kivetÍtŐs ÉbresztŐÓra_75878_hu_cs_sk
Post on 25-Nov-2015
8 Views
Preview:
DESCRIPTION
TRANSCRIPT
-
IAN 75878 IAN 75878
PROJECTION ALARM CLOCKOperating instructions
BUDK S PROJEKC ASUNvod k obsluze
KIVETTS BRESZTRAHasznlati utasts
PROJEKTIONSWECKERBedienungsanleitung
PROJEKN BUDKNvod na obsluhu
GB Operating instructions Page 1HU Hasznlati utasts Oldal 13CZ Nvod k obsluze Strana 27SK Nvod na obsluhu Strana 39DE / AT / CH Bedienungsanleitung Seite 51
Before reading, unfold the page containing the illustrations and familiarise yourself with all functions of the device.
Olvass eltt kattintson az brt tartalmaz oldalra s vgezetl ismerje meg a kszlk mindegyik funkcijt.
Ped tenm si otevete stranu s obrzky a potom se seznamte se vemi funkcemi pstroje.
Pred tanm si odklopte stranu s obrzkami a potom sa oboznmte so vetkmi funkciami prstroja.
Klappen Sie vor dem Lesen die Seite mit den Abbildungen aus und machen Sie sich anschlieend mit allen Funktionen des Gertes vertraut.
PROJECTION ALARM CLOCK SPU 900 A1KOMPERNASS GmbHBurgstrae 21 D-44867 Bochumwww.kompernass.com
Last Information Update Stav informci Informcik llsa Stand der Informationen Stav informac: 05 / 2012 Ident.-No.: SPU 900 A1042012-4
CV_SPU 900 A1 - TOZ-75878.indd 4 13.06.2012 13:47:39
-
SPU 900 A1
CV_SPU 900 A1 - TOZ-75878.indd 9 19.04.2012 13:25:44
-
- 1 -
INDEX PAGE
Intended Use 2
Items supplied 2
Technical Data 2
Safety information 2
The appliance components 4
Putting the appliance into use 5
Radio operation 9
Cleaning 11
Troubleshooting 11
Notice regarding conformity 11
Importer 11
Disposal 12
Warranty & Service 12
Read the operating instructions carefully before using the appliance for the first time and pre-serve this booklet for later reference. Pass this booklet on to whoever might acquire the appli-ance at a future date.
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 1 11.06.2012 11:22:53
-
- 2 -
ProjectionAlarmClockSPU900A1
IntroductionCongratulations on the purchase of your new appliance.You have clearly decided in favour of a qual-ity product. These operating instructions are a part of this product. They contain important information in regard to safety, use and dis-posal. Before using the product, familiarise yourself with all of these operating and safety instructions. Use the product only as described and only for the specified areas of applica-tion. Retain these instructions for future refer-ence. In addition, pass these documents on, together with the product, to any future owner.CopyrightThis documentation is copyright protected. All rights including those of photographic reproduction, duplication and distribution by means of particular methods (for example data processing, data carriers and data net-works), wholly or partially as well as substan-tive and technical changes are reserved.
IntendedUseThis radio alarm is intended for displaying the time and for the reception of VHF and MW radio programmes. Additionally, the ap-pliance is fitted with an alarm function using either radio or a signal tone.This radio alarm is not intended for use in commercial or industrial applications. No warranty is provided for damages resulting from improper use of the appliance!
Itemssupplied1 Projection Alarm Clock SPU 900 A11 Operating manual
TechnicalData
Power supply: 220-240 V~, 50 HzPower consumption
in radio operation: 5 Watt Standby: 1.2 Watt Output level: 2 x 450 mW bei 10% THD Frequency range : VHF (FM) 87.5 108 MHz MW (AM) 526.5 1606.5 kHz Operating temperature: + 5 +35 C Storage temperature : -20 +50 C Humidity: 5 90 % (No condensation)
Dimensions (W x H x D): 21 x 7 x 14.1 cm Weight : 870 g approx. Protection class: II / Backup Batteries 2 x 1.5 V, Type AAA/
Micro (not supplied)
Safetyinformation
WarningA warning of this danger level signifies a pos-sible dangerous situation. If the dangerous situation is not avoided it can lead to injuries. Follow the directives in this warning notice, so as to avoid personal injuries.
ImportantA warning of this danger level signifies pos-sible property damage. If the situation is not avoided it can lead to property damage. The directives in this warning are there to avoid property damage.
NoticeA notice signifies additional information that assists in the handling of the appliance.
Warning: Risk of electric shocks. Connect the appliance only to correctly
installed and earthed mains power sock-
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 2 11.06.2012 11:22:55
-
- 3 -
ets. Ensure that the rating of the local power supply tallies completely with the details given on the rating plate of the appliance.
Arrange for Customer Services to repair or replace connecting cables and/or appliances that are not functioning prop-erly or have been damaged.
Keep the power cable and appliance away from children. Children frequently underestimate the dangers of electrical appliances.
NEVER submerse the appliance in water. Wipe it only with a slightly damp cloth.
Do not expose the appliance to rain and never use it in a humid or wet environ-ment.
Always take hold of the power cable by the plug. Do not pull on the cable itself and never touch the power cable with wet hands, this could result in either a short circuit or you receiving an electric shock.
Do NOT place the appliance itself, furniture items or similar objects on the power cable and take steps to ensure it cannot become jammed or trapped in any way.
Make sure that the power cable does not become wet during operation.
You are not permitted to open the ap-pliance housing or to repair or modify the appliance. If the housing is opened or irregular modifications are made, you run the risk of receiving a potentially fatal electric shock and the warranty lapses.
Protect the appliance against drip and spray water. Do not place any water-filled vessels (e.g. flower vases) on or near the appliance.
Check the appliance and all parts for visible damages. The safety concept can work only if the appliance is in a faultless condition.
Always remove the power plug before cleaning the appliance.
Warning: Injury hazard! NEVER make a knot in the power cable
and do NOT bind it together with other cables. The power cable must be laid so that co one can step on or trip over it.
The power plug must always be easily accessible, so that in the event of an emergency the appliance can be quickly disconnected from the mains power sup-ply.
This appliance is not intended for use by individuals (including children) with restricted physical, physiological or intel-lectual abilities or deficiences in experi-ence and/or knowledge unless they are supervised by a person responsible for their safety or receive from this person instruction in how the appliance is to be used. Children should be supervised to ensure that they do not play with the ap-pliance.
Provide a stable location for the ap-pliance.
Do not operate the appliance if it has sustained a fall or is damaged. Arrange for the appliance to be checked and, if necessary, repaired by qualified tech-nicians.
Keep batteries well away from children. Children could put batteries into their mouths and swallow them.
If a battery is swallowed, seek medical assistance IMMEDIATELY.
Warning: Explosion hazard! Do not throw batteries into a fire.
Do not recharge the batteries. Never open batteries, never solder or
weld batteries. The risk of explosions and injuries exists!
Warning: Risk of fire! Do not use the appliance near hot sur-
faces. Do not place the appliance in locations
that are subject to direct sunlight. If you
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 3 11.06.2012 11:22:55
-
- 4 -
do, it may overheat and become irrepa-rably damaged.
Never cover the ventilation slots of the appliance while it is switched on.
Do not place open fire sources, such as candles, on or near the appliance.
Caution with thunderstorms! Equipment connected to a power supply
can be damaged during a thunderstorm. You should therefore always pull the power plug from the power socket when there is a storm.
Warnings about interaction with batteriesThe appliance uses batteries for memory storage. When handling batteries, please observe the following:
If you do not intend to use the appliance for an extended period, remove the batteries.
Regularly check the condition of the bat-teries. Leaking batteries can cause dam-age to the appliance.
Should the batteries leak, put on a pair of protective gloves and clean the bat-tery compartment and terminals with a dry cloth.
Caution!Never subject the batteries to excessive heat (i.e. bright sunlight, fire, etc.).
Attention!There is a risk of explosion if the batteries are improperly replaced. Only replace with the same or equivalent types.
Notice regarding separation from mains-powerThe button on this appliance does not completely disconnect it from the mains power network. Additionally, the appli-ance consumes power when in standby-mode. To completely separate the appli-
ance from mains power, the plug MUST be removed from the wall socket.
Notice regarding electrical power surges (EFT / electrical fast transient) and electrostatic discharges:In a case of malfunction due to an elec-trical fast transient (power surge) and/or electrostatic discharge, the appliance must be returned to default settings in order to re-establish normal operation. This could mean that it must be discon-nected from the power supply and then reconnected. The batteries (if present) must be removed and then reinserted.
NoticeNo liability/warranty claims will be con-sidered for damage to the appliance caused by the effects of moisture, water penetration, overheating or due to un-authorised modifications!
Theappliancecomponentsq VOL - Volume decreasew VOL + - Volume increasee MODE/LOCK - Recalls the adjustable
parameters/Button lockr Loudspeakert Projektor - projects the time onto
a wally SNOOZE/ - Snooze button,/
DIMMER Brightness switchu BAND - Switches the radio wave-
bandi DOWN - Selector button down-
wardso UP - Selector button up-
wardsa PROJECTION - Time projection on/off
switchs PRESET/ALARM + - Radio station/alarm
memory upwards/d PRESET/ALARM - Radio station/alarm
memory downwards
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 4 11.06.2012 11:22:55
-
- 5 -
f PAGE/AL.SET - switches the memory sides/calls up the alarm function
g Display - Indicatorh A.M.S. MEMORY - Autom. radio station
savej SLEEP - Controls the switch-off
timerk NAP/USER - User switching, Timer
functionl - On/Off switch for
radio functions1( Focus adjuster - for focussing the time
projection2) Wire aerial - for VHF reception2! Power cable2@ Battery
compartment - for the backup batteries
PuttingtheapplianceintouseFirst take all appliance components from the packaging and remove all packing foil and tape. Check the appliance for signs of visble damage.
Inserting the back-up batteriesWith the backup batteries all individual de-vice settings are retained in the event of a power failure. For this you require two 1.5 V batteries of the type AAA/Micro. They are not supplied.
1.Open the lid of the battery compartment 2@ on the underside of the radio alarm.
2. Insert the batteries. Ensure the polarities are correct.
3. Close the lid of the battery compartment 2@. The lid must audibly engage.
Note:The back-up batteries must be checked at least once per year and, if necessary, exchanged for new ones.
Providing mains power Insert the plug into a mains power
socket. In the display g the welcome "PLEASE WAIT FOR SETTING THANKS"
appears. During this period the radio alarm attempts to update its settings for time and date with the help of RDS signals. Should you wish to interrupt this process, press any button. Should the automatic update fail, make the required adjustments manually.
Setting the timeTo programme in the time and the follow-ing parameters, radio operation must be switched off. If a button is not pressed within approx. 15 seconds, the appliance saves the adjustment and then leaves the programming mode.
1.Press theMODE/LOCK button e. The time display blinks.
2. Press the buttons DOWN/UP i/o to set the time at minute intervals. Pressing and holding down one of button changes the time in quick succession.
Setting the date1.Press the MODE/LOCK button e once
again. In the display g the date indica-tion "01.01.2013 blinks.
2. Press the buttons DOWN/UP i/o to set the date in day intervals. Pressing and holding one of the buttons changes the date in a fast sequence.
Programme City1.Press the MODE/LOCK button e once
again. In the display g the indicator for the city sign blinks below the "LOCAL CITY display.
2. Press the buttons DOWN/UP i/o to programme in the time zone for a city resp. your general place of residence. Pressing and holding one of the buttons changes the indicator faster. Here is an overview of the programmable cities and the time differences:Abbr. Diff. CityHNL -10 Honolulu / USAANC -9 Anchorage / USAYVR -8 Vancouver / Canada
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 5 11.06.2012 11:22:55
-
- 6 -
Abbr. Diff. CityLAX -8 Los Angeles / USADEN -7 Denver / USACHI -6 Chicago / USAMEX -6 Mexico City / MexicoNYC -5 New York / USAYYZ -5 Toronto / CanadaYUL -5 Montreal / CanadaCCS -4 Caracas / VenezuelaRIO -3 Rio De Janeiro / BrazilBUE -3 Buenos Aires /ArgentinaUTC 0 Universal Time
CoordinatedLON 0 London / UKBER +1 Berlin / GermanyPAR +1 Paris / FranceROM +1 Rome / ItalyCAI +2 Cairo / EgyptIST +2 Istanbul / TurkeyMOW +3 Moscow / RussiaKWI +3 Kuwait City / KuwaitDXB +4 Dubai / Saudi ArabiaKHI +5 Karachi / PakistanDAC +6 Dacca / BangladeshBKK +7 Bangkok / ThailandSIN +8 SingaporeHKG +8 Hong KongPEK +8 Beijing / ChinaSHA +8 Shanghai / ChinaTYO +9 Tokyo / JapanSYD +10 Sydney / AustraliaNOU +11 Noumea /
New CaledoniaAKL +12 Auckland /
New Zealand3. Press the button SNOOZE/DIMMER y
to switch the daylight saving time for the selected time zone either on or off. The display g indicates SUM ON resp. SUM OFF accordingly.
