. Double-space all components of the manuscript except tables. In 12 point Times
or Times New Roman.Type on one side of A4 paper. Use one inch margins. Number all pages.
Send an original manuscript (with original figures, marked “ORIGINAL”) and 3 photocopies.
Hard copies are required. Staple each manuscript copy, including the original manuscript in the upper left
corner. Include no paper clips or binders.
Disk. Include an IBM-formatted, 3-l/2" disk, containing the manuscript in Microsoft Word
(version 97 preferred).
MAIL MANUSCRIPT TO:
Orawan Wongwanich, Manager,
Kasetsart University Research and Development Institute (KURDI)
Kasetsart University,
50 Pahonyothin Road, Chatuchak,
Bangkok 10900, Thailand
Tel. 66-2-579-0032, 579-5548, 561-1474
Fax. 66-2-561-1474
E-mail: rdi@nontri.ku.ac.th
PRE-SUBMISSION CHECKLIST
(see “Instructions for Authors” for additional information.)
Cover letter & form❑ Full contact information for the corresponding author (full name, address, phone,
fax, e-mail).
Manuscript❑ Original manuscript (with original figures, marked ORIGINAL)
❑ Three photocopies
❑ Page numbering
❑ Each manuscript stapled in upper left corner (no paper clips or binders)
❑ Abstract of less than 200 words
❑ 5 key words
❑ Figure captions listed consecutively on a page separate from figures
DISK❑ 3-l/2 in IBM-formatted disk with full manuscript Microsoft Word (version 97 preferred) file.
(submission of the title page and abstract by electronic means is an acceptable alternative)
Kasetsart Journal
Application for Membership
Name : _________________________________________________________________________
Title : _________________________________________________________________________
Home Address : __________________________________________________________________
Tel : ___________________________________ Fax : ______________________________
Office Address : __________________________________________________________________
Tel : ___________________________________ Fax : ______________________________
E-mail Address : __________________________________________________________________
Type of application : � New Membership
� Membership Extension
Membership type : � Regular (non › government) Membership
� Student Membership
Submission information :
Student membership (Natural Science)
� Application and 60 bahts dues payment
� Letter of Recommendation from major advisor or the copy of student ID
Student membership (Social Science)
� Application and 40 bahts dues payment
� Letter of Recommendation from major advisor or the copy of student ID
Regular membership (Natural Science)
� Application and 120 bahts dues payment
Regular membership (Social Science)
� Application and 80 bahts dues payment
Send application materials to
Manager of KU Journal
KURDI Kasetsart University
50 Paholyothin, Bangkhen Bangkok 10900
Payment information :
� Cash
� Send money order made payable to KURDI , Kasetsart Post Office
Preferred address for mail
� Home
� Office
Do Not Write In This Space
For Office Use Only
Membership Number ______________________
Receipt Number __________________________ Receipt Date ________________________
___________________________ Finance Officer
( __________________________ )
Date ___________________________
Letter of Recommendation
This is to certify that _______________________________________________________
is currently the ____________________________ (first - , second -, third -, fourth › year, graduate)
student majoring _________________________ , Faculty of _____________________________
, ______________________________University.
( __________________________________)
Academic Title ______________________
Major Advisor
Date _______________________________
top related