bendigo weekly issue 722 july 29
DESCRIPTION
Bendigo Weekly Issue 722 July 29TRANSCRIPT
-
BendigoWeeklyBendigoWeeklyBendigoWeeklyISSUE 722 FRIDAY, JULY 29, 2011 www.bendigoweekly.com.au
WHITE HOTBy ROSEMARY SORENSEN
ITS being called the ultimate wed-ding party.
This is being watched very carefully right across Australia, Bendigo Art Gallery director Karen Quinlan said this week.
Costume history shows like these are much more challenging to create, but we know that people do love them.
The White Wedding Dress ex-hibition is a world exclusive and the rst time any gallery has been given the go-ahead to curate their
own show from the collections of the Victoria and Albert Museum of London.
The exhibition also marks the 10th anniversary of the completion in 2001 of the nal stages of a ma-jor redevelopment.
It was the addition of gallery spaces, a new cafe and entrance that opened the way for the gallery to become one of the best cultural in-stitutions in Australia.
The gallery has tripled in size since 1996, and is now attracting
more than 150,000 visitors annu-ally. Another $7.55m extension is due to begin later this year.
The gallery is hoping The White Wedding Dress will push past the previous record set by its Golden Age of Couture exhibition in 2008,
which attracted more than 75,000 visitors with an economic boost es-timated at $9.4 million.
On the back of the building im-provements, the gallery has pushed its reputation for curatorial excel-lence by securing exclusive exhibi-tions and ensuring display stan-dards are rst-class.
We are very fortunate to have the Bendigo Art Gallery team to work with, V&A curator Edwina Ehrman said.
Wedding dress showcase puts gallery in world-class league
Continued Page 2Editorial Page 13
ALMOST THERE: Bendigo Art Gallery director Karen Quinlan prepares for the upcoming The White Wedding Dress exhibition at the Bendigo Art Gallery. Photo: BILL CONROY
Visit our website to view our range of designswww.paulgraybuilders.com.au
Paul GrayBuilders
O ce Adress: 132 Mollison St, BendigoPhone: (03) 5444 5054 or Jenny: 0400 823 309
O ce Open Hours: Mon to Fri 9am - 5pm Sat 9am to 12 Noon
b i i f d i O
The Ascot display is CLOSING SOON!
Display Open Hours: Saturday and Sunday 12.30pm to 5pm
or by appointment
Come and visit our friendly team at 132 Mollison Street, Bendigo
2907
79 McIvor Forest Drive
-
2 NEWS www.bendigoweekly.com.au Bendigo Weekly Friday, July 29, 2011
clivepeeters.com.au
211775_BDG
Product offers end 01/08/11
5TOUCHSCREEN
$243Navman MY75T GPS.5 screen, smart find, keyword searches, 3Djunction views, speed limit alerts, advanced laneguidance. 020897
DUAL COREPROCESSOR
$498Compaq Presario CQ43-102AU Laptop.AMD Dual Core 1.60GHz, 6GB RAM, 320GB HDD,DVD burner, 14 screen, Windows 7 Home Premium.LZ763PA, AMI4GB-AMISOD24
HDMOVIE
RECORDING
$98Panasonic Lumix DMC-S1 Digital Camera.12.1 megapixels, 4x optical zoom, 2.7 LCD, lithiumbattery. Available in silver, pink or black. DMCS1GNK/K/PA
BendigoRocklea Homemaker Court,239 High St, Kangaroo Flat
5447 5200
UPGRADED TO
6GB RAM
MUSTENDMONDAY!
2907
172 McIvor Highway, Bendigo
Postal PO Box 324, Bendigo, 3552Fax 5442 5450 Phone 5442 5448Editorial 5440 2544 Sales 5440 2566 Classifieds 5442 1646Web www.bendigoweekly.com.au
CEO Peter Chapman
Editor Anthony Radford [email protected]
Editor (Features) Steve Kendall [email protected]
Editor (Online) Peter Kennedy [email protected]
Sales and Marketing Manager Jess Hourigan [email protected]
The Local PhonebookPhone 1300 850 342 Fax 1300 732 141Web www.thelocalphonebook.com.au
Contact us
12 Letters
26 Down to Business
27 Talking Shop
19 Discover Bendigo
20 Whats This?
28 Classifieds
28 Whos new?
40 Sport
Index
www.bendigoweekly.com.au
BendigoWeekly
Issue 22 Friday, July 29
, 2011pr pertyguidethe
Packed with extras: Page
7 Flawless finish
: Page 27Cathedral vie
ws: Page 27
Vive la differencePage 20
House and land
packages available
our plan or yours!
