masterclass 7 july 2008 - university of nottingham€¦ · masterclass 7 july 2008 biology and...
Post on 11-May-2020
1 Views
Preview:
TRANSCRIPT
Masterclass 7 July 2008
Biology and Technology
2
General Introduction
Welcome to the Masterclass – Biology and Technology. This
information pack includes introductions to the people who will be working with you today and summaries of the activities you will
participate in. It also contains important information about how to
keep safe during today’s activities.
Timetable
Table of Contents
PEOPLE INVOLVED 3
SAFETY AND RESPONSIBILITY 4
EVOLUTION AND CLASSIFICATION 6
MODELING BIODIVERSITY 14
ELECTRON MICROSCOPY AND NANOSCIENCE 21
FURTHER INFORMATION AND LINKS 24
Time Activity Location
11.00-11.10 Arrival/Housekeeping/Agenda/coffee Maths and
Physics Foyer
11.10-11.30 Mini lecture by Dr. Tom Reader Maths and
Physics A1
11.35-12.45 Evolution and Classification Pope A26
12.50-1.30 Lunch and info on courses Maths and
Physics Foyer
1.35-2.45 Modeling Biodiversity Pope A26
2.50-3.50 Electron microscopy with Dr. Michael Fay NNNC
3.50-4pm Question and Answer Session Maths and
Physics A1
3
People involved
Dr. Tom Reader is a lecturer in ecology. He studied for his BSc at Lancaster University, completed his PhD at Cambridge University,
and then worked at the University of Sydney before coming to the
University of Nottingham. He studies population and community
ecology and animal behaviour. He has always been keen to
communicate his research to a wider audience, and his outreach
experiences have included TV and radio appearances, school visits
and contributions to various public events.
Dr. Michael Fay is responsible for the electron microscope suite at
the NNNC. He studied for his BSc at Leicester University, an MSc at Warwick University, and completed his PhD at Sheffield University
before coming to the University of Nottingham in 2000. He originally
worked on electron microscopy of semiconductors, but now looks at a
wide range of materials from spider silk to pharmaceuticals to carbon nanotubes.
Pamela Styles is originally from Birmingham, where she completed
A levels in Biology, Chemistry, Maths, General Studies and an AS
level in French. She completed a degree in Genetics at the
University of Nottingham, and decided to stay to do a PhD in
Genetics. She is now in the second year of a computer-based PhD
research project on "the Evolution of Mobile DNA".
Tim Newbold is a PhD student in conservation ecology. He
completed his undergraduate degree in Zoology at Nottingham, before travelling to Egypt to study its biodiversity for a year. He then
returned to Nottingham to begin his PhD, continuing to work on the
biodiversity of Egypt.
Rohanna Dow is a PhD student in Biology. She completed A-levels
in Biology, Chemistry and English and an AS level in Physics before studying for a BSc in Zoology at the University of Nottingham. After
completing her degree, she took two years out to travel and work.
She is now working on a PhD investigating mimicry within natural
and computer generated habitats.
4
Safety and Responsibility
We want to make sure your visit to the University of Nottingham is
as safe and interesting as possible. Please read the notes below and, while on campus today, please ensure you follow all instructions from
your teachers and the researchers leading the activities.
Please be aware of where you and your belongings are at all times.
In every building you visit, you will be told where the nearest emergency exit is. If you hear an alarm, please make your way
quickly and calmly to the exit.
No bags or coats should be taken into laboratories. In laboratories, please do not touch any equipment unless you are specifically invited
to do so.
When using computers on campus, you have a responsibility to act in
accordance with the University’s Code of Practice (next page).
Please read this. If you do not agree to the Code of Practice, you
must not use the computers at the University of Nottingham.
If at any point in the day you are injured, you must inform the researcher you are working with or another member of staff
immediately. Certified First Aiders will be available to help you.
Thank you very much. With your cooperation we can have a safe
and productive day. A full risk assessment has been completed for
today’s activities. If you would like to see a copy, please ask.