Programme World Time1.Press the MODE/LOCK button e once
again. In the display g the indicator for the city signs blinks below the "WORLD CITY display.
2. Press the buttons DOWN/UP i/o to set the desired world time. Pressing and holding one of the buttons changes the indicator faster. Also here, the above list-ing of programmable cities and their time difference is valid.
3. Repeatedly press the SNOOZE/DIMMER button y to adjust for a summer time off-set in the selected world time.
Time offset Display Explanation
1 OFFSET 1 In your time zone (local city) it is winter time and in the adjusted world time it is currently summer time.
0 OFFSET 0 In your time zone (local city) and in the adjusted world time it is currently winter time resp. summer time.
-1 OFFSET -1
In your time zone (local city) it is summer time and in the adjusted world time it is currently winter time resp. they have no summer time.
Programme the reminder functionYou can programme in up to 10 dates on which the appliance can give you a reminder when they arrive.
1. Press the MODE/LOCK button e once again. In the display g a date and the SDA 1 indicator for the memory date 1 blinks.
2. Press the buttons DOWN/UP i/o to programme in the first desired memory date. Pressing and holding one of the but-tons changes the indicator faster.
3. If you press the SNOOZE/DIMMER but-ton y, the year number will be deactivat-ed and you will thus receive a reminder on this date every year.
4. Should you wish to programme in further dates, press the PAGE/AL.SET button f to select a memory slot from 2-10.
5. Proceed as above with further dates.
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 6 11.06.2012 11:22:55
-
- 7 -
6. To deactivate the memory function, pro-gramme in a date that lies in the past.
Programme the Update functionWith this function the appliance can automat-ically up-date the time by using RDS-Data.
1.Press the MODE/LOCK button e once again. The display g indicates "UPDATE ON".
2. Press the button DOWN i to deactivate the up-date function. The display g then shows "UPDATE OFF".
3. Press the button UP o to reactivate the up-date function.
Programme time for the slumber function1. Press the MODE/LOCK button e once
again. The display g indicates "SNOOZE 09".
2. Press the DOWN/UP i/o button to set the desired time frame for the sleep func-tion between 1 and 59 minutes.
Selecting 12 or 24 hour time display1. Press the MODE/LOCK button e once
again. The display g indicates "24HR.2.Press the button DOWN i to select the
12 hour modus. In the display g appears "12HR".
3.Press the button UP o to return to the 24 hour modus.
Adjusting the projection duration1. Press the MODE/LOCK button e once
again. The display g indicates "PROJ-T OFF".
2.Press the buttons DOWN/UP i/o to adjust the projection duration to between 01 and 59 minutes. When set to OFF the projection lights up permanently and can be switched on or off by pressing the PROJECTION button a.
Projection with the alarm1. Press the button MODE/LOCK e once
more. The display g indicates PROJ-AL OFF.
2. Press the UP button o when the projection is to be switched on automatically during an alarm.
3. Press the DOWN button i to deactivate this function.
Automatic Display Dimmer1. Press the button MODE/LOCK e once
more. The display g indicates DIM-T OFF.2. Press the UP button o if the display is to
be automatically dimmed at specified times. The display g then indicates DIM-T ON.
3. Press the DOWN button i to deactivate this function.
Setting the Display-Dimmer Time 1. Press the button MODE/LOCK e once
more. The display g shows DT 23:00 ON as the time at which the display is to be automatically dimmed.
2. Press the buttons DOWN / UP i/o to set a different time.
3. Press the button MODE/LOCK e once more. The display g shows DT 6:00 OFF as the time at which the display is to return to its normal brightness.
4. Press the buttons DOWN/UP i/o to set a different time.
Press the MODE/LOCK button eonce again to close adjustment.Timer function1.Press the button NAP/USER k. In the dis-
play g the NAP indicator appears and the time indicator 010 blinks.
2. Using the buttons DOWN/UP i/o set the desired time interval (a time span between 1 minute and 23:59 h is possible).
3.Press the button NAP/USER k once again to start the Timer. In the display g the remaining time is indicated.
4. Should the time be expired, the timer signal will sound for about 10 minutes, the NAP indicator flashes and the time is displayed.
5. Press any button to end the alarm.
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 7 11.06.2012 11:22:55
-
- 8 -
6. If you wish to end the Timer function before the alarm, press and hold the button NAP/USER k for one second.
Alarm function (Alarm 1 to 4)You can programme in up to four alarm times on your radio alarm. If a button is not pressed within approx. 15 seconds, the ap-pliance saves the adjustment and then leaves the programming mode.
1. With the radio switched off, press the PAGE/AL.SET button f to call up the alarm function. Using the PRESET/ALARM +/ buttons s/d, select the desired alarm memory position. In the display g the last set alarm time and the symbol for the type of alarm (radio or signal tone) blinks.
2. Press the buttons DOWN/UP i/o to set the desired alarm time. Pressing and hold-ing down one of the buttons DOWN/UP i/o changes the alarm time in quick suc-cession.
3.Press the button PAGE/AL.SET f until the desired alarm function (see table) is indi-cated in the display g.Alarm function Symbol in the
display gAcoustic signal
Radio
Switched off no symbol
4.Press the button SNOOZE/DIMMER y to set the weekdays on which you require the alarm function: You can choose be-tween workdays (MON, TUE, WED, THU, FRI), weekends (SAT, SUN) and every day (MON, TUE, WED, THU, FRI, SAT, SUN).
5.Hold the button SNOOZE/DIMMER y pressed down for 2 seconds when you want to be woken on a specific weekday. To programme this weekday, repeatedly press the SNOOZE/DIMMER button y.
Orientate yourself on the weekday indica-tor at the top right in the display: MON: = Monday TUE = Tuesday WED = Wednesday THU = Thursday FRI = Friday SAT = Saturday SUN = Sunday
6. To return to the selection of workdays, weekends or whole weeks, once again hold the SNOOZE/DIMMER button y pressed down for 2 seconds.
7.After approx. 15 seconds the display g returns to time indication. The adjustment for the alarm function is now saved and will be shown.
8. If needed, programme the other memory positions for alarm times as detailed above.
9. If you wish to be woken by the radio func- tion, switch the radio on now and select the desired radio station. Then adjust the sound volume to the maximum to be achieved during the alarm procedure. The radio function is explained on the following pages.
When the alarm signal sounds... ... and the alarm function "Radio" is se-
lected, the radio switches itself on with increasing sound volume and the last adjusted radio station for one hour.
... and the selected alarm function is sig-nal tone, the signal tone sounds with an increasing volume for 10 minutes.
To close the individual alarm function press any button except the SNOOZE/DIMMER button y.
The Slumber functionWhen you press the SNOOZE/DIMMER but-ton y, the presently active alarm is cancelled for the time that is programmed for this func-tion (see Section "Programme time for the slumber function, 1 - 59 min., standard value = 9 min.). Meanwhile the SNZ indicator
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 8 11.06.2012 11:22:56
-
- 9 -
glows in the display g. To permanently stop an interrupted alarm, briefly press the PAGE/AL.SET button f.
The Reminder functionThe appliance will remind you of the dates that you have programmed in with the re-minder function. In these cases and on these days, from 08:00 - 23:00 and on every full hour, the reminder alarm will sound for 10 minutes. Additionally, the SDA indicator blinks in the display g. Press any button to end the reminder alarm.
Adjusting changing display indicatorsWhen the appliance is in Standby, press the button DOWN i. In the display appears "D" (for Time and Date). Press the button DOWN i once again, "W" appears in the display (for Time and World Time). Press the button DOWN i once again, "DW" appears in the display (for Time, Date and World Time in rotation). Press the button DOWN i once again, "" appears in the display (only Time).
RadiooperationThe technical data of the appliance makes possible an adjustable frequency range wider than the permitted frequency ranges of 87,5 - 108 MHz resp. 526,5 - 1606,5 kHz. In some countries, different national regulations may apply to the assigned radio frequency ranges. Please note that information received outside of the assigned radio frequency ranges may not be used, passed on to third parties or otherwise misused. For VHF radio reception, completely unwind the wire aeriel 2) and, with the radio switched on, determine the most fa-vourable positioning for it. The appliance has a built-in aerial for MW reception. To improve MW reception, if required, turn the radio until it is in the most favourable position.
Switching the radio on and off1.Press the button l. In the display g
the current frequency and the switch-on
symbol is indicated. Next to it, the clock symbol blinks and thus indicates that the device is waiting for the reception of the current time from an RDS station.
2.Press the button lonce again to switch the radio function off and return the appliance to the standby mode.
Manual station selection1.Use the waveband select button u to
select the required reception waveband, MW (AM) or VHF (FM).
2.Press the button UP o to search for radio stations with a frequency higher than the one indicated in the display.
3. Press the button DOWN i to search for radio stations with a frequency lower than the one indicated in the display.
4. If the found radio station transmits RDS-Data, the indicator in the dis-play g glows. The display g indicates the name of the radio station and the time is updated (insofar as this adjustment is activated, see the section "Programme the Update function").
Automatic station searchYou can also let the appliance search for radio stations. The radio alarm then searches the selected frequency range until it has found a radio station.
1.Press and hold the button UP o for two seconds: The radio alarm searches for the station with the next highest frequency.
2.Press and hold the button DOWN i for two seconds: The radio alarm searches for the station with the next lowest fre-quency.
Repeat these steps until you have found a radio station to your liking.
Programming stationsFor each of 2 users you can save 20 VHF sta-tions and 12 MW stations as favourites in the appliance. These memory slots are spread over several pages, which can be called up via the PAGE/AL.SET button f. On each
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 9 11.06.2012 11:22:56
-
- 10 -
page there are 4 Sender slots, they can be addressed with the PRESET/ALARM +/-but-tons s/d.
1.With the radio switched on, press the PAGE/AL.SET button f to call up the desired memory page 1-5. In the display g the number of the just selected memory page appears below "PAGE".
2. Tune in to the desired station.3.Briefly press the button A.M.S. MEMORY h. In the display g the number and the memory slot indicator "MEM" blink.
4. Now, using the PRESET/ALARM +/ but-tons s/d, select the place at which the radio station is to be saved. Confirm it with the A.M.S. MEMORY button h. The radio station is now saved and will be permanently indicated.
5.As the appliance can be used by several people, it is equipped with user switching. Both users can thus save different radio stations as favourites. To switch over to the individual user, press and hold the NAP|USER button k for two seconds. The currently active user, A or B, is indicated on the display g.
6. Repeat the steps 1 - 4 (for both users) until all desired radio stations have been saved.
AMS (Automatic Memory System)With the AMS function the radio searches au-tomatically for radio stations and then saves them to the memory positions.
Press and hold the button A.M.S. MEM-ORY h for two seconds. The radio alarm automatically searches for sufficiently powerful radio stations and saves them in the memory.
Accessing the station1. To recall a saved radio station, in Radio
mode first select the desired user.2.Now select the required memory page
with the PAGE/AL.SET button f.3. Using the PRESET/ALARM +/- button s/d, select the desired memory space for the radio station.
Adjusting the volume. In radio modus, repeatedly press the but-
ton VOL q to reduce the sound volume. To the right in the display g the current sound volume setting is indicated in steps from V 0 - 18.
Repeatedly press the button Vol. + w to increase the sound volume.
Switch-off TimerThis appliance is fitted with a switch-off timer for up to 90 minutes.
1.Press the button SLEEP j to call the func-tion up and, if need be, to switch the ra-dio on.
2.Repeatedly press the button SLEEP j to enter in the remaining playing time in steps of 10 minutes. After a few seconds, the frequency is indicated once again.
3. In the display g the Sleep indicator ap-pears .
4.At any time you can press the SLEEP button j to blend in the remaining countdown time for a few seconds.
5. On expiry of the time period the ap-pliance switches itself off.
6.To switch the timer off prematurely, press the l button.
Switching and dimming the displayYou can adjust the display brightness by pressing the SNOOZE / DIMMER button y to one of three settings: bright, medium, off. The higher the brightness, the greater is the power consumption of the device.When you briefly press the MODE/LOCK button e during radio operation, you can toggle between frequency and time display.
ProjectionThe time can be projected from the appliance onto a wall or the ceiling. This function is in-tended for reading the time in darkness. During the day in well lit rooms you will hardly be able to use the projection facility. When projection is switched on, the projection symbol glows in the display g.