%DOPDLQ
2207
100 Mitchell St, Bendigo
Offi ce Hours: 9-5 Mon-
Fri or by Appointment
Call Geoff King on 0408
025 684 or 5442 860
3
$JUHDWILQG
32
2
Living 134.92m
2
Garage 38.21m2
Total 173.13m
2
Width 14.25m
Length 14.38m
Crisp Building Enterpri
ses PTY LTD
Priced from $182,951
(18.64sqs.)
Liftout
DAILY LOCAL NEWS UPDATES AT
www.bendigoweekly.com.au
Weekend forecast
Rain totalsThis week 10.6mm This year 471.6mm
FRI Frost then sunny. Min 3 Max 15
SUN Mostly Sunny. Min 4 Max 16
SAT Rain Clearing. Min 5 Max 13
BendigoWeekly
ENTERTAINEDPGs 22 and 23
www.bendigoweekly.com.auNEW LIFE FOR POWNEYS SITE
ONE of Ben-digos highest pro le retail sites will have a new tenant within weeks.www.bendigoweekly.com.au this week revealed that the vacant Powneys News-agency site will re-open on Monday, August 15, and that a newsagency will once again operate from the premises.Powneys closed on April 7 with debts of more than $780,000.Building owner, Bendigo businessman Hugh Norris has been tight-lipped about the future of the site, saying only that the
views of locals was part of his consid-erations into the preferred new tenant.
ACCUSED BOMBER FRONTS COURT
The Castlemaine man accused of stockpiling a large amount of explosives and other materials has appeared in court.Phillip John Marsh, 35, appeared in the Bendigo Magistrates Court today, but did not make an application for bail.Marsh is charged with six offences re-lating to his alleged purchase of bomb-making chemicals and equipment via
eBay. He appeared in an out-of-sessions court hearing before a bail justice in the Castlemaine Town Hall on Tuesday night.He has been remanded to appear in court again next week.
LA TROBE PLANS NEW COURSES
La Trobe Uni-versity has an-nounced plans to offer new courses in the Faculty of Humanities and Social Sciences (FHSS) in response to the needs of business and make it easier for students to stay close to home for their tertiary studies.
The new Bachelor of Strategic Com-munication and Bachelor of Commu-nity Development will be introduced in 2012, together with a Bachelor of Arts degree with a new work-ready compo-nent and a Diploma of Arts.
The introduction of the Bachelor of Com-munity Development means students in-terested in this subject will be able to undertake undergraduate and postgrad-uate studies in Bendigo, as a Master of Community Planning and Development is already available.
The Bachelor of Strategic Communica-tion is the rst industry accredited de-gree in Australia with strategy at its core.
This week on the web...
While we guide the story-line and content, this is the
rst time we have allowed our collection to go to a gal-lery in this way, she said.
Businesses in Bendigo are gearing up for the anticipated in ux of visitors, con dent the new show will build on the success of previous gal-lery blockbusters.
Bendigo Tourism Visitor Services manager Viv Collins said the experience gained from previous gallery events helped them prepare for the three-month White Wedding Dress season.
We trialled our volun-teer meet-and-greet service on the V/Line train from Castlemaine and the number of questions they were being asked tells us its obviously needed, Ms Collins said.
There are 15 new volun-teers on the roster to assist on the trains and at the Informa-tion Hub set up at the Ben-digo Railway Station.
Ms Collins expects demand to build steadily once the show begins next week.
Quest Bendigo, which is working with Bendigo Tour-ism to offer accommodation and ticket packages, is seeing a spike in interest from Mel-bourne visitors.
Last time (The Golden Age of Couture), it was in-
stant, and towards the end it became dif cult for us to keep up, Quest Bendigo marketing manager Casey Wright said.
Were already seeing the bookings coming in and were getting a lot of inqui-ries.
City of Greater Bendigo Tourism executive manager Kathryn Mackenzie said the whole city was holding its breath, waiting to see if the wedding dress show captured the imagination of visitors.
Were expecting that it will appeal to niche markets and were hoping to encour-age young people to come to the city, she said.
There are wedding dresses springing up in all the shops and thats very ex-citing.
It would be great to see all of Bendigo embracing the spirit of the exhibition.
From Page 1
Show unveiled
Gallery highlights emotion
THE frocks are magni cent, but there is much more to the Bendigo Art Gallerys The White Wedding Dress exhibition.
Costume history goes back 2000 years, BAG director Karen Quinlan said.
People are interested in the way we dress because of what it tells them about themselves.
Theres so much emotion at-tached to the wedding day, and what your out t reveals and con-ceals people do care.