5
IT
6
Evolution and Classification
In this section you will:
� Learn how to make an evolutionary tree of species by sequence
searching, extraction and running the tree-building programs
to investigate how species are related.
� Explore why classification of organisms is important, and how
humans are classified. Identify species and relationships by
examining skulls and bones
Using Computers to Make Evolutionary Trees
1. Double click on the Novell Application Launcher (NAL) icon on
the desktop.
2. In the left hand pane, click on School and Departmental ���� Biology ���� Fundamentals of Molecular Evolution. Three icons
will appear in the right hand pane: ClustalX, NJ Plot and Protpars
(Figure 1). We will be using ClustalX and NJ Plot today. You can minimise NAL for now, but keep it open.
Figure 1
7
3. Open an Internet Explorer browser window by double clicking on
the Internet Explorer icon on the desktop.
4. Type in the following address:
http://www.pubmed.com
This will take you to the National Centre for Biotechnology
Information (NCBI) website. Through this website, you can access
most of the publicly available DNA and protein sequence data. This is
freely accessible to anyone.
5. On the bar along the top, select “Protein” from the drop down list
next to Search (Figure 2).
6. If you are making the bacteria tree, you will be using the S12 protein, which is a component of the 30S subunit of the bacterial
ribosome. To locate this protein, try searching with something like
“Bacillus anthracis S12 30S”.
Step 6: Type the protein you
want to search for in this box
Step 5:
Select Protein
Step 6: Then
click Go to
search for your
protein
Figure 2
8
For the mammal tree, you will be using the amelogenin protein.
This protein is a major component of tooth enamel. Type in the name of the species and the protein name, e.g. “dog amelogenin”, or
“Canis familiaris amelogenin”. Then click Go (Figure 2).
7. A list of search results will appear. The one you want should be
near the top! The name of the protein and the name of the species
will usually appear. When you’ve found the protein you want, click on
the reference number in blue (Figure 3).
8. Details about this protein will come up, such as what species it’s
found in and the names of the authors who submitted the sequence
(Figure 4).
This format is called GenPept format, and contains more information
than we need to make a tree. The sequence format is shown in the
top left (GenPept). Click on the arrow and select “FASTA” from the
drop down list (Figure 4). Fasta is a much simpler file format. It
consists of a “>” symbol, followed by a description of the sequence. Underneath this descriptive line is the amino acid sequence, e.g.
Step 7: Click on the
blue reference number
to open up the
database record for this
protein
Figure 3
9
>Human Amelogenin MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMG
GWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQ
PNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDL
TLEAWPSTDKTKREEVD
9. The sequence will appear (Figure 5), and in most cases will begin
with “M” (methionine). All protein sequences start with methionine.
Where the sequence in the database starts with a different amino
acid, this might mean that part of the protein is missing. Clustal will
introduce a gap to account for this if it is the case. Select the amino
acid sequence and copy it.
Unique database
reference number
Species
Classification of the
species
Length of protein
(117 amino acids)
Some information
about the animal
the sequence came
from
Name of the protein
What the protein does
Step 8: Select
FASTA from this list
Figure 4
10
The Fasta descriptive line produced by the database is usually long
and complicated, so don’t copy it over. Just copy the sequence. You will be able to add your own name for the sequence.
10. Open Notepad (Start � Programs � Accessories � Notepad).
Paste in your amino acid sequence. On the line above it, type “>”
and then give your sequence a title. This title is what will appear on
the tip in your tree, so it is best to give it the name of the species the
sequence came from, e.g. “Dog”, or the disease caused by the bacterium it comes from, e.g. “Anthrax” (Figure 6).
11. Return to the Internet Explorer browser window. Click the back button until you return to the screen shown in Figure 7.
Now repeat stages 6-10 to search for, copy, and paste into your
notepad file, the other sequences you need for your tree.
The FASTA
descriptive line
FASTA
sequences
always begin
with a > symbol
Amino acid sequence
Figure 5
Figure 6
11
12. When you have all six sequences in a notepad file, with no spaces between them (Figure 8), you are ready to make the tree.
Save the file, for example, “amelogenin.txt”, “mammals.txt” or
“bacteria.txt”. Save it in the My Documents folder.