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 10 11.06.2012 11:22:56
-
- 11 -
1.For this, first fold the projector t out.2.Switch the function on with the PROJEC-
TION button a.3.Direct the projector t onto the desired
surface area. Before you can turn the pro-jector t - if so desired - to the side, you must carefully pull its base up from the device housing.
4.Using the focus regulator 1( sharpen the image.
5. The time will now be projected onto the desired surface area for the pre-adjusted timespan (see section "Adjusting the Pro-jection duration").
6. To display the projection back to front, press and hold the button PROJECTION afor one second. Pressing and holding it once again lets the projection appear as normal.
7. Should you wish to switch this function off prematurely, press the PROJECTION but-ton a and fold the Projector t in.
Button lockPress and hold the MODE/LOCK button e until the key symbol is indicated in the dis- play g. The normal key functions are now blocked. The buttons retain, however, the function Alarm stop. In addition, the button SNOOZE/DIMMER y as the snooze button and for setting the display brightness. To dis-able the button lock function, press and hold the MODE/LOCK button e once again until the key symbol extinguishes.
Cleaning
Warning!Always remove the mains power plug before cleaning the appliance! Moisture penetrating into the appliance creates the risk of electric shock! Additionally, the appliance could become irreparably damaged!
Clean the housing of the radio alarm only with a slightly moist cloth and a mild deter-
gent. Ensure that moisture cannot permeate into the appliance during cleaning!
Troubleshooting
The appliance doesn't work. > Is the plug of the power cable 2! inserted firmly into the power socket?
> Has the circuit breaker tripped? > Is there a power cut?
Poor VHF reception. > Change the alignment of the wire aerial 2). If necessary, firmly position it with adhesive tape.
Poor MW reception. > Change the alignment of the appliance.
Loss of all programming after a power cut.
> Batteries were not inserted to retain the memory.
> The batteries inserted for memory reten-tion are exhausted. Replace them.
The projected time is difficult to read. > Using the focus regulator 1( sharpen the image.
NoticeregardingconformityThis appliance has been tested against, and found to be in compliance with, the funda-mental requirements and other relevant stipu-lations of the EMC Directive 2004/108/EC, as well as the Guidelines of the Low Voltage Directive 2006/95/EC.
ImporterKOMPERNASS GMBH BURGSTRASSE 21 44867 BOCHUM, GERMANY
www.kompernass.com
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 11 11.06.2012 11:22:56
-
- 12 -
DisposalDo not dispose of the appliance in your normal domestic waste. This product is subject to the provisions of European Directive 2002/96/EC.
Disposing of the appliance Arrange for the product, or parts of it, to
be disposed of by a professional disposal company or by your communal waste facility.
Observe the currently applicable regula-tions. In case of doubt, please contact your waste disposal centre.
Disposal of batteries/accumulators Used batteries/rechargeable batteries
may not be disposed of in household waste.
Batteries/rechargeable batteries can contain toxic substances which may damage the environment. Therefore, dispose of the batteries/rechargeable batteries in accordance with statutory regulations.
Every consumer is legally obliged to sur-render batteries/rechargeable batteries to a community collection centre in their district or to a dealer. The purpose of this obligation is to ensure that batteries are disposed of in a non-polluting man-ner.
Only dispose of batteries when they are fully discharged.
Disposal of packagingDispose of the packaging materials in an environmentally responsible manner.
Warranty&ServiceYou receive a 3-year warranty for this appli-ance as of the purchase date. This appliance has been manufactured with care and meticu-lously examined before delivery.
Please retain your receipt as proof of pur-chase. In the case of a warranty claim, please make contact by telephone with our service department. Only in this way can a post-free despatch for your goods be assured.
The warranty covers only claims for material and manufacturing defects, but not for trans-port damage, wearing parts or for damage to fragile components, e.g. buttons or batteries.
This product is for private use only and is not intended for commercial use. The warranty is void in the case of abusive and improper handling, use of force and internal modifica-tions not carried out by our authorized Serv-ice Centre.
Your statutory rights are not restricted in any way by this warranty.
The warranty period is not extended through repairs made under warranty. This applies also for replaced or repaired parts. Any damages or deficiencies found on purchase must be reported as soon as possible after unpacking, at the latest two days after pur-chase. On expiry of the warranty, all repairs carried out are subject to payment.
Service Great BritainTel.: 0871 5000 720 ( 0.10/Min.) E-Mail: kompernass@lidl.co.uk
IAN 75878
Service IrelandTel.: 1890 930 034 (0,08 EUR/Min., (peak)) (0,06 EUR/Min., (off peak)) E-Mail: kompernass@lidl.ie
IAN 75878
BDA_SPU 900 A1 - TOZ-75878_4_en.indd 12 11.06.2012 11:22:58
-
- 13 -
TARTALOMJEGYZK OLDAL
Rendeltetsszer hasznlat 14
Tartozkok 14
Technikai adatok 14
Biztonsgi utasts 14
A kszlk rszei 16
A kszlk zembehelyezse 17
Rdi zemmd 21
Tisztts 23
Hibaelhrts 23
A megfelelsgre vonatkoz tudnivalk 24
Gyrtja 24
Garancia s szerviz 24
Az els hasznlat eltt figyelmesen olvassa el a hasznlati utastst majd ksbbi hasznlatra tegye el. A kszlk harmadik fl rszre trtn tovbbadsakor adja t a lerst is.
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 13 11.06.2012 11:23:17
-
- 14 -
Kivetts bresztra SPU 900 A1
BevezetsGratullunk j kszlke megvsrlshoz.Vsrlsval kivl minsg termk mel-lett dnttt. A hasznlati tmutat a termk rsze. Fontos tudnivalkat tartalmaz a biz-tonsgra, hasznlatra s rtalmatlantsra vonatkozlag. A termk hasznlata eltt ismerkedjen meg a hasznlati s biztonsgi utastsokkal. Csak a lertak szerint s a megadott clokra hasznlja a termket. rizze meg ezt a lerst. A kszlk har-madik szemlynek trtn tovbbadsakor adja a termkhez valamennyi lerst is.Szerzi jogvdelemEz a dokumentci szerzi jogvdelem alatt ll. Valemennyi jog, a fotomechanikai lejtszsra, sokszorostsra s klneges eljrssal trtn sokszorostsa (pldul adatfeldolgozssal, adathordozval s adathlzattal) vonatkozak is mg rszle-gesen is, valamint a tartalmi s mdostsok joga fenntartva.
Rendeltetsszer hasznlatAz bresztrdi a pontos id kijelzsre s URH, valamint KH rdiadk vtelre val. Ezenkvl a kszlk rdis s hangjelzses breszt funkcival rendelkezik.Az bresztrdi nem alkalmas ipari vagy kereskedelmi hasznlatra. A kszlk nem rendeltetsszer hasznlatbl ered kro-krt nem vllalunk felelssget!
Tartozkok1 Kivetts bresztra SPU 900 A11 Hasznlati utasts
Technikai adatokHlzati csatlakozs: 220240 V~, 50 Hz
Teljestmnyfelvtel rdis zemmdban: 5 W Kszenlti: 1,2 W
Kimeneti teljestmny: 2 x 450 mW 10% THD mellett Frekvencia- tartomny: URH (FM) 87,5 108 MHz KH (AM) 526,5 - 1606,5 kHz zemelsi hmrsklet: + 5 +35C Trolsi hmrsklet: -20 +50 C Nedvessg: 5 90 % (nem kondenzld)
Mretei (szlessg x hosszsg x mlysg): 21 x 7 x 14,1 cm Sly: kb. 870 g Vdettsgi osztly: II/Tartalk elemek: 2 db tartalk 1,5 V,
AAA/mini ceruzaelem tpus (nem tartozik a csomagba)
Biztonsgi utasts
FigyelmeztetsEnnek a veszlyessgi fokozatnak a figyel-meztet jele lehetsges veszlyes helyzetet jell. Srlst okozhat, ha nem tudjuk elkerl-ni ezeket a veszlyes helyzeteket. Tartsa be a hasznlati tmutatban lv figyelmeztet utastsokat, hogy elkerlje a szemlyi krt.
FigyelemEzen veszlyessgi fokozat figyelmeztet utastsa lehetsges anyagi krt jell. Anya-gi krt okozhat, ha nem tudjuk elkerlni eze-ket a veszlyes helyzeteket. Az anyagi kr elkerlse rdekben tartsa be a figyelmez-tet utastsban szerepl felszltst.
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 14 11.06.2012 11:23:18
-
- 15 -
TudnivalTudnival jelli a kiegszt informcikat, melyek megknnytik a kszlk kezelst.
Figyelmeztets:ramtsveszlye!
A kszlket csak elrsszeren be-szerelt s fldelt konnektorba csatla-koztassa. A hlzati feszltsgnek meg kell egyeznie a kszlk tpustbljn megadott feszltsggel.
A nem kifogstalanul mkd vagy srlt csatlakozvezetket ill. kszlket azonnal javttassa vagy cserltesse az gyflszolglattal.
Ne engedjen gyerekeket a csatlakoz vezetk vagy a kszlk kzelbe. A gyermekek gyakran albecslik az elektromos kszlkek ltali veszlyt.
Ne mertse vzbe a kszlket! Csak enyhn nedves kendvel trlje meg.
Soha ne tegye ki a kszlket esnek s ne hasznlja nedves vagy vizes krnyezetben.
A vezetket mindig a csatlakoznl fog-ja meg. Ne a vezetket magt hzza, s ne fogja meg a vezetket nedves kzzel, mivel ez rvidzrlatot vagy elektromos ramtst okozhat.
Se a kszlket, se btordarabokat vagy hasonl trgyakat ne helyezzen a vezetkre s gyeljen arra, hogy ne szoruljon be.
Vigyzzon arra, hogy hasznlat kz-ben a csatlakozvezetk soha ne le-gyen vizes vagy nedves.
Tilos a kszlk burkolatt felnyitni s a kszlket egyedl megjavtani vagy megvltoztatni. Elektromos ramts ve-szlye ll fenn s a garancia rvnyt veszti, ha a burkolat fel van nyitva vagy sajt maga tszereli a kszlket.
Vdje a kszlket a rcseppen vagy rspriccel vztl. Ez okbl ne helyez-zen folyadkkal tlttt trgyat (pl. virg-vzt) a kszlkre vagy mell.
Ellenrizze a kszlket s valamennyi alkatrszt, hogy nincsenek-e rajtuk lt-hat srlsek. A kszlk biztonsgi rendszere csak kifogstalan llapotban mkdik.
Tisztts eltt hzza ki a hlzati csatla-kozt.
Figyelmeztets:Srlsveszly! Ne csomzza ssze a vezetket s ne
ksse ssze ms vezetkekkel. A hlzati kbelt gy fektesse ki, hogy senki ne lp-jen r vagy senki ne bukjon fel benne.
A hlzati csatlakoz mindig knnyen elrhet legyen, hogy vszhelyzetben a kszlket azonnal le lehessen v-lasztani az ramhlzatrl.
A kszlk nem alkalmas arra, hogy olyan szemlyek (idertve a gyer-mekeket is) hasznljk, akiket testi, rzkszervi vagy elmebeli kpessgeik vagy tapasztalatuk s ismeretk hinya megakadlyoznnak abban, hogy biztonsgosan hasznljk a kszlket, kivve, ha a biztonsgukrl gondosko-d felgyelettel vannak, vagy ha eltte felvilgtosottk ket a kszlk hasz-nlatrl. Vigyzni kell a gyermekekre, hogy ne jtsszanak a kszlkkel.
Gondoskodjon rla, hogy szilrdan lljon a kszlk.
Ha a kszlk leesett vagy megsrlt, nem szabad tovbb hasznlni. A kszlket szakkpzett szakemberrel ellenriztesse s adott esetben javtassa meg.
Ne engedje, hogy az elemek gyermek kezbe jussanak. A gyermekek a sz-jukba vehetik az elemeket s lenyelhetik ket.
Ha lenyelnk az elemeket, azonnal orvoshoz kell fordulni!
Figyelmeztets:Robbansveszly!
Ne dobja az elemet a tzbe. Ne tltse fel az elemeket.
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 15 11.06.2012 11:23:19
-
- 16 -
Soha ne nyissa fel az elemeket, ne forrassza s hegessze ket! Ekkor robbans- s balesetveszly alakul ki!
Figyelem:Tzveszly! Soha ne hasznlja a kszlket forr
felletek kzelben. Ne lltsa fel a kszlket olyan helyen,
amely kzvetlen napsugrzsnak van kitve. Msklnben tlhevlhet s hely-rehozhatatlan kr keletkezhet benne.
Soha ne takarja le a kszlk szellz-nylsait zemels kzben.
Ne tegyen nylt tzforrst, pl. gyertyt a kszlkre vagy mell!
Figyelemviharesetn! Zivatar esetn az elektromos h-
lzatra csatlakoztatott kszlkek meghibsodhatnak. Ezrt zivatar ese-tn mindig hzza ki a hlzati dugt a csatlakoz aljzatbl.