The gallery will tonight wel-come the rst of its guests to this glamorous and detailed show, which showcases items dating back 200 years from the Victo-ria and Albert design museum in London as well as Australian gar-ments.
From high-society fashions for grand weddings, to meticulously prepared gowns worn by working women, to outrageous eye-catch-ing creations by contemporary de-signers, this is a show of spectacu-lar contrasts.
We have learnt from earlier shows the importance of the man-nequin and how it is displayed, Ms Quinlan says.
You come into a room that is full of people, and its important we tell their stories.
Following tonights preview, the grand opening on Saturday evening will be followed by a Friends of the Gallery viewing on Sunday before White Wedding Dress opens to the public on Mon-day.
For the rst time, the gallery has organised ticket sales to be linked to sessions, so that visitors who pre-buy can avoid queues.
There are wedding
dresses... in all the shops
SHOW TIME: Conservator Jude Schahinger and curator Keira Miller with a 1933 wedding dress. Photo: BILL CONROY
-
Friday, July 29, 2011 Bendigo Weekly www.bendigoweekly.com.au news3
THE audience were asking for more after this weeks Catholic College Bendigo Year 9 production.
The students performed Oliver!, the ad-aptation of Charles Dickens Oliver Twist this week, and there are two performances to go.
Director Lisa Darlow said the show would be performed at The Capital tonight from 7.30pm and tomorrow from 6.30pm
The inspiration to choose such a well known show as Oliver! came from a Year 8 Drama class that I had the pleasure of teaching in 2010, she said.
This class consisted of 26 enthusiastic and talented young people however, 19 members of this particular class were boys an unprecedented number in a single class.
This meant we needed a show that not only had strong female roles, but a variety of entertaining male characters as well.
Oliver! has a Twist in the tale
Council to issue spot fines for roadside infringement
endtocarsalesBy BEN CAMERON
THE City of Greater Ben-digo council will issue $100 on-the-spot fines for those who park their vehi-cles in public areas to sell.
Following a review of a local streets and road law, and increasing com-munity concern, council will make it illegal for residents to park their ve-hicles on public roadsides and road reserves.
Coun c i l P l a nn i n g and Development direc-tor Prue Mansfield said council received frequent complaints of parked cars
creating a risk to drivers and pedestrians.
It is often unsafe (to park on the roadside), as people stop or slow down to look at the vehicles as they drive past, block off
the area with their cars, she said.
It is often a consid-erable nuisance for the people living near the hot spots.
Council received 51
submissions from the Vasey RSL Village in Kan-garoo Flat in support of penalty infringement no-tices, due to access and traffic and safety con-cerns.
It is already illegal to park cars and other vehi-cles like boats or caravans on the roadside for sale, she said.
The problem is the only way we have of stop-
ping it is to take people to the Magistrates Court, which is a slow and ex-pensive process for both us and the car seller.
It also takes up valu-able court time that we think should be spent on other issues of higher concern to the commu-nity.
Ms Mansfield said council would take an assurance approach to offending motorists, and request they move their car first.
She said it was unlike-ly council would operate a second-hand car yard.
It is often unsafe. It also takes up valuable court time.
MORE: Curtain up tonight at The Capital. Photos: BILL CONROY
Carports Garages Sheds Barns Miners Cottages Lofty 2 storey sheds Machine Sheds Farm Sheds
2907
5448 3099303 Midland Highway, Epsom www.eurekagarages.com.au
See more at our website www.eurekagarages.com.auom au
Supply OnlyBENDIGO REFRIGERATION &AIRCONDITIONING SERVICES
Established 1982205 Midland Highway, Epsom 5448-3999 www.bracs.com.au
2907
$1679Inc GST
Mitsubishi Electric inverter reverse cycle split system air conditionerCooling: 7.1kW Heating: 8.1kW - Model: MSZGE 71 Suitable to Heat and Cool rooms up to 60 sq metres
& COOLINGSPECIAL OF
FER ON
Model AU00852
*Supply Only
3DOO0DOO%HQGLJR3KRQH)RUDOO\RXUFRQYH\DQFLQJDQGOHJDOQHHGVFRQWDFW3HWHU+LOOLHU&UDLJ:DWWVDQG6WHSKHQ%URRNV&219(