13. Return to the NAL window (Figure 1). Double click on the ClustalX icon. This opens the ClustalX alignment program. Go to File ���� Load sequences, and then browse to find your notepad file
with the sequences in it. Click on it, then select “Open”. Your sequences should appear in the ClustalX window.
Figure 7
Figure 8
12
14. Now you need to align your sequences. Go to Alignment ���� Do
complete alignment. A box will pop up. Click on “Align”. You will notice that dashes (-) are introduced where the program believes
insertions and deletions have occurred. Asterisks (*) along the top of
the sequences indicate positions which have the same amino acid in
all six species.
15. Now that the sequences are aligned, you are ready to make a
tree. ClustalX has another program incorporated into it, called
Neighbour Joining (N-J). This is a “phylogenetic reconstruction”,
or tree-building program. Go to Trees and click on “Correct for multiple substitutions”. Click on Trees again, and select “Bootstrap N-J Tree” (Figure 9).
16. A window will appear asking how many bootstrap replicates you
want, and what to call the output file (Figure 10). The default values are fine, so just click on OK. NJ will do 1000 bootstrap replicates by
default.
Figure 9
Figure 10
13
17. When your tree is ready, a message will appear in the bottom left
of the ClustalX window to say your tree has been created. You can now return to NAL, and open NJ Plot. This will allow you to view
your tree.
18. In NJ plot, go to File ���� Open. Then find the tree file that N-J
has created. It will end in the file extension “.phb”, so if you called your original file “mammals.txt”, your tree will be called
“mammals.phb”.
19. Select your phb file and click open. Your tree will appear. This
tree is unrooted, and you need to let NJ Plot know which species to
use as outgroup for it to draw the tree correctly. Click on “New outgroup” at the top, and hashes (#) will appear next to the species’ names. Click on the hash # next to the species you wish to
use as outgroup (Pyrococcus furiosus or Opossum). Then click on
“Show tree”.
20. You can also click on “Bootstrap values”. The number of
bootstrap replicates (out of 1000) which support that branch will be shown above the branch. Anything over 50% (500) isn’t bad, over
70% (700) is very good.
Questions
Bacteria: What kind of bacterium do you think plague evolved from?
----------------------------------------------------------------------------
Mammals: What are humans’ closest relatives outside of the
primates?
----------------------------------------------------------------------------
14
Modeling Biodiversity
In this section, you will:
� Discuss how we might measure biodiversity and how we might
use this knowledge to decide which areas of the world most
need conserving.
� Consider what determines where a species is found and how
we can model this using computers.
� Create your own species distribution model using specialist
software called Maxent.
Biodiversity
Biodiversity is a term used to describe the variety of life on Earth.
Conservationists generally agree that we should try to conserve as
much biodiversity as possible given the resources available. But how
might we measure biodiversity?
A common measure of biodiversity is species richness. This is simply
the total number of species found in a particular place and is
relatively easy to calculate, making it useful for deciding which areas
to save. Working with the person sitting next to you, try to answer the following questions. We will discuss them together shortly:
1. Some habitats have more species than others. Try to list some
habitats that have lots of species and some that have few.
15
2. Can you think of any problems with using species richness to
decide which areas need to be conserved? Will all species be conserved equally well?
If scientists have been to a place, they can estimate the number of
species found there. However, many areas have never been visited,
often because they are very difficult to get to. We need some way of predicting the diversity of unknown sites from what we know about
the places that we have already visited. To do this, we need to
understand what affects where species live.
Species Distributions
Some species live in tropical rainforests, some in the Arctic, while
others live in the desert. What determines where a species is found?
Working in pairs again, list as many things as you can think of that
might affect whether a species can live in an area or not.
16
Modelling Species Distributions
Computer models attempt to capture and explain the important
aspects of real-world situations. In the case of species distributions
we attempt to find what determines the distribution of a species so
that we can predict whether the species will occur in places that have
never been visited before.