FigyelemazelemekkezelsekorA kszlk a ments biztostsra eleme-ket hasznl. Az elemek kezelsre vonat-kozlag az albbiakat kell betartani:
Ha hosszabb ideig nem hasznlja a kszlket, vegye ki belle az elemeket.
Rendszeresen ellenrizze az elemeket. A kifoly elemsav krt okozhat a ksz-lkben.
Ha kifolyna az elem, vegyen fel vd-kesztyt s szraz kendvel tiszttsa meg az elemrekeszt s az elem csatla-kozsait.
Figyelmeztets!Ne tegye ki az elemeket tl nagy hnek (pl. tz napnak, tznek).
Figyelem!Az elem szakszertlen cserje esetn robba-nsveszly ll fenn. Csak ugyanolyan vagy egyenrtk tpusra cserlje ki.
TudnivalahlzatrlvallekapcsolsrlA kszlk gombja nem vlasztja le teljesen a kszlket az ramhl-zatrl. Ezenkvl a kszlk kszenlti zemmdban is ramot vesz fel. Ha a kszlket teljesen le szeretn kapcsolni a hlzatrl, a csatlakozjt ki kell hz-ni a konnektorbl.
Tudnivalkalkfeszltsggelkapcsolatban(EFT/gyorsvillamostranziens)selektrosztatikuskisls:Az elektromos gyors tmeneti folyamatok (lkfeszltsg) ill. az elektrosztatikus ki-sls miatti mkdszavar esetn a term-ket vissza kell helyezni ahhoz, hogy jra megfelelen mkdhessen. Elfordulhat, hogy le kell vlasztani az ramelltst s ismt jbl kell csatlakoztatni. Az eleme-ket (amennyiben vannak benne) ki kell venni s jra vissza kell tenni ket.
TudnivalAz bresztrdiban nedvessg, teht a kszlkbe behatol vz vagy tlhev-ls hatsra bekvetkezett krokrt nem vllalunk felelssget/szavatossgot!
A kszlk rszeiq VOL -hanger cskkentsew VOL+ -hanger nvelsee MODE/LOCK - a bellthat paramte-
reket hvja le/Billentyzr
r Hangszrt Kivett: -kivettiapontosidt
afalray SNOOZE/ -szundi gomb/
DIMMER fnyer tkapcsol u BAND -tkapcsolja a rdisvoti DOWN -kivlaszt gomb lefeleo UP -kivlaszt gomb felfelea PROJECTION - a pontos id kivetts-
nek be- s kikapcsolsa
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 16 11.06.2012 11:23:19
-
- 17 -
s PRESET/ALARM+-lloms/bresztsmemriafelfele/
d PRESET/ALARM-lloms/bresztsme-mrialefele
f PAGE/AL.SET -tkapcsoljaamemria-oldalakat/lehvjaazbresztsifunkcit
g kijelz -kijelzsh A.M.S.MEMORY-automatikus ad mentsj SLEEP - a kikapcsol idztt
szablyozzak NAP/USER - felhasznl tkapcsol-
sa, idzt funkcil - a rdi funkci be- s
kikapcsolsa1( Fkusz
szablyz - az idkivetts fku-szlsa
2) Vezetkes antenna - URH vtelre
2! hlzati kbel2@ Elemtart - a tartalk elemekhez
A kszlk zembehelyezseVegyen ki valamennyi kszlkrszt a cso-magbl s vegye le rluk a csomagolanya-got. Ellenrizze a kszlket, hogy nincsen-e rajta esetleges srls.
A backup elem behelyezseAbackupelemmelramkimaradsesetnvalamennyiegynikszlkbelltsmeg-marad. Ehhez kt 1,5 V-os AAA tpus mini ceruzaelem szksges. Ezek nem tartoznak a csomaghoz.1.Nyissa ki az bresztrdi aljn tallha-
t elemrekesz 2@ fedelt.2. Helyezze bele az elemeket. gyeljen
a megfelel polaritsra.3. Csukja be az elemtart 2@ fedelt. A
fedl hallhatan pattanjon be a helyre.
Tudnival:A backup elemeket vente legalbb egyszer ellenrizni kell s ha szksges, ki kell cserlni ket.
Az ramellts ltrehozsa Dugja a hlzati dugaszt egy konnek-
torba. A kijelzn g a PLEASE WAIT FOR SETTING THANKS dvzls jelenik meg. Ekzben az bresztrdi megprblja az RDS jelek segtsgvel frissteni a pontos idt s dtumot. Ha meg szeretn szaktani ezt a folyama-tot, nyomja meg brmelyik gombot. Ha nem sikerlne az automatikus frissts, kzzel lltsa be a nevezett opcikat.
Id belltsaHa be szeretn lltani a pontos idt s az albbi paramtereket, ki kell kapcsolni a rids zemmdot. Ha kb. 15 msodpercen bell nem nyomja meg egyik gombot sem, a kszlk lementi a belltsokat s elhagyja a belltsi zemmdot. 1.Nyomja meg a MODE/LOCK gombot e. Villog a pontos id kijelzse.
2.A pontos id percenknti intervallumok-ban val belltshoz nyomja meg a DOWN/UP gombot i/o. Valamenyikgombnyomvatartsagyorsegymsutn-banvltoztatjamegapontosidt.
Dtum belltsa1.Nyomja meg ismt a MODE/LOCK
gombot e. A kijelzn g a 01.01.2013 dtum kijelzs villog.
2.A dtum napokban trtn belltshoz nyomja meg a DOWN/UP gombot i/o. Valamelyik gomb nyomvatartsval gyors egymsutnban vltozik a dtum.
Vros belltsa1.Nyomja meg jra a MODE/LOCK gom-
bot e. A kijelzn g a LOCAL CITY kijelzs alatt megjelenik a vros rvidt-snek kijelzse.
2. Nyomja meg a DOWN/UP i/o gom-bokat, hogy belltsa a vros ill. krlbe-lli tartzkodsi helye alapjn az idz-nt. Valamelyik gomb nyomvatartsval gyorsan megvltozik a kijelzs. Itt tall-hat a bellthat vrosok s idklnb-sgek ttekintst:
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 17 11.06.2012 11:23:19
-
- 18 -
Rv.. Klnbsg. VrosHNL -10 Honolulu/USAANC -9 Anchorage/USAYVR -8 Vancouver /
KanadaLAX -8 Los Angeles/USADEN -7 Denver/USACHI -6 Chicago/USAMEX -6 Mexico City/
MexikNYC -5 New York/USAYYZ -5 Toronto /KanadaYUL -5 Montreal /
KanadaCCS -4 Caracas/
VenezuelaRIO -3 Rio de Janeiro/
BrazliaBUE -3 Buenos Aires /
ArgentnaUTC 0 Universal Time
CoordinatedLON 0 London /UKBER +1 Berlin/
NmetorszgPAR +1 Prizs/
FranciaorszgROM +1 Rma/
OlaszorszgCAI +2 Kair/EgyiptomIST +2 Isztambul/
TrkorszgMOW +3 Moszkva/
OroszorszgKWI +3 Kuwait City/
KuvaitDXB +4 Dubai /
Szaudi-ArbiaKHI +5 Karachi/
PakisztnDAC +6 Dacca /
BangladesBKK +7 Bangkok/TjfldSIN +8 SzingaprHKG +8 Hong KongPEK +8 Beijing/KnaSHA +8 Shanghai/KnaTYO +9 Toki/Japn
Rv.. Klnbsg. VrosSYD +10 Sydney /AusztrliaNOU +11 Noumea /
New CaledoniaAKL 12 Auckland /
j-Zland3. Nyomja meg a SNOOZE/DIMMER
gombot y, ha be vagy ki szeretn kap-csolni a kivlasztott idznhoz a nyri idszmtst. A kijelz g megfelelen SUM ON-t ill. SUM OFF-ot jelez ki.
A vilgid belltsa1.Nyomja meg jra a MODE/LOCK gom-
bot e. A kijelzn g a WORLD CITY kijelzs alatt megjelenik a vros rvidt-snek kijelzse.
2.A kvnt vilgid belltshoz nyomja meg a DOWN/UP gombokat i/o. Valamelyik gomb nyomvatartsval gyorsan megvltozik a kijelzs. Erre is rvnyes a bellthat vrosok s idk-lnbsgek fent nevezett ttekintse.
3. NyomjamgismteltenaSNOOZE/DIMMERgomboty,hogyakivlasztottvilgidhzbelltsaanyriidtlvaleltoldst.
Idltolds Kijelz Magyarzat
1 OFF-SET1
Aznidznjban(LocalCity)tliid-szmtssabelltottvilgidbenppennyriidszmtsvan.
0 OFF-SET0
Aznidznjban(LocalCity)sabell-tottvilgidbenppennyriidszmtsill.tliidszmtsvan.
-1 OFF-SET-1
Aznidznjban(LocalCity)nyritliid-szmtssabelltottvilgidbenppentliidszmtsvan,ill.nin-csennyriidszmts.
Emlkeztet funkci belltsaLegfeljebb 10 adatot lehet beprogramozni, melyek elrsekor emlkezteti nt a kszlk.
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 18 11.06.2012 11:23:19
-
- 19 -
1. Ismt nyomja meg a MODE/LOCK gom-bot e. A kijelzn g egy dtum s az SDA 1 kijelzs villog az 1. emlkeztet dtumhoz.
2.A kvnt emlkeztet dtum belltshoz nyomja meg a DOWN/UP gombot i/o. Valamelyik gomb nyomvatartsval gyor-san megvltozik a kijelzs.
3.Ha megnyomja a SNOOZE/DIMMER gombot y, kikapcsol az vszm s ezzel minden vben emlkeztet erre a dtum-ra.
4. Ha tbb dtumot is be szeretne prog-ramozni, nyomja meg a PAGE/AL.SET gombot f, hogy kivlassza a kvnt 2-10. memriahelyet.
5. A tbbi dtummal ugyangy jrjon el.6. Ha ki szeretn kapcsolni az emlkeztet
funkcit, programozzon be egy elmlt dtumot.
A frisst funkci belltsaEzzel a funkcival a kszlk az RDS adatok segtsgvel magtl frissti a pontos id be-lltsait.1. Ismt nyomja meg a MODE/LOCK gom-
bot e. A kijelz g UPDATE ON-t jelez ki.2. Nyomja meg a DOWN i gombot, ha
ki szeretn kapcsolni a frisst funkcit. A kijelz g ezutn UPDATE OFF-t jelez ki.
3.Nyomja meg az UP gombot o, ha ismt be szeretn kapcsolni a frisst funkcit.
A szundi funkci idejnek belltsa1. Ismt nyomja meg a MODE/LOCK gom-
bot e. A kijelz g SNOOZE 09-et jelez ki.2. Nyomja meg a DOWN/UP i/o gom-
bot, ha 1 - 59 perc kztt szeretn bellta-ni a ksleltetett breszts idejt.
12- vagy 24-rs zemmd belltsa1. Ismt nyomja meg a MODE/LOCK gom-
bot e. A kijelz g 24HR-t jelez ki.2.Nyomja meg a DOWN i gombot, ha
be szeretn lltani a 12 rs zemmdot. A kijelzn g 12HR.jelenik meg.
3.Nyomja meg az UP o gombot, ha megint 24 rs zemmdra szeretne tkapcsolni.
A kivettsi id belltsa1. Ismt nyomja meg a MODE/LOCK gom-
bot e. A kijelz g PROJ-T OFF-ot jelez ki.2.A kivettsi id 1-59 perc kztti idtar-
tamnak belltshoz nyomja meg a DOWN/UP gombot i/o. AzOFFbe-lltsbanakivettsfolyamatosanvilgtsaPROJECTIONgombamegnyom-svallehetki-sbekapcsolni.
Kivetts breszts esetn1. IsmtnyomjamegaMODE/LOCKgombote.AkijelzgPROJ-AL OFF-otmutatki.
2. NyomjamegazUPgomboto,haaztszeretn,hogybresztskzbenakivettsautomatikusankapcsoljonki.
3 NyomjamegaDOWNgombot i,hakiszeretnkapcsolniafnyerszablyozfunkcit.
A kijelz automatikus fnyerszablyozsa 1. IsmtnyomjamegaMODE/LOCKgom-
bote.AkijelzgDIM-T OFF-otmutatki.2. NyomjamegazUPgomboto,haakijel-
znekafnyerejtautomatikusanegybi-zonyosidpontbanvisszaszeretnvenni.AkijelzgDIM-T ON-tmutatki.
3 NyomjamegaDOWNgombot i,hakiszeretnkapcsolniafnyerszablyozfunkcit.
A kijelz fnyerszablyozsi idejnek belltsa1. IsmtnyomjamegaMODE/LOCKgom-
bote.AkijelzgDT 23:00 ON-tjelzikiannakazidnek,amikorakijelzfny-erejtvisszafogja.