-
4 news www.bendigoweekly.com.au BendigoWeeklyFriday,July29,2011
IS COMINGENQUIRE NOW ABOUT FABULOUS CHRISTMAS PARTIESCONTACT [email protected]
ENQUIRE NOW ABOUT FABULOUS CHRISTMAS PARTIESCONTACT [email protected]
171 - 193 McIvor Road, Bendigo Phone: 5443 8166Find us on Facebook
Fortunes Sports Bar
COONFERENCES EVENTS WWEEDDDDIINNGGSS
HAPPYHOURS
THURSDAY & FRIDAYS5.30pm - 7.00pm
SATURDAYS & SUNDAYS1.00pm - 2.00pm
BAR SNACKSTHURSDAYS
JAG THE JOKERSPORTS BARPRIZES & GIVEAWAYS
RAFFLESTHURSDAYS & FRIDAYSUP TO 30 0N FRIDAY NIGHTS
BECOME A MEMBERFOR EVEN MORE DISCOUNTS & GIFTSITS FREE!! ASK IN THE SPORTS BAR9FDBOQJDLZPVVQBOEUBLFZPVIPNFPTUFOIITS
BRAINS!CA$H 4
ON HOLD
WATCH THIS SPACE FOR
RESTART DATES
20% OFF BISTRO MEALS
LUNCH & DINNER
FOR SENIORS
MEMBERS JACKPOT
DOUBLE DRAWJULY 29 - 2 X
$100
PLUS LAUNCH OF NEW MEMBERS C
ARDS
20% OFF MEALS ORDERED BEFORE 6PM
CASH JACKPOT UP FOR GRABS
$100 FOR 1.8.11
MUSIC & SHOWS
FREE BAND PLAYING TO EVERYONE IN THE MAIN ENTERTAINMENT AREAALL WELCOME. BOOK FOR DINNER NOW AND MAKE A NIGHT OF IT.THE GASTRIC BAND (LOCAL)Saturday September 24Sunday October 29Saturday November 19
CREEDENCE CLEARWATER RECYCLEDFriday October 7$65 - free drink on arrival plus 2 course dinner.Tickets on sale August 1RUBBER SOULThe Beatles Tribute Band is hereSaturday, December 102 course dinner and show extravaganza with plenty of dancing and fun - what a great idea for your staff to celebrate with.
Meet Mark Ryanour new Duty Manager
I saw you in the WeeklyMark Ryan is a newer member of the All Seasons team, joining us as one of our Duty Managers. Marks extensive experience in people management ensures our staff are constantly learning and improving, to make sure your visit to our venue is warm and welcoming.
5BZIJUP/BSL
-
Friday, July 29, 2011 Bendigo Weekly www.bendigoweekly.com.au news 5
By BEN CAMERON St MatthewS Church in Long Gully is no longer just a place of worship, but a true community hub.
Over the past three years, the church has been revitalised, with a new garden, a toy library and the possibility of music events being held there ,too.
the church was dying, Seeds Bendigo Dave Fagg said.
It was being used just one or two times a week.
Its become something the whole community can take own-ership of.
Meanwhile Ian Mobsby, a founding member of Moot Com-munity in the UK, visited Bendigo to speak at the church.
the progressive church lead-er is passionate about inspiring new forms of church to meet the demands of a new world where mainstream churches are expe-riencing rapidly declining atten-dances.
Eaglehawk Primary School group to change perceptions
shining a new light
Sowing the seeds of change
By ANTHONY RADFORD
the community group charged with reinvigorat-ing eaglehawk Primary School is turning its at-tention to perhaps its big-gest challenge tackling community perception.
the school was slated for closure by the former State Government last year, but a strong com-munity campaign saw it saved.
a group set up of school and community representatives has been charged with spending at least $2 million of gov-ernment funding for ur-gent works at the school.
the current govern-ment announced the
school would not close, but action group chair-man Gordon McKern said the perception in the community was the school would still close.
even though poli-ticians are saying the
school will remain open, people dont always be-lieve it, he said.
we want to remind the local community that things are happening.
It is just as important we bring the community into the school and the
school into the commu-nity.
It is a matter of cre-ating confidence in the community.
Our role is not only to spend the money, but get the community in-
volved so they realise this is a good school.
the first $850,000 of funding is already allo-cated.
Re-cabling of the schools It network is al-most complete, and busi-nesses will be asked in the
next few weeks to begin tendering for a new slate roof, a new toilet block and other urgent mainte-nance for the school.
the government has confirmed the full $2 mil-lion is available, whenev-er required, for improve-ments, Mr McKern said.
we might even spend as much as $4 million. well have to see how it goes.
Former weeroona College and Loddon P-12 principal Neville Sharpe has been appointed the schools acting principal.