Computer models almost always simplify the real world, especially
when they are trying to explain biological processes. Where a species
is found may be determined by many factors (some of which we discussed previously). All we can hope to do is use as many factors
as possible. This means that the model predicts where a species
could be found, not where it is found.
Species distribution models take a list of sites where a given species
has been recorded. Information on climate, habitat and other
environmental factors (usually worked out from satellite images) at
these sites is used to build up a picture of the environmental
conditions that the species lives in. This is then applied to the
environmental conditions of unknown areas to predict whether the
species could live there.
Building Your Own Species Distribution Model
All the files that you need for the practical today can be found in the
C:\Masterclass folder on your computer.
In there you will find some picture files (the file type is jpeg). These show maps of sites where species have been seen and also maps of
some environmental variables (climate and habitat). Have a look at
these and see if you can spot any patterns in the environmental
conditions of the places that species are living in.
Now to build your model. The software that you need is also in the
C:\Masterclass folder.
1. Double click on the file called Maxent (there are 2 files with the same name – you need to click on the one that has the
file type ‘MS-DOS Batch File’). You should get a window like
the one shown below:
17
2. Next choose one of the four species to model. The sites that
these species have been seen in are listed in the Excel files
(Red Fox, Lesser Gerbil, Dorcas Gazelle and Jungle Cat) with
file type ‘Microsoft Office Excel Comma Separated Values
File’.
3. You need to load the samples that you have chosen into the
Maxent software. Click on the ‘Browse’ button next to the
‘Samples’ box, navigate to the C:\Masterclass folder and
double-click on the file for your chosen species.
4. Next you need to load the environmental variables. These
are found in the ‘Variables’ folder within the C:\Masterclass
folder. Click ‘Browse’ next to the ‘Environmental Layers’ box,
navigate to the C:\Masterclass folder, click once on
‘Variables’, then click ‘Open’.
5. The habitats variable is divided into categories, so in the list
of environmental variables you need to change the box next
to habitats so that it says ‘categorical’. 6. Click on the boxes next to ‘Create response curves’ and
‘Make pictures of predictions’ so that the boxes are checked.
18
7. Click on the ‘Browse’ button next to the ‘Output directory’
box, navigate to the C:\Masterclass folder again, click once on the folder called ‘Model’ and click open. Your model will be
saved in this directory.
8. Finally, click ‘Run’ and your model will begin.
9. When the boxes showing model progress (as shown below) have disappeared, your model is finished. This should only
take a couple of minutes.
10. If you get a warning message that says ‘Sample at …………. in ………….. is out of bounds, skipping’ then click ‘Suppress
similar warnings’.
11. If you get a warning message that says ‘Sample at ……….. in
species.csv is missing some environmental data’ then click
‘Ignore such samples (safer)’.
12. Leave the Maxent software window and return to the
C:\Masterclass folder. Then double-click on the folder called
Model.
13. There should be an internet file with the same name as the
species you just modelled (e.g. Jungle_cat, Lesser_gerbil
etc.). Double-click on this file.
14. If you scroll down, you should be able to see a map of the
predicted distribution, where the environment is suitable for your chosen species. Warm colours (red and orange) show
very suitable places. Cool colours (blue and green) show less
suitable places. The white dots show places where the
species has been seen (the places that you used to make your model).
15. If you scroll down further you will see graphs showing the
relationship between where your species was seen and the
environmental variables.
19
What Can We Use the Models For?
Working in pairs again, have a think about what the models tell us
about the species. What does your model show?
How could we use the models?
20
How do you think that we could improve the predictions?
If you like, you can e-mail the map to yourself. It is a PNG file with
the same name as your species and is found in
‘C:\Masterclass\Model\plots
21
Electron Microscopy and Nanoscience
In this section, you will:
� Visit the Nottingham Nanotechnology and Nanoscience Centre
(NNNC)
� Hear a brief lecture about electron microscopy and nanoscience and view nano-scale images taken at the centre.
� Get an in-depth look at state of the art scanning and
transmission electron microscopes (SEM and TEM) and see
them in action.
� Tour the NNNC, including the atomic force spectrometry suite
and the PEEM lab (proton emitting electron microscope).