2. NyomjamegaDOWN/UPgombokati/ o,hamsikidpontotszeretnekiv-lasztani.
3. IsmtnyomjamegaMODE/LOCKgom-bote.AkijelzgDT 6:00 OFF-otjelezkiannakazidnek,amikorakijelzmegintnormlfnyerveljelenjenmeg.
4. NyomjamegaDOWN/UPgombokati/o,hamsikidpontotszeretnekiv-lasztani.
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 19 11.06.2012 11:23:19
-
- 20 -
Ismt nyomja meg a MODE/LOCK gombot e, ha le szeretn zrni ezt a belltst.Idzt funkci1.NyomjamegaNAP/USERgombotk.
AkijelzngaNAPkijelzsjelenikmegsa010idkijelzsvillog.
2 lltsa be a DOWN/UP gomb i/o se-gtsgvel a kvnt idt (1 perctl 23 ra 59 percig terjed idtartam belltsa lehetsges).
3 Nyomja meg ismt a NAP/USERgombotk, ha el akarja indtani az idztt. A kijelzn g a fennmarad id jelenik meg.
4. Halejrtazid,azidzthangjelzsekb.10percighallhat,aNAPkijelzsvillogsapontosidjelenikmeg.
5. Ha be szeretn fejezni az bresztst, nyomja meg brmelyik gombot.
6.Ha be szeretn fejezni az breszts eltt az idzt funkcit, tartsa egy msodper-cig lenyomva a NAP/USERgombotk.
Az breszt funkci (1-4. breszts)Az bresztrdival ngy fle bresztsi idt programozhat be. Ha kb. 15 msodper-cen bell nem nyomja meg egyik gombot sem, a kszlk lementi a belltsokat s elhagyja a belltsi zemmdot.1.Hakivankapcsolvaardi,nyomjameg
aPAGE/AL.SETgombotf,haleszeret-nhvniazbresztsifunkcit.APRESET/ALARM+/-gombbals/dvlaszthatjakiakvntbresztsimemriahelyet.Akijelzngalegutbbbelltottbresztsiidsazbresztstpusnakjellsevil-log(rdivagyhangjelzs).
2.A kvnt bresztsi id belltshoz nyomja meg a DOWN/UP gombokat i/o. ADOWN/UPgomboki/onyomvatartsagyorsegymsutnbanvltoztatjamegazbresztsiidt.
3. NyomjamegaPAGE/AL.SETgombotf,mgakvntbresztsifunkci(lsdatblzatot)nemjelenikmegakijelzng.
bresztfunkci A kijelzn g meg-jelen szimblum
Hangjelzs
Rdi
ki van kapcsolva Szimblum nlkl4.Nyomja meg a SNOOZE/DIMMER y
gombot, ha a ht azon napjait szeretn belltani, amelyeken bresztst kr: gyvlaszthatamunkanap(MON,TUE,WED,THU,FRI),htvge(SAT,SUN)smindennap(MON,TUE,WED,THU,FRI,SAT,SUN)kzl.
5.Tartsa 2 msodpercig lenyomva a SNOOZE/DIMMER gombot y, ha a ht egy bizonyos napjn szeretn kri az b-resztst. Ennek a napnak a belltshoz ismt nyomja meg a SNOOZE/DIMMER gombot y. Igazodjon a kijelz jobb fels rszben megjelen napok rvidt-shez: MON = htf TUE = kedd WED = szerda THU = cstrtk FRI = pntek SAT = szombat SUN = vasrnap
6. Ha vissza akar lpni a munkanap, htvge vagy teljes ht belltstl, tartsa ismt 2 msodpercig lenyomva a SNOOZE/DIMMER y gombot.
7. Kb. 15 msodperc utn a kijelz g a pontos id kijelzshez tr vissza. Ezzel le vannak mentve az bresztsi funkci belltsai s ezek kijelzsre kerlnek.
8. Ha szksges, megfelelen programozza be a tbbi bresztsi id trhelyt.
9. Hardifunkcivalkriazbresztst,kapcsoljabeardit,svlasszakiakvntrdiadt.Ezutnlltsabeaztahangert,melyetbresztskormaximlisan
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 20 11.06.2012 11:23:19
-
- 21 -
elszeretnerni.Ardimkdsnekmagyarzattakvetkezoldalakontallja.
Ha az breszts megszlal... ... s a Rdi bresztsi funkci van
kivlasztva , a rdi nvekv hangervel s a legutbb belltott adn kapcsol be egy rig.
...sahangjelzsbresztsifunkcivankivlasztva,ahangjelzsek10percignvekvhangervelszlalnakmeg.
Az adott bresztsi funkci befejezshez nyomja meg brmelyik gombot, kivve a SNOOZE/DIMMER gombot y.
Az ismtelt breszts (szundi) funkciHa megnyomja a SNOOZE/DIMMER gombot y, kimarad az ppen bekapcsolt breszts annyi idre, mely ehhez a funkci-hoz be van lltva (lsd a Szundi funkci idtartamnak belltsa rszt, 1 - 59 perc, alaprtk= 9 perc). Ekzben a kijelzn g vilgt a SNZ kijelzs. Haegymegszaktottbresztstvgrvnyesenmegszeretnesza-ktani,nyomjamegegyszerrvidenaPAGE/AL.SETgombotf.
Az emlkeztet funkciA kszlk emlkezteti az emlkeztet funk-cival belltott dtumra. Ebben az esetben ezen a napon 8:00 - 23:00 kztt minden egsz rban 10 perces emlkeztet riaszts szlal meg. Ehhez a kijelzn g villog az SDA kijelzs.Ha be szeretn fejezni az emlkeztet riasz-tst, nyomja meg valamelyik gombot.
A vltoz kijelz funkcik belltsaHa a kszlk kszenlti zemmdban van, nyomja meg a DOWN gombot i. A kijel-zn D jelenik meg (a pontos idhz s a dtumhoz). Imt nyomja meg a DOWN gombot i, ekkor a kijelzn W jelenik meg (a pontos idhz s a vilgidhz). Imt nyomja meg a DOWN gombot i, ekkor a kijelzn DW jelenik meg (felvltva a pontos id, a dtum s a vilgid). Ismt
nyomja meg a DOWN gombot i, a kijel-zn (csak a pontos id) jelenik meg.
Rdi zemmdA kszlk mszaki adottsgai 87,5108 MHz ill. 526,51606,5 kHz kztt bellthat frekvenciatartomnyt tesznek lehetv. Az egyes orszgokban eltr nemzeti rendelkez-sek lehetnek letben a kirendelt rdis frekven-ciatartomnyokhoz. Vegye figyelembe, hogy a kiosztott frekvenciatartomnyon kvl fogadott informcikat nem szabad rtkesteni, idegen szemlynek tovbbadni vagy felhasznlsi cljval ellenttes mdon felhasznlni. Az URH vtelhez tekerje le teljesen a vezetkes antennt 2)s mkds kzben hatrozza meg, hogy milyen irnyban van kedvez helyzetben. A kzphullm adk vtelhez a kszlk beszerelt antennval rendelkezik. Ha esetleg javtani szeretne a KH adk vteln, fordtsa el a kszlket a kedvezbb irnyba.
A rdi funkci be- s kikapcsolsa1.Nyomja meg a gombot l. A kijelzn g az aktulis frekvencia s a bekapcso-lsi jel jelenik meg. Melletteazrajelevillogsgyjelziki,hogyakszlkRDSadtlvrjaapontosidtkldst.
2.Nyomja meg ismt a l gombot, ha be szeretn fejezni a rdi funkcit s a kszlket kszenlti zemmdba szeret-n visszahelyezni.
Az adk kzi belltsa1.Vlassza ki a svvlaszt-gombbal u
a KH (AM) vagy URH (FM) tartomnyt.2.Nyomja meg az UP gombot o, ha
magasabb frekvencij adt szeretne keresni a kijelzn megjelentettnl.
3. Nyomja meg a DOWN gombot i, ha alacsonyabb frekvencij adt szeretne keresni a kijelzn megjelentettnl.
4. Ha az ppen belltott ad RDS adato-kat kld, a kijelzn g vilgt az kijelzs. Ekkor a kijelz g a rdiad nevt jelzi ki s a pontos idt aktualizlja
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 21 11.06.2012 11:23:20
-
- 22 -
(amennyiben a belltsoknl be van kapcsolva, lsd a Frisstsi funkcik belltsa).
Automatikus adkeressA kszlkkel adkat is lehet keresni. Az bresztrdi ekkor tkeresi a kivlasztott frekvenciasvot, amg tallt egy adt.
1. Tartsa kt msodpercig lenyomva az UP gombot o: az bresztrdi felfele keresi meg a legkzelebbi adt.
2.Tartsa kt msodpercig lenyomva a DOWN gombot i: az bresztrdi lefele keresi meg a legkzelebbi adt.
Addig ismtelje meg ezeket a lpseket, amg nem tallt tetszse szerinti adt.
Ad programozsa2 felhasznlnak szemlyenknt 20 URH adt s 12 KH adt lehet lementeni ked-vencknt. Ezek a memrik tbb oldalra osztdnak el, melyeket a PAGE/AL.SET gombbal f lehet lehvni. Valamennyi ol-dalon 4 adnak van helye, melyeket az PRESET/ALARM +/- s/ d lehet lehvni.1.Habevankapcsolvaardi,nyomjameg
aPAGE/AL.SETgombotf,hogylehvjaakvntmemriaoldalakat1-5kzl.A kijelzn g a PAGE alatt megjelenik az ppen kivlasztott memriaoldal.
2. lltsa be a kvnt adt.3.Nyomja meg rviden az A.M.S.
MEMORY gombot h. A kijelzn g a szmok helye s a MEM trhely kijel-zs villog.
4. VlasszakiaPRESET/ALARM+/gombbals/daztahelyet,amelyreleszeretnmenteniazadt. Igazolja az A.M.S. MEMORY gombbal h. Ekkor le van mentve az ad s tartsan kijelzsre kerl.
5.Mivel tbben is hasznlhatjk a ksz-lket, kt, felhasznlhoz val tkapcso-lval rendelkezik. Mindkt felhasznl klnbz adkat menthet le magnak kedvencknt. Hamegszeretnvltoztatniafelhasznlt,tartsaktmsodpercig
lenyomvaaNAP/USERgombotk.AzppenaktivltAvagyBfelhasznljelenikmegakijelzng.
6. Ismtelje meg a 1 - 4. lpseket (mindkt felhasznlhoz), amg valamennyi kvnt ad le van mentve.
AMS (Automatic Memory System)Az AMS funkcival a rdi automatikusan keres adkat s lementi ket a 20 rendelke-zsre ll trhelyre. Tartsa kt msodpercig lenyomva az
A.M.S. MEMORY gombot h. Az bresz-tra automatikusan megkeresi a leger-sebben sugrzott adkat s egyms utn lementi ket.
Adk lekrdezse1. Ha lementett adt le szeretn hvni, v-
lassza ki rdi zemmdban elszr a kvnt felhasznlt.
2.A PAGE/AL.SET gombbal f vlassza ki a kvnt memriaoldalt.
3. VlasszakiaPRESET/ALARM+/gomb-bals/daztatrhelyet,ahovaazadtleszeretnmenteni.
Hanger belltsa Rdi zemmdban tbbszr nyomja
meg a Vol q gombot, ha vissza sze-retne venni a hangerbl. A kijelzn g jobbra az aktulis hanger jelenik meg V 0 - 18 lpsekben.
Ismt nyomja meg a Vol+ w gombot a hanger nvelshez.
Kikapcsols idztA kszlk max. 90 percig mkd kikap-csol idztvel rendelkezik.1.Nyomja meg a SLEEP gombot j, ha le
szeretn hvni ezt a funkcit s esetleg be szeretn kapcsolni a rdit.
2. Ismt nyomja meg a SLEEP gombot j, ha 10 perces lpsekben be szeretn adni a fennmarad idt. Nhny msodperc ml-va ismt a vteli frekvencia jelenik meg.
3. Ekzben a kijelzn g 4.Nyomja meg brmikor a SLEEP gombot j, ha nhny msodpercre a fennmarad
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 22 11.06.2012 11:23:20
-
- 23 -
idt szeretn megjelenteni.5. Az id lejrta utn a kszlk kikapcsol.6.Ha id eltt ki szeretn kapcsolni a
kikapcsols idztt, nyomja meg a gombot l.
A kijelz fnyerejnek megvltoztatsa s tkapcsolsaA kijelz fnyerejt a SNOOZE/DIMMER gomb y megnyomsval hrom fokozatban llthatja be: vilgos, kzepes, kikapcsol. Minlnagyobbafnyer,annlnagyobbakszlkteljestmnyfelvtele.HardizemmdbanrvidenmegnyomjaaMODE/LOCKgombote,tkapcsolafrek-venciasazrakijelzsekztt.