Joining Mr McKern on the action group is school council president Duncan Murley, and experienced educator John Jones.
worship with a difference: Jeramey stagoll loves the community
garden at st Matthews church. Photo: BILL CONROY
It is a matter of creating confidence in the community. 9]ITQ\a8ZQV\QVO
78-6"5WV.ZQ IUXU;I\!IUXU 2907
Open 7 days a week. Monday-Friday 9am-5pm. Saturday and Sunday 10am-4pm
Ph: 5443 7506
Did you know that we use only Locally Roasted Coffee Beans?Why? Because it has that special
freshly roasted taste.Support your local business. We do!
Medium take away coffee usually $4.20 now only
UPGRADE OFFER
$4.20 now only
$3.502907
BENDIGO MARKETPLACE
White Hills Amcal PharmacyAnn Howe - Manager 499 Napier Street, White Hills 5442 4244
Locally Owned & Operated 2907
HI-STRENGTH LIQUID FISH OILLL
AS SEEN ON TV!
Great tasting Fruit Punch Flavour
- No shy after-taste
Omega-3 fatty acids may help relieve the pain associated with arthritis and reduce joint in amation.Break free from symptoms such as constipation, diarrhoea,
gas and bloating with Ethical Nutrients IBS Suport
ycy
as e
Bendigo 5443 4161
81 Chapel St, [email protected] an obligation-free
appointment
Specialist Personal Injury Lawyers
We guarantee clear advice & prompt action! We offer specialist advice & representationin TAC, WorkCover & Superannuation Claims.
If your claim is not successful, you will nothave to pay our legal fees!
Are you injured?
You may be entitled to
compensation
2907
Louise Hanby DWynn Principal, Winn Legal
and Jaz Goddard, Solicitor
3DOO0DOO%HQGLJR3KRQHDQQHWWH#KTODZFRPDX)$0,/
-
6 news www.bendigoweekly.com.au BendigoWeeklyFriday,July29,2011
INTEL CORE i7 750GB HDD 1GB GRAPHICS
HUGESAVINGSACROSSOURRANGEOFCOMPUTERPRODUCTS
UPGRADED TO6GB RAM
$364Toshiba Netbook.Intel Atom 1.66GHz, 1GB RAM, 250GB HDD,Wi-Fi, Bluetooth, 10.1 screen, Windows 7Starter. PLL50A-03K00D
$597HP Pavilion DM1-3216AU Laptop.AMD Athlon II Dual-Core Processor, 4GB RAM,500GB HDD, 11.6 HD LED, Windows 7 HomePremium. QC321PA
$1177Samsung RC720-S04AU Laptop.Generation 2 Intel Core i5, 4GB RAM, 750GBHDD, Blu-ray ROM/DVD burner, 1GB graphics,Bluetooth, 17.3 screen, Windows 7 HomePremium. RC720-S04AU
5TOUCHSCREEN
$10ea8GB USB Keys.PA3875A-1M8B, LJDFF8GBACANZ
$85Epson Stylus NX420 Multi-Function.Print, scan, copy, 35ppm in black/15ppm incolour, Wi-Fi, 1.5 LCD, four individual ink cartridges.C11CA80401
$243Navman MY75T GPS.5 screen, smart find, keyword searches, 3Djunction views, speed limit alerts, advanced laneguidance. 020897
MUSTENDMONDAY!
$498Compaq Presario CQ43-102AU Laptop.AMD Dual Core 1.60GHz, 6GB RAM, 320GB HDD, DVD burner,
14 screen, Windows 7 Home Premium. LZ763PA, AMI4GB-AMISOD24
$994Toshiba Satellite P750/02J Laptop.Generation 2 Intel Core i7 2.0GHz, 4GB RAM, 750GB HDD,
DVD burner, 1GB graphics, TV tuner 15.6 screen, Windows 7 Home Premium. PSAY3A-02J001
DUAL COREPROCESSOR
SAVE$200
WINDOWS 7 10.1 SCREEN 250GB HDD
4GB RAM 500GB HDD BLUETOOTH
11.6SCREEN
HUGE17.3
SCREEN
$98Panasonic Lumix DMC-S1 Digital Camera.12.1 megapixels, 4x optical zoom, 2.7 LCD, lithiumbattery. Available in silver, pink or black.DMCS1GNK/K/PA
HDMOVIE
RECORDING
LIMIT3 PER
CUSTOMER.
WIRELESSPRINTING
ULTRAPORTABLE
$888HP Pavilion DV6-4023TX Laptop.Generation 2 Intel Core i7 2.0GHz, 8GB RAM,320GBHDD, DVD burner, 1GB graphics, 15.6 screen,Windows 7 Home Premium. LZ764PA, AMI4GB-SOD24
UPGRADEDTO 8GB RAM
1GB GRAPHICS
BLU-RAY ROM 750GB HDD 1GB GRAPHICS
INTELCORE i7
clivepeeters.com.au Product offers end 01/08/11 211760_BDG
BendigoRocklea Homemaker Court, 239 High St,
Kangaroo Flat 5447 5200
-
Friday, July 29, 2011 Bendigo Weekly www.bendigoweekly.com.au news7
YEAR 11 Bendigo Senior Secondary College stu-dents learnt one of their most important lessons this week.