What is Nanoscience?
“Nanoscience and nanotechnology involve studying and working with
matter on an ultra-small scale. One nanometre is one-millionth of a
millimetre and a single human hair is around 80,000 nanometres in width. Nanoscience and nanotechnology encompass a range of
techniques rather than a single discipline, and stretch across the
whole spectrum of science, touching medicine, physics, engineering
and chemistry.
Nanomaterials can be natural or manmade. For example,
nanoparticles are produced naturally by plants, algae and volcanic
activity. They have also been created for thousands of years as
products of cooking and burning, and more recently from vehicle
exhausts. Some proteins in the body, which control things like flexing
muscles and repairing cells, are nanosized. We can set out to make
nanomaterials in a variety of different ways. Some nanomaterials can
assemble themselves from their components. Carbon fragments, for
example, can self-assemble into nanotubes in this way. Another
approach, used in the production of computer chips, is to etch
nanomaterials from larger pieces of material. Increasingly, these two
methods are converging, leading to exciting new production
techniques.
Powerful microscopes have been developed which allow
researchers not only to look more closely at atoms and molecules,
but also to pick them up and move them around to form basic
nanostructures. This allows some nanomaterials to be built molecule by molecule. For instance, this technique was used to manipulate
atoms to spell out the IBM logo. However at present this technique is
extremely laborious and unsuitable as an industrial process.”
- The Royal Society
http://royalsociety.org/page.asp?id=1211
22
Electron Microscopy
SEM operated by Dr Hannah Edwards
The FEI Quanta200 3D DualBeam FIB/SEM uses a focussed ion
beam (FIB) and scanning electron microscope (SEM) to image,
analyse and process samples. Both the ion beam and the electron
beam can be scanned across the sample with information (such as
scattered electrons or X-rays) measured for each point and plotted
on the computer screen. The ion beams, which have a resolution
down to 10nm, can be used to very accurately sputter material from
the sample. This means that cross-sections can be made at specific features of interest and analysed using the SEM, or by making a
sample with a very thin (~100nm) region, prepared for analysis
using the transmission electron microscope. This technique is
particularly useful for samples which contain materials of very
different hardness, such as biological cells on metals or ceramics.
The FIB/SEM is equipped with a Quoruom Technologies PP2000T
Cryo transfer system, which allows frozen samples to be prepared in a similar manner. This means that biological samples, food, oils or
even liquids can be frozen to -140 degrees C, cross-sectioned and
analysed.
23
TEM operated by Dr Mike Fay
The JEOL 2100F Transmission electron microscope (TEM) has a point resolution down to 0.19nm, which means that individual large
atoms can be seen. Using very thin (~100nm) samples, the 200 kV
electron beam passes through the sample to produce images that
can be recorded on a specialised high-resolution digital camera. The
microscope also has a spectrometer than measures the energy of the
electrons, and Scanning Transmission Electron Microscopy (STEM),
which combines the abilities of SEM and TEM in one instrument. By
measuring X-rays emitted from the sample, or the energy of
electrons after they have passed through the sample, the elemental
composition of samples can be measured at scales down to 1 nm resolution. Special holders allow samples to be frozen with liquid
nitrogen or heated up to 1000 degrees C in the column, reacted with
gases or even analysed with a scanning tunnelling microscope tip
within the electron microscope.
24
Further Information and Links Thank you for coming to the Masterclass! We hope you enjoyed the
day!
For further information on anything you have seen today or details
about studying at the University of Nottingham, please email
scienceoutreachproject@nottingham.ac.uk, or go to the project
website at www.nottingham.ac.uk/sop.
For additional information about any of the departments involved in the Science Outreach Project or today’s event, check out the
following webpages:
School of Biology: www.nottingham.ac.uk/biology
School of Pharmacy: www.nottingham.ac.uk/pharmacy
School of Chemistry: www.nottingham.ac.uk/chemistry
Faculty of Engineering: www.engineering.nottingham.ac.uk
NNNC: http://www.nottingham.ac.uk/nano/
top related