KivettsA pontos idt a kszlkrl falra vagy a pla-fonra lehet kivetteni. Ez a funkci azt a clt szolglja, ha sttben szeretnnk leolvasni a pontos idt. Napkzben jl megvilgtott helyisgben alig fogja tudni hasznlni a kivett funkcit. Habevankapcsolvaakive-tts,akijelzngvilgtakivettsjele.1.Ehhez hajtsa ki a projektort t.2.Kapcsolja be a funkcit a kivett gombot a.
3. Irnytsa a projektort t a kvnt helyre. Mielttakivettttoldalrafordtan,vatosanhzzakiatalpazattakszlkburkolatbl.
4.lltsa lesre a fkuszszablyzval 1( a kivettst.
5. A pontos id csak az elre belltott id-ben vettdik a kvnt helyre (lsd a Ki-vetts idtartamnak belltsa rszt).
6. Haakivettsttkrzttenszeretnkije-lezni,tartsaegymsodperciglenyomvaaPROJECTIONgombota.Hamgegyszermegnyomjaeztagombot,akkorakivettsmegintalapbelltsbanjelenikmeg.
7. Ha id eltt ki szeretn kapcsolni ezt a funkcit, nyomja meg a kivett gombot a s hajtsa be a kivettt t.
BillentyzrTartsaaddiglenyomvaaMODE/LOCKgom-bote,mgakijelzngmegnemjelenikakulcsjel.Ezzellevannakzrvaanormlbillentyfunkcik.Agombokazonbanmeg-tartjkazbresztsbefejezsefunkcit.Ezenkvl a SNOOZE/DIMMER gombnak y megmarad a ksleltetett breszts s a kijelz fnyerejnek mdostsa funkcija. Hakiszeretnoldaniabillentyzrat,tartsaaddiglenyomvaaMODE/LOCKgombote,amgakulcsjelkinemalszik.
Tisztts
Figyelmeztets!A kszlket minden tisztts eltt hzza ki a hlzati aljzatbl! Ha nedvessg kerl a kszlkbe, akkor elektromos ramts veszlye ll fenn! Mskln-ben helyrehozhatatlan kr keletkezhet a kszlkben!
Az bresztra burkolatt kizrlag enyhn nedves ronggyal s gyenge mosszerrel tisz-ttsa. Vigyzzon arra, hogy tisztts kzben ne kerljn folyadk a hzba!
Hibaelhrts
A kszlk nem mkdik. > Jl be van dugva a konnektorba a hl-zati vezetk 2! csatlakozja? > Lehet, hogy ki van kapcsolva a biztostk? > ramkimarads van?
Rossz az URH vtel. > Vltoztassa meg a vezetkes antenna 2) helyzett. Ha szksges, rgztse ragasz-tszalaggal.
Rossz a KH vtel. > Vltoztassa meg a kszlk helyzett.
ramkimarads utn valamennyi bellts elveszett > Nem tett be elemet a memria megrz-shez.
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 23 11.06.2012 11:23:20
-
- 24 -
> A behelyezett elemek ki voltak merlve mr ahhoz, hogy megrizzk a memrit. Cserlje ki ket.
A kivettett pontos id nagyon rosszul olvashat. > lltsa lesre a fkuszszablyzval 1( a kivettst.
A megfelelsgre vonatkoz tudnivalkA kszlk megfelel az elektromgneses sszefrhetsgre vonatkoz 2004/108/EC irnyelv alapvet elvrsainak s vonat-koz elrsainak s az alacsonyfeszltsg kszlkekre vonatkoz 2006/95/EC irnyelvnek.
GyrtjaKOMPERNASS GMBH BURGSTRASSE 21 44867 BOCHUM, GERMANYwww.kompernass.com
rtalmatlantsSemmi esetre se dobja a ksz-lket a hztartsi hulladkba. Ez a termk a 2002/96/EC eurpai irnyelv hatlya al tartozik.A kszlk rtalmatlantsa A kszlket vagy annak rszeit enge-
dlyezett hulladkgyjt helyen vagy a helyi hulladkeltvolt zemnl tudja kidobni.
Vegye figyelembe az rvnyben lv ide-vonatkoz elrsokat. Ha bizonytalan, ve-gye fel a kapcsolatot a hulladkfeldolgoz vllalattal.
Az elemek/akkuk rtalmatlantsa Az elemeket/akkukat nem szabad a
hztartsi hulladkba dobni. Az elemek/akkuk mrgez anyagokat
tartalmazhatnak, melyek kros hatssal vannak a krnyezetre. Az elemeket/ak-
kukat ezrt mindenkppen az rvnyes trvnyes elrsoknak megfelelen selejtezze ki.
Minden felhasznl trvnyes kte-lessge, hogy az elemeket/akkukat leadja lakhelye gyjthelyn vagy a kereskednl. Ez a ktelezettsg azt a clt szolglja, hogy az elemek/akkuk krnyezetkml rtalmatlantsra kerl-hessenek.
Az elemeket s akkukat csak lemerlt llapotban adjk le.
A csomagols rtalmatlantsaValamennyi csomagolanyagot juttas-son el a krnyezetbart hulladkhasz-nosthoz.
Garancia s szervizA kszlkre 3 v garancit adunk a v-srls dtumtl szmtva. A kszlket gondosan gyrtottuk, s szllts eltt lelki-ismeretesen ellenriztk. Krjk, a vsrls igazolsra rizze meg a pnztri blokkot. Krjk, garanciaigny esetn vegye fel a kapcsolatot telefonon az n kzelben lv szervizzel. Csak ebben az esetben garantl-hatjuk, hogy ingyen tudja bekldeni az rut.A garancia csak anyag- s gyrtsi hibra vonatkozik, nem pedig szlltsi krra, kop alkatrszekre vagy a trkeny rszek (pl. kapcsol vagy elem) srlsre.A termk csak magn s nem pedig ke-reskedelmi hasznlatra kszlt. A garan-cia rvnyt veszti visszalsszer vagy szakavatatlan kezels, erszak alkalmazsa vagy olyan beavatkozsok esetn, amelye-ket nem engedlyeztetett szervizel zlete-ink hajtottak vgre.Az n trvnyes jogait ez a garancia nem korltozza. A garancilis id nem hosszabbodik meg a jtllssal. Ez a kicserlt vagy javtott r-szekre is vonatkozik. Az esetlegesen mr a vtelkor meglv hibkat s hinyossgokat azonnal a kicsomagols utn , de legk-
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 24 13.06.2012 14:01:08
-
- 25 -
sbb kt nappal a vsrls dtumtl sz-mtva jelenteni kell. A garancilis id lejrta utn esedkes javtsok kltsgvonzatak.
Szerviz MagyarorszgTel.:0640102785E-Mail:kompernass@lidl.hu
IAN75878
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 25 11.06.2012 11:23:21
-
- 26 -
BDA_SPU 900 A1 - TOZ-75878_4_hu.indd 26 11.06.2012 11:23:21
-
- 27 -
OBSAH STRANA
el pouit 28
Rozsah dodvky 28
Technick daje 28
Bezpenost 28
Sousti pstroje 30
Zprovoznn pstroje 31
Provoz rdia 35
itn 37
Pomoc pi vyhledvn chyb 37
Poukaz na konformitu 37
Dovozce 37
Znekodnn 37
Zruka a servis 38
Ped prvnm pouitm si pozorn pette nvod na obsluhu a uschovejte ho pro pozdj potebu. Pi pedvn zazen tetm osobm pedejte i tento nvod.
BDA_SPU 900 A1 - TOZ-75878_4_cz.indd 27 11.06.2012 11:22:10
-
- 28 -
BudksprojekcasuSPU900A1
vodGratulujeme Vm k zakoupen novho p-stroje. Vam nkupem jste si vybrali kvalitn vrobek. Nvod k obsluze je soust to-hoto vrobku. Obsahuje dleit pokyny a upozornn ohledn bezpenosti, pouit a likvidace. Ped pouitm vrobku si dobe pette provozn a bezpenostn pokyny. Vrobek pouvejte pouze pedepsanm zpsobem a v uvedench oblastech pouit. Tento nvod dobe uschovejte. Pi pedv-n vrobku tetm osobm pedvejte i tyto podklady.Autorsk prvoTato dokumentace je chrnn autorskm prvem. Vechna prva, a i fotomechanick reprodukce, rozmnoovn a roziovn prostednictvm zvltnho procesu (nap-klad zpracovn dat, nosie dat a datov st), i jenom sten, jako obsahov a technick zmny, jsou vyhrazeny.
elpouitBudk s rdiem je uren pro zobrazen asu a pjem rdiovch stanic VKV a SV. Krom toho je pstroj vybaven budic funkc pro-stednictvm rdia a signlu.Budk s rdiem nen uren pro ivnostensk nebo prmyslov oblasti. Vrobce neodpovd za kody vznikl uvnm pstroje v rozporu s jeho urenm!
Rozsahdodvky1 Budk s rdiem a projekc SPU 900 A11 Nvod k obsluze
TechnickdajePipojen k sti: 220-240 V~, 50 HzPkon rdia: 5 Watt Pohotovostn reim (standby): 1,2 Watt
Vstupn vkon: 2 x 450 mW pi 10% THD Kmitotov psmo: VKV (FM) 87,5-108 MHz SV (AM) 526,5 1606,5 kHz Provozn teplota: + 5 +35CSkladovac teplota: -20 - +50 CVlhkost: 5 - 90 % (bez kondenzace) Rozmry ( x v x hl.): 21 x 7 x 14,1 cm Hmotnost : cca 870 g Tda ochrany: II/Baterie Backup 2 x 1,5 V, typu AAA/ Micro (nejsou soust dodvky)
Bezpenost
VstrahaTmto vstranm upozornnm tohoto stupn nebezpe se oznauje mon nebezpen situace. Pokud se nezabrn nebezpen situaci, me vst tato ke zrannm. Proto te-ba nsledovat pokynm v tomto vstranm upozornn pro zabrnn zrann osob.
POZORTmto vstranm upozornnm tohoto stup-n nebezpe se oznauje mon hmotn koda. Pokud se nezabrn tto nebezpen situaci, me vst tato ke hmotnm kodm. Proto teba nsledovat pokynm v tomto vstranm upozornn pro zabrnn hmot-nch kod.
UpozornnUpozornn oznauje dodaten informace, kter uleh manipulaci s pstrojem.
BDA_SPU 900 A1 - TOZ-75878_4_cz.indd 28 11.06.2012 11:22:12
-
- 29 -
Vstraha:Nebezperazuelektrickmproudem!
Pstroj pipojte pouze do dn insta-lovan a uzemnn zsuvky. Sov napt se mus shodovat s daji na typovm ttku pstroje.
Nechte kabely nebo pstroje, kter ne-funguj sprvn nebo byly pokozen, okamit opravit nebo vymnit servisem pro zkaznky.
Nedovolte dtem piblit se k pipojo-vacmu kabelu ani k pstroji. Dti asto neodhadnou nebezpe, kter elektric-k zazen pedstavuj.
Spotebi nikdy neponoujte do vody. Pouze jej otete lehce navlhenm hadkem.
Nevystavujte zazen psoben det a rovn jej nikdy nepouvejte ve vlhkm nebo mokrm prosted.
Sov kabel berte do ruky vdy za zstrku. Netahejte za samotn kabel a tak se kabelu nikdy nedotkejte mokrma rukama, jeliko by mohlo dojt ke zkratu nebo elektrickmu vboji.
Nestavte pstroj a ani kusy nbytku nebo pod.na sov kabel a dbejte na to, aby se tak nepiskpl.
Dbejte na to, aby propojovac kabel nebyl bhem provozu nikdy mokr nebo vlhk.
Kryt pstroje nesmte otevt a ani pstroj sami opravovat nebo modifikovat. Pi otevenm krytu hroz nebezpe ohro-en ivota zsahem elektrickm prou-dem a zanik nrok na zruku.
Chrate pstroj ped odkapvajc a stkajc vodou. Proto nestavte na nebo vedle pstroje dn ndoby naplnn vodou (nap. vzy s kvtinami).
Zkontrolujte, zda na pstroji a jeho stech nejsou viditeln pokozen. Zazen me bt bezpen pouze tehdy, pokud je v bezvadnm stavu.
Ped kadm itnm vythnte zstrku ze zsuvky.
Vstraha:Nebezpeporann! Nikdy nedlejte na kabelu uzel a ne-
spjejte jej s dalmi kabely. Napjec kabel by se ml poloit tak, aby nikdo ne-mohl o nj zakopnout nebo na nj stoupit.