Students took part in a half-day Fit2Drive work-shop to give them some expert information about the dangers and responsi-
bilities of driving.More than 30 present-
ers from across the state from the TAC, VicRoads, the RACV, Victoria Po-
lice and the Department of Education showed the students the ropes, giving them some invaluable tips and lessons.
AUTOMATIC: The safety message was key on the day. Photo: Bill conroy. More photos at www.bendigophotos.com
By ANTHONY RADFORD
THE City of Greater Ben-digo council will go back to the drawing board and start consultations again on a playground for Har-greaves Mall.
In April, www.bendi-goweekly.com.au revealed the proposed plans for the playground.
Council had decided to build a $60,000 series of small walls with inter-active features such as an abacus, telescope, tic-tac-toe game area and rubber crocodile and lizard sculp-tures.
There would also be crawl-through maze, a music panel, steering wheel panel and mirrors.
However, local traders werent happy and pushed
for a more traditional type of playground with a slide.
Council chief execu-tive officer Craig Niemann said at the time council would make a decision and it would be built by June 30.
However, two weeks ago the Bendigo Weekly revealed new City of Greater Bendigo Com-munity Wellbeing direc-tor Pauline Gordon said she would seek permis-sion from the council to go back to the community for consultation.
Ms Gordon said coun-cil had approved her pro-posal, and consultation would begin in months.
The maze was thought of as a quick at-tempt to offer a play area for young children, but is it really what children
and families would want if they were given the op-tion? she said.
We have a good op-portunity to do something that the community will appreciate but we need to take the time to get it right and that can only occur by listening to what the
community really wants and understanding what would entice them to the Central Business District.
Ms Gordon said coun-cil officers had until De-cember to consult and report back to council on a preferred plan.
A significant piece of the consultation will oc-cur during the September school holidays when a range of activities will be used to gather childrens opinions, she said.
The City of Greater Bendigo is very proud of its Child-Friendly-City status and council is pre-pared to take the time it needs to undertake a thorough process that is informed by a broad cross section of the commu-nity.
Is it really what children and families would want..?
Mallplaygroundbackonagenda
Students have the drive to learn
For good clean quality water tanks and pools
0408 054 104 or 5443 8412
WATER DELIVERIES/HLJKWRQ2907
visit www.paal.com.auCall Charlie Scerri 0433 578 566
Showroom - (03) 9720 1222 259 Canterbury Rd, Bayswater North 3153
sBEDROOMSWITHSEPARATESTUDYANDACHILDRENSRETREATs3PACIOUSMASTERBEDROOM WITHENSUITEANDWALKINROBEs+ITCHENWITHLARGEWALKINPANTRYANDCUPBOARDS s3PACIOUSLIVINGAREAANDFAMILYROOMs3EPARATELOUNGEANDDININGAREAs,ARGERUMPUSTHEATREROOMs$OUBLEGARAGEANDWORKSHOPWITHSEPARATETOILETs3TRONGHITENSILESTEELFRAMESEASILYBUILTBYNUMBERSs$ESIGNEDWITHYEARSOFEXPERIENCE FEATURES
August Specials ... $2,800 DISCOUNT on deliveries of all PAAL home designs with confirmed orders Franklin $209,670 as shown with all of Paals quality inclusions
LARGE & AFFORDABLEFAMILY COUNTRY HOMEFor the owner-builder
2907
WE CLEAN TILE & GROUT CLEANING SHOWER GLASS & TILES VINYL FLOORS POLISHED & SEALED CONCRETE
WE SEAL ALL GROUT & PORCELAIN TILES TIMBER DECKINGALL WORK GUARANTEED PH. 0428 443 808
DON'S BACK - CARPET CLEANINGWELCOME BACK ALLOLD & NEW CLIENTS
Quality work with competitive prices. 20 years experience
DON'S CARPET & TILE CLEANING
WWEE CCLLEEAANN
SPECIAL PRICES ONEMPTY HOMES AND UNITS
Window Glass Replacement Door Repairs Locks, Cords & Rollers repaired Insulating Glass for Doors & Windows Safety Glass Shower Doors
www.jclwindows.com Ph: 5444 5523 Mob: 0432 440 675
Glass repair and installers of 6 Star double glazed windows
2907
Separation & Divorce Recovery Workshop
Want to take control of your life again? Are your emotions running riot?
Want to understand why you are feeling like you are? Want to meet people who understand the place youre in?
Want to move on but dont know how?
CentaCare Bendigo is running a Separation & Divorce Recovery Workshop on Monday evenings, beginning August 8th at 6:30 8:30pm, concluding on Sept 19th.
This is a non confrontational and supportive self-help workshop. It is empowering and informative with no strings
attached. It is a catalyst for moving forward.
For enquiries or to register, please phone Narelle Williams at CentaCare on 5438 1300. 3 UHODWLQJWRSHRSOHZZZFHQWDFDUHVDQGKXUVWRUJDX
Have you been injured?
337 Hargreaves Street, Bendigo, Vic In Castlemaine & Echuca by appointment
www.admlaw.com.au
We value our clients above all else.
Contact your local Accredited Personal Injury Specialists.
Central Victorias leading Personal Injuries Law Firm.
NO WIN NO COSTS*Phone 5445 9200Free Call 1800 242 588 *Conditions Apply
s 3 / , ) # ) 4 / 2 3 s! 2 . / , $ $ ! , , ! 3 - C 0 ( % 2 3 / .2907
SERVICE PLUS AUTO GAS
OnsiteOnsiteQUALITY LPG INSTALLATIONS& MECHANICAL REPAIRS Ph: 5444 4284
2/50 Bridge Street Bendigo
QUALITY LPG INSTALLATION
LP Gas Tuning and Repairs All Mechanical Repairs
All Servicing
2907
Dr. Hyeong-Jun, KIM | Ph: (03) 5444 1717 135 Mitchell St, Bendigo, VIC, 3550
www.uplushealth.com.au | [email protected]
Acupuncture , Traditional Chinese Herbal Medicine and Remedial Massage (Tuin Na)
Treatment for acute and chronic conditionsHay fever, anorexia, anxiety, arthritis, back & neck pain, depression, IBS, insomnia, general health maintenance, headache, migraines, sciatica, smoking cessation, stress management and gynaecological conditions.
Health Rebates available (Hicaps)2907
-
8 news www.bendigoweekly.com.au BendigoWeeklyFriday,July29,2011
TIMEOffer ends Monday August 1st
clivepeeters.com.au
*1. Bonus delivery and installation must be within a 25km radius of the store from which the goods were purchased and at a time convenient to the store. Installation is standard installation only. Existing plumbingmust be in place. Terms and conditions apply. See in store for details. *2. Product(s) removed must be equivalent size and quantity to the product(s) purchased. The Clive Peeters and/or its delivery contractors willremove the old products(s) when delivering the customers new product(s) at no additional charge. The Clive Peeters and/or its delivery contractors reserve the right to refuse removal if, in their reasonable opinion,the product(s) are soiled, wet and/or pose an OHS risk. Delivery fee applies in the event that the customer misses a set delivery time and product(s) need to be re-delivered. Terms and conditions apply, see store fordetails. *3. Conditions of No Deposit, No Interest, No Repayments for 17 months: Available to approved customers on single or multiple transactions where the amount financed is $500 or more on GO MasterCard,GO Business MasterCard, Buyers Edge and GE CreditLine between 15/07/11 and 14/08/11. Offer available on purchases from Clive Peeters stores (excludes Miele and agency brands). Interest and payments arepayable after the interest free and payment deferred period. Offer available on advertised or ticketed price. This notice is given under each of the GO MasterCard, GO Business MasterCard, Buyers Edge and GECreditLine Conditions of Use (as applicable) which specify all other conditions for this offer. A $25.00 Establishment Fee for GO MasterCard and GE CreditLine applies to all new applications. The GO BusinessMasterCard attracts a $40 Annual Fee. Account Service fee of $3.95 per month applies for GO Mastercard, GE CreditLine and Buyers Edge and $2.95 per month for GO Business MasterCard and other fees andcharges are payable. For GO MasterCard, GO Business MasterCard and Buyers Edge, credit is provided by GE Capital Finance Australia (ABN 42 008 583 588) and for GE CreditLine, credit is provided by GEFinance Australasia Pty Ltd (ABN 88 000 015 485), both trading as GE Money.
Bosch 6.5kg Front Load Washing Machine.1000rpm spin speed, six wash programmes, 4 starenergy rating. WELS 4.5 Star, 56L/wash. WAE20262AU
Samsung 434L Top Mount Fridge.Multi-airflow cooling, glossy white finish, Coolever Zone Plus,safety glass spill-proof shelving. H169.3 x W72.5 x D69.2cm.SR432NW
Enjoy Clive Peeters LOW PRICES AND GREAT SERVICE!Leading brands! Professionally installed! Quality Workmanship Guaranteed!