Napjec kabel mus bt vdy snadno pstupn, aby se v ppad nouze mohl pstroj rychle odpojit od st.
Tento vrobek nen uren k tomu, aby jej pouvaly osoby (vetn dt), kter maj omezen fyzick, senzorick nebo duevn schopnosti i nedostatek zku-enost a/nebo znalost, ledae by jej pouvaly pod bezpenostnm dohledem zodpovdn osoby nebo by od n obdr-ely pokyny, jak vrobek pouvat. Dohlejte na dti, aby si s tmto vrob-kem nehrly.
Zajistte, aby byl pstroj postaven sta-biln.
Pokud pstroj spadne nebo je pokoze-n, nesmte jej vce uvdt do provozu. Pstroj nechejte pezkouet a ppadn opravit kvalifikovanm odbornm perso-nlem.
Baterie se nesmj dostat do rukou dtem. Hroz nebezpe, e by dti mohly baterie vloit do st a spolknout.
V ppad spolknut baterie je teba neprodlen vyhledat lkaskou pomoc.
Vstraha:Nebezpevbuchu! Baterie nevhazujte do ohn.
Baterie znovu nenabjejte. Baterie nikdy neotvrejte, neprovdjte na
nich letovn ani svaovn. Hroz nebez-pe vbuchu nebo zrann!
Pozor:Nebezpeporu! Pstroj nepouvejte v blzkosti povrch
s vysokou teplotou. Neumsujte pstroj na msta, kter jsou
vystaven pmmu slunenmu zen. V opanm ppad se pstroj me peht a nevratn pokodit.
Nikdy nezakrvejte vtrac otvory p-stroje, jestli-e je zapnut.
BDA_SPU 900 A1 - TOZ-75878_4_cz.indd 29 11.06.2012 11:22:12
-
- 30 -
Nestavte zdroje s otevenm ohnm, jako jsou nap. svky na nebo vedle pstroje.
Pozorpibouce! Pi bouce me dojt k pokozen p-
stroj, kter jsou zapojeny do st. Proto pi bouce vdy vythnte zstrku ze zsuvky.
PozorpizachzensbateriemiPstroj pouv k zlohovn pamti baterie. Pro manipulaci s bateriemi respektujte nsledujc pokyny:
Pokud pstroj del dobu nepouvte, baterie vyjmte.
Pravideln kontrolujte baterie. Vytkajc baterie mohou pstroj pokodit.
Jestli-e vyteou baterie, je teba si nathnout rukavice a vyistit prostor pro baterie a baterie kontakty suchm hadkem.
Varovn!Nikdy nevystavujte baterie nadmrnmu teplu (nap. pm slunen zen, ohe).
Pozor!Pi neodborn vmn bateri hroz nebez-pe vbuchu baterie. Nahrate pouze stej-nm nebo rovnocennm typem.
PokynkodpojenodnapjecstTlatko tohoto pstroje odpojuje p-stroj od elektrick st. Krom toho je pstroj v standby-provozu vdy pod proudem. Pokud chcete pstroj zcela odpojit od napjec st, muste vyth-nout zstrku ze zsuvky.
Upozornnnarzovnapt(EFT/rychlzmnaelektrickhostavu)aelektrostatickvboje:V ppad vadn funkce zpsoben rychlou zmnou elektrickho stavu
(rzov napt), resp. elektrostatickho vboje, mus bt vrobek pro obnoven normlnho provozu navrcen do p-vodnho stavu. Me pomoci odpojen od napjen a optovn pipojen. Baterie (jsou-li v pstroji) mus bt ode-brny a znovu vloeny.
UpozornnZa kody na budku s rdiem, kter vznikly z dvodu vlhkosti, vniknutm vody do pstroje, nadmrnm peh-tm nebo vlastnorun pestavbou, se nepebr ruen/a ani zruka!
Soustipstrojeq VOL - snen hlasitostiw VOL + - zven hlasitostie MODE/LOCK - vyvol nastaviteln
parametre/ Zablokovn tlatek
r Reproduktort Projektor - projektuje as na stnyy SNOOZE/ - tlatko ztemnn/
DIMMER pepna jasuu BAND - pepne rdiov psmoi DOWN - vbrov tlatko zpto UP - vbrov tlatko
dopedua PROJECTION - zapnut/vypnut
projekce hodins PRESET/ALARM + - pam stanic/alarm
dopedud PRESET/ALARM - pam stanic/
alarm zptf PAGE/AL.SET - pepne strany pamti/
vyvol funkci alarmug Display - Zobrazenh A.M.S. MEMORY - autom. ukldn stanic
do pamtij SLEEP - d asova vypnutk NAP/USER - aplikan pepnut,
funkce asovael - zapna/vypna
rdiov funkce
BDA_SPU 900 A1 - TOZ-75878_4_cz.indd 30 11.06.2012 11:22:12
-
- 31 -
1( Regultor zaosten - k zaostovn projekce
asu2) Vytahovac
antna - pro pjem VKV2! Sov kabel2@ Pihrdka na
baterie - pro baterie Backup
ZprovoznnpstrojeNejdve vythnte vechny sousti pstroje z balen a odstrate obaly. Zkontrolujte p-stroj na ppadn pokozen.
Vloen zlohovacch bateriV ppad vpadku proudu zstanou vechna individuln nastaven pstroje zachovna pomoc zlon baterie. K tomu potebujete dv 1,5 V baterie typu AAA/Micro. Tyto ne-jsou soust dodvky.
1.Otevte klapku pihrdky na baterie 2@ na spodn stran budka s rdiem.
2. Vlote baterie. Dbejte pitom na sprvnou polaritu.
3. Vko pihrdky na baterie 2@ zavete. Vko mus jasn zaklapnout.
Poznmka:Zlohovac baterie alespo jednou ron zkontrolujte a ppadn vymte.
Zajitn pvodu napt Zapojte zstrku do zsuvky. Na displeji
g se objev uvtac npis PLEASE WAITFOR SETTING THANKS. Budk s rdiem se zatm pokus aktualizovat sv nasta-ven hodin a datumu pomoc signlu RDS. Pokud chcete tento proces peruit, tak stisknte libovoln tlatko. Nepoda-li se automatick aktualizace, provete uveden nastaven manuln.
Nastaven hodinovho asuPro nastaven hodin a nsledujcch param-ter mus bt rdio vypnut. Pokud se bhem cca.15 sekund nestiskne tlatko, ulo pstroj nastaven do pamti a opust modus nastaven.
1.Stisknte tlatko MODE/LOCK e. Za-ne blikat zobrazen hodin.
2.Stisknte tlatka DOWN/UP i/o, pro nastaven hodin v minutovm intervalu. Podrenm jednoho z tlatek se zmn as v rychlm sledu.
Nastaven data1.Stisknte opt tlatko MODE/LOCK e.
Na displeji g blik zobrazen datumu 01.01.2013.
2.Stisknte tlatka DOWN/UP i/o pro nastaven datumu v dennm intervalu. Stisknut a podren jednoho z tlatek zmn datum v rychlm poad.
Nastaven msta1.Stisknte opt tlatko MODE/LOCK e. Na displeji g blik zobrazen pro zkratky mst pod zobrazenm LOCAL CITY.
2. Stisknte tlatka DOWN/UP i/o pro nastaven asov zny za pomoc msta resp. Vaeho piblinho msta pobytu. Stisknut a podren jednoho z tlatek zmn rychle zobrazen. Zde naleznete pehled o nastavitelnch mstech a aso-vch diferenc:Zkr. Dif. MstoHNL -10 Honolulu/USAANC -9 Anchorage/USAYVR -8 Vancouver/KanadaLAX -8 Los Angeles/USADEN -7 Denver/USACHI -6 Chicago/USAMEX -6 Mexico City/MexicoNYC -5 New York/USAYYZ -5 Toronto/KanadaYUL -5 Montreal/KanadaCCS -4 Caracas/VenezuelaRIO -3 Rio De Janeiro/BrazlieBUE -3 Buenos Aires/ArgentnaUTC 0 Universal Time
CoordinatedLON 0 Londn/VBBER +1 Berlin/NmeckoPAR +1 Pa/Francie
BDA_SPU 900 A1 - TOZ-75878_4_cz.indd 31 11.06.2012 11:22:12
-
- 32 -
Zkr. Dif. MstoROM +1 m/ItlieCAI +2 Kairo/EgyptIST +2 Istanbul/TureckoMOW +3 Moskva/RuskoKWI +3 Kuwait City/KuwaitDXB +4 Dubai/Saudsk ArbieKHI +5 Karachi/PakistnDAC +6 Dacca/BangladBKK +7 Bangkok/ThajskoSIN +8 SingapurHKG +8 Hong KongPEK +8 Beijing/naSHA +8 Shanghai/naTYO +9 Tokyo/JaponskoSYD +10 Sydney/AustrlieNOU +11 Noumea/
Nov KalednieAKL +12 Auckland/
Nov Zland3.Stisknte tlatko SNOOZE/DIMMER y,
pro zapnut nebo vypnut letnho asu zvolen asov znyny. Na displeji g se pimen objev SUM ON resp. SUM OFF.
Nastaven svtovho asu1.Stisknte opt tlatko MODE/LOCK e. Na displeji g blik zobrazen pro zkratky mst pod zobrazenm WORLD CITY.
2.Stisknte tlatka DOWN/UP i/o pro nastaven svtovho asu.Stisknut a po-dren jednoho z tlatek zmn rychle zobrazen. Tak zde plat nahoe zobra-zen pehled o nastavitelnch mstch a asovch diferencch.
3. K nastaven letnho asovho posunu pro zvolen svtov as, stisknte opakovan tlatko SNOOZE/DIMMER y.
asov posun Displej Vysvtlen
1 OFFSET 1 Ve Vaem asovm psmu (Local City) je zimn as a v nastavenm svtovm asu je prv letn as.
asov posun Displej Vysvtlen
0 OFFSET 0 Ve Vaem asovm psmu (Local City) a v nastavenm svtovm asu je prv letn resp. zimn as.
-1 OFFSET -1
Ve Vaem asovm psmu (Local City) je letn as a v nastavenm svtovm asu je prv zimn as resp. nem letn as.
Nastaven funkce pipomenutMete naprogramovat a 10 daj, na kter Vs pstroj me upozornit pi jejich dosaen.
1. Stisknte opt tlatko MODE/LOCK e. Na displeji g blik datum a zobrazen SDA 1 pro datum pipomenut 1.
2.Stisknte tlatka DOWN/UP i/o pro nastaven prvnho danho datumu pipomenut. Stisknut a podren jednoho z tlatek zmn rychle zobrazen.
3.Pokud stlate tlatko SNOOZE/DIM-MER y, dektivuje se slo roku, m se tento datum pipomene potom kad rok.
4. Pokud chete naprogramovat dal data, stisknte tlatko PAGE/AL.SET f pro zvolen poadovanho pamovho msta 2-10.
5. Postupujte s dalmi daty stejn.6. K deaktivaci funkce pipomenut napro-
gramujte datum, kter u uplynul.Nastaven funkce UpdateTouto funkc me pstroj nastaven asu automaticky aktualizovat na zklad dat RDS.
1.Stisknte opt tlatko MODE/LOCK e. Na displeji g se zobraz UPDATE ON.
2. Stisknte tlatko DOWN i pro deaktivaci funkce aktualizace. Na displeji g se potom zobraz UPDATE OFF.
3.Stisknte tlatko UP o pro optovnou aktivaci funkce aktualizace.
Nastaven asu pro dmac funkci1. Stisknte opt tlatko MODE/LOCK e.
Na displeji g se zobraz SNOOZE 09.
BDA_SPU 900 A1 - TOZ-75878_4_cz.indd 32 11.06.2012 11:22:12
-
- 33 -
2. K nastaven poadovanho asovho intervalu dmac funkce mezi 1-59 minu-tami, stisknte tlatko DOWN/UP i/o.
Nastaven 12- nebo 24hodinovho reimu1. Stisknte opt tlatko MODE/LOCK e.
Na displeji g se zobraz 24HR.2.Pro nastaven 12 hodinovho reimu
stisknte tlatko DOWN i. Na displeji g se objev 12HR.
3.Stisknte tlatko UP o pro optovn pepnut na 24 hodinov reim.
Nastaven projekn doby1. Stisknte opt tlatko MODE/LOCK e.
Na displeji g se zobraz PROJ-T OFF.2.Stisknte tlatka DOWN/UP i/o pro
nastaven projekn doby od 1 - 59 mi-nut. V nastaven OFF svt projekce trvale a lze ji stisknutm tlatka PROJECTION-a zapnout resp. vypnout.
Projekce pi alarmu1. Stisknte opt tlatko MODE/LOCK e.
Na displeji g se zobraz PROJ-AL OFF.2. Pokud se bhem alarmu m automaticky
zapnout projekce, pak stisknte tlatko UP o.
3. Stisknte tlatko DOWN i, chcete-li tuto funkci stmvae opt deaktivovat.
Automatick zmny jasu displeje1. Stisknte opt tlatko MODE/LOCK e.
Na displeji g se zobraz DIM-T OFF.2. Pokud m displej stmavnout v urenm
ase, stisknte tlatko UP o. Na displeji g se pak zobraz DIM-T ON.
3. Stisknte tlatko DOWN i, chcete-li tuto funkci stmvae opt deaktivovat.
Nastaven asu zmny j displeje1. Stisknte opt tlatko MODE/LOCK e.
Na displeji g se zobraz DT 23:00 ON jako as, ve kterm displej automaticky stmavne.
2. K nastaven jinho asu stisknte tlatka DOWN/UP i/o.
3. Stisknteopt tlatko MODE/LOCK e. Na displeji g se zobraz DT 6:00 OFF jako as, ve kterm se m displej zobrazit
opt v normlnm jasu.4. K nastaven jinho asu stisknte tlatka
DOWN/UP i/o.Stisknte opt tlatko MODE/LOCK e pro ukonen tohoto nastaven.
Funkce asovae1.Stisknte tlatko NAP/USER k. Na
displeji g se zobraz zobrazen NAP a ukazatel asu 010 blik.
2.Nastavte tlatky DOWN/UP i/o -dan as (mon je as od 1 minuty do 23:59 h).
3.Stisknte opt tlatko NAP/USER k pro sputn asovae. Na displeji g se zobraz zbval as.
4. Jakmile uplyne as, zazn na cca. 10 minut signl asovae, zobrazen NAP blik a zobraz se as.
5. K ukonen alarmu stisknte libovoln tlatko pstroje.
6.Chcete-li funkci asovae ukonit jet ped alarmem, podrte tlatko NAP/USER k na jednu sekundu stlaen.
Funkce buzen (alarm 1 a 4)vam budkem s rdiem mete naprogramo-vat a tyi doby buzen. Pokud se bhem cca.15 sekund nestiskne tlatko, ulo pstroj nastaven do pamti a opust modus nasta-ven.
1.K vyvoln funkce buzen stisknte pi vypnutm rdiu tlatko PAGE/AL.SET f.Tlatky PRESET/ALARM +/ s/d zvo-lte poadovan pamov msto alarmu. Na displeji g blik naposledy nastaven as buzen a symbol zpsobu alarmu (r-dio nebo signl).
2.Stisknte tlatka DOWN/UP i/o pro nastaven poadovan doby buzen. Podrenm jednoho z tlatek DOWN/UP i/o se zmn doba buzen v rychlm sledu.
3.Stisknte tlatko PAGE/AL.SET f tak dlouho, dokud se na displeji g nezobraz poadovan as buzen (viz tabulku).
BDA_SPU 900 A1 - TOZ-75878_4_cz.indd 33 11.06.2012 11:22:13
-
- 34 -
Funkce buzen Symbol na dis-pleji g
Zvukov signly
Rdio
Vypnuto bez symbolu4.Stisknte tlatko SNOOZE/DIMMER y
pro nastaven dn v tdnu, ve kterch si pejete vzbudit: Mete volit mezi dny v tdnu (MON, TUE, WED, THU, FRI), vkend (SAT, SUN) a v kad den (MON, TUE, WED, THU, FRI, SAT, SUN).
5.Drte tlatko SNOOZE/DIMMER y stlaen 2 sekundy, jestli-e si pejete bt vzbuzeni v urit den v tdnu. Pro na-staven tohoto dne v tdnu stisknte opa-kovan tlatko SNOOZE/DIMMERy. Orientujte se pitom dle zobrazen dn v tdnu na displeji vpravo nahoe: MON = pondl TUE = ter WED = steda THU = tvrtek FRI = ptek SAT = sobota SUN = nedle
6. Chcete-li se vrtit zptky k volb pracovnch dn, vkendu nebo celho tdne, znovu krtce stisknte tlatko SNOOZE/DIM-MER y po dobu 2 sekund.
7. Po cca. 15 sekundch se displej g navrt do zobrazen hodinovho asu. Nastaven funkce buzen je nyn uloeno do pamti a se zobraz.
8. Pp.zbval pamov msta pro doby buzen naprogramujte stejnm zpsobem.
9. Pokud chcete bt buzeni rdiem, tak zapnte nyn rdio a zvolte poadova-nou vyslac stanici. Pot nastavte hlasi-tost, kter se m pi buzen maximln doshnout. Funkce rdia je vysvtlen na dal strnce.
Jakmile zazn alarm... ... a je-li zvolen funkce buzen rdio,
se na jednu hodinu zapne rdio se zvyujc se hlasitost a naposledy nastavenou vysla-c stanic.
... a je-li zvolen funkce buzen Signl, zazn signly po dobu 10 minut stoupajc hlasitost.
Pro ukonen dan funkce buzen stisknte libovoln tlatko s vjimkou tlakta SNOOZE/DIMMER y.
Dmac funkceKdy stisknete tlatko SNOOZE/DIMMER y, vypne se prv aktivn alarm pro dobu, kter byla nastaven pro tuto funkci (viz odstavec Nastaven doby pro dmac funkci, 1 - 59 min., standardn hodnota = 9 min.). Mezitm svt zobrazen SNZ na displeji g. K trvalmu zruen peruenho alarmu stisk-nte jednou krtce tlatko PAGE/AL.SET f.
Upozorovac funkcePstroj Vs upozorn na datum, kter jste nastavili upozorovac funkc. V tomto p-pad se vyd v tento den od 8:00 - 23:00 v kadou plnou hodinu vollen na 10 minut pipomnac alarm. K tomu blik zobrazen SDA na displeji g.
Pro ukonen pipomnacho alarmu stisknte libovoln tlatko.
Nastaven stdavch zobrazen displejeKdy je pstroj ve stavu Standby, stisknte tlatko DOWN i. Na displeji se objev D (pro hodinov as a datum). Stisknete-li opt tlatko DOWN i, tak se na displeji objev W (pro hodinov as a svtov as). Stisknete-li opt tlatko DOWN i, tak se na displeji objev DW (stdav pro hodinov as- datum - svtov as). Stisknete-li opt tlatko DOWN i, tak se na displeji objev (pouze hodinov as).
BDA_SPU 900 A1 - TOZ-75878_4_cz.indd 34 11.06.2012 11:22:13
-
- 35 -
ProvozrdiaTechnick vlastnost pstroje umouj nasta-viteln frekvenn psmo mimo povolenho frekvennho psma 87,5 - 108 MHz resp. 526,5 - 1606,5 kHz. V rznch zemch se mohou vyskytovat odlin nrodn pedpisy k pidlenm rdiovm frekvennm psmm. Upozorujeme Vs, e informace pijman mimo pidlen rozhlasov kmitotov psma je zakzno komern vyuvat, pedvat tetm osobm nebo je jinak zneuvat. Pro dobr rdiov pjem VKV vythnte laskav celkem vysunovac antnu 2) a zjistte v provozu nejpznivj smr vyrovnn. Pro pjem SV m pstroj vlastn zabudovanou antnu. Pro zlepen pjmu SV otote pstroj do nejpznivjho smru vyrovnn.
Funkci rdia zapnout/vypnout1.Stisknte tlatko l. Na displeji g
se zobraz aktuln frekvence a symbol zapnut . Vedle blik symbol hodin, co ukazuje, e pstroj ek na penos aktul-nho asu z vyslac stanice RDS.
2.Stisknte opt tlatko l pro ukonen funkce rdia a uveden pstroje do reimu Standby.
Run nastaven stanic1. Psmovm tlatkem u zvolte dan
psmo rdia, SV (AM) nebo VKV (FM).2.Stisknte tlatko UP o pro vyhledvn
vyslacch stanic s vy frekvenc, ne je zobrazen na displeji.
3. Stisknte tlatko DOWN i pro vyhled-vn vyslacch stanic s ni frekvenc, ne je zobrazen na displeji.
4. Pen-li prv nastaven vyslac stanice data RDS, svt zobrazen na displeji g. Pot se na displeji g zobraz nzev rdiov stanice a aktualizuje se hodinov as (pokud se pi nastaven aktivoval, viz odstavec nastaven funkce Update).
Automatick vyhledvn stanicTak mete nechat pstroj samostatn vyhledvat vyslac stanice. Pot prohled budk s rdiem zvolen frrekvenn psmo, dokud nenael jednu vyslac stanici.
1.Drte tlatko UP o stisknut dv sekundy: Budk s rdiem vyhledv stanici s nej-blim vym kmitotem.
2.Drte tlatko DOWN i stisknut dv sekundy: Budk s rdiem vyhledv stanici s nejblim nim kmitotem.
Tyto kroky opakujte, a naleznete hledanou stanici.
Uloen vyslac stanicePro 2 uivatele mete v pstroji jako favo-rity uloit do pamti po 20 VKV vyslacch stanic a po 12 SV vyslacch stanic. Tyto pamti se rrozlen na vce stran, kter m-ete vyvolat tlatkem PAGE/AL.SET f. Na kad stran nalznou msto 4 vyslac stani-ce, kter mete aktivovat tlatky PRESET/ALARM +/- s/d.
1.K vyvoln poadovan strany pamti 1-5 stisknte pi zapnutm rdiu tlatko PAGE/AL.SET f. Na displeji g se pod PAGE objev slo prv zvolen strany pamti.
2. Nastavte poadovanou rozhlasovou stanici.
3.Stisknte krtce tlatko A.M.S. MEMO-RY h. Na displeji g blikaj cifry a zobra-zen pamovho msta MEM.
4. Tlatky PRESET/ALARM +/ s/d zvolte nyn to msto , na kter se vyslac stanice m uloit. Potvrte tlatkem A.M.S. ME-MORY h. Te je vyslac stanice uloe-n do pamti a vdy se zobraz.
5.Protoe pstroj me pouvat vce osob, m k dispozici funkci pepnut uivatele. Oba uivatel mohou tak uloit do pamti rzn vyslac stanice. Pro pe-pnut pslunho uivatele drte stlaen tlatko NAP|USER k na dv sekundy. Pslun aktivn uivatel A nebo B se zobraz na displeji g.
BDA_SPU 900 A1 - TOZ-75878_4_cz.indd 35 11.06.2012 11:22:13
-
- 36 -
6. Opakujte kroky 1 - 4 (pro oba uivatele), dokud se do pamti neulo vechny da-n vyslac stanice.
AMS (Automatic Memory System)Funkc AMS hled rdio automaticky roz-hlasov stanice a ukld tyto na lonch mstech.
Drte tlatko A.M.S. MEMORY h na dv sekundy stlaen. Budk s rdiem vy-hledv automaticky dostaten siln roz-hlasov stanice a ukld tyto do pamti.
Aktivace stanice1. Pro vyvoln do pamti uloench vys-
lacch stanic zvolte v reimu rdio nejd-ve poadovanho uivatele.
2.Nyn zvolte tlatkem PAGE/AL.SET f danou stranu pamti.
3. Tlatky PRESET/ALARM +/ s/d zvolte pamov msto poadovan vyslac stanice.
Nastaven hlasitosti Stisknte opakovan v reimu rdia tlatko
Vol. q ke snen hlasitosti. Vpravo na displeji g se zobraz aktuln hlasitost ve krocch od V 0 - 18.
Stisknte opakovan tlatko Vol. + w ke zven hlasitosti.
asova vypnutPstroj m k dispozici asova vypnut pro max. 90 minut.
1.Stisknte tlatko SLEEP j pro vyvoln funkce a pp. zapnut rdia.
2.Stisknte opt tlatko SLEEP j pro zad-n zbytkov doby chodu v 10-ti minuto-vch krocch. Po nkolika sekundch se opt zobraz frekvence pjmu.
3.Na displeji g svt zobrazen Sleep .4.Stisknte kdykoliv tlatko SLEEP j pro
zobrazen nkolika sekund aktuln zbytkov doby chodu.
5. Po uplynut doby se pstroj vypne.6.Pro pedbn vypnut asovae vypnut,
stisknte tlatko l.
Pepnn a stmvn displejeJas displeje mete nastavit ve tech stup-nch stisknutm tlatka SNOOZE/DIMMER y : svtl, stedn, vypnut. m vt jas, tm vy je spoteba energie pstroje.Stisknete-li v rdiovm provozu krtce tlatko MODE/LOCK e, tak pepnte mezi zobra-zenm frekvence a asu.
ProjekceHodinov as si mete nechat pstrojem projektovat na stnu nebo strop. Tato funkce je mylen pro odeten asu ve tm. Pes den v dobe osvtlench prostorech se projekce ned takka vbec pouvat. Pi zapnut projekci svt na displeji g symb
top related