17months
INTEREST FREE*3No Deposit No Interest No Repayments
until December 2012*3
Product offers end 01/08/11 211766_BDG
BUY ANYFRIDGE ORWASHER
FROMPARTICIPATING BRANDS
AND GET434 LITRE
$748INSTALLED AND W
ORKING,
NO MORE TO PAY!
6.5KG
$699INSTALLED AND W
ORKING,
NO MORE TO PAY!
Participating Brands:
Free Delivery*1
Free Installation*1
Free Disposal ofold unit*2
BendigoRocklea Homemaker Court, 239 High St,
Kangaroo Flat 5447 5200
-
Friday, July 29, 2011 Bendigo Weekly www.bendigoweekly.com.au news 9
By VICKI HARRINGTON
Our wedding-day photo competition comes to a close today, but there are more opportunities for Bendigo Weekly readers to win, with the opening of the White Wedding Dress exhibition at the Bendigo Art Gallery.
The many entries in our Win a Second Hon-eymoon Competition confirm this and indicate weddings have changed very little over the years.
Fashions and pho-to locations may have moved with the times but basic scenes and stories of happy couples celebrating their union with families and friends continues.
Twelve months ago Annemarie and Andrew McClure were blissfully planning their wedding day for November 6 in Horsham.
Both were working in Perth at the time and most of their plans were made via the internet and phone with a little help from Annemaries mum in Horsham.
Three weeks before the big day, Annemarie received a phone call she
says she will never forget.It was her mum in
Horsham, Dont stress, but we have a bit of a problem, the priest has double booked the church, her mum said.
Annemarie went into action. We had to bring the ceremony time for-ward and then send out updated invitations to every guest and advise the photographer, hair dresser and makeup art-ist.
We were worried someone may not get the message, but on the day it all went perfectly Annemarie said.
Annemarie and An-drew moved back to Vic-toria earlier this year and chose Bendigo to make their new home. It isnt Melbourne and it is still close enough to our fam-ilies, she said.
The Weekly gave them another memorable phone call this week when we rang to congrat-ulate them for winning the Win a Second Hon-eymoon Competition.
How exciting. It will coincide beautifully with our first anniversary, a thrilled Annemarie said.
Four weekly winners
received $100 vouchers from Bendigos Puddler Bar and restaurant and the McClures will spend five nights relaxing cour-tesy of the Harbourside resort Gold Coast.
We have five double passes to the White Wedding Exhibition to
give away to Bendigo Weekly readers.
To be in the draw for a double pass, email your details by 5pm Tuesday, August 2, to [email protected] with White Wedding tickets in the subject line.
Goldfields libraries join statewide action
Fighting the cuts
Double booking turns into a win
By ROsEmARy sORENsEN
GOlDFIelDS libraries have joined a statewide campaign to urge the State Government to re-verse its shock decision to cut library funding.
We want all this to be a positive campaign, but we need to be as-sured about whats going to happen in the future, Goldfields library chief executive officer Carolyn Macvean said.
We are all very ner-vous, something has to give.
City of Greater Ben-digo councillors support-ed the librarys decision not to sign the funding
agreement with State Government, which will reduce library services by $15,000 this year.
Council is concerned this could lead to further funding erosion, mayor rod Fyffe said.
Councils now fund 74.7 per cent of recurrent operational library costs while the State Govern-ment now only contrib-utes 19.3 per cent.
libraries are greatly valued facilities the
state should be increas-ing funding to them not decreasing it.
Bendigo was one of 50 Victorian councils who met in Melbourne last Friday to plan a response to the library cuts, which
were announced without warning after council and library budgets had been put in place.
Chairman of the Mu-nicipal Association of Victoria board, Golden Plains Shire councillor
Bill McArthur, said the councils had launched a state-wide campaign for fairer funding.
We need to convince the state to reverse the decision, as a matter of urgency, Cr McArthur said.
Cr McArthur said the MAV has met with minis-ter for local government Jeanette Power.
The objective of a more sustainable model is uppermost in our mind and in her mind, Cr McArthur said.
Cr McArthur said a Facebook page, stopli-brarycuts is now avail-able for people to support the funding battle.
The state should be increasing funding ... not decreasing it
WEDDING WINNERS: Annemarie and Andrew McClure.
Bendigo Call 5441 8008Level 1, 358 Hargreaves Stfernwoodfitness.com.au
ZERO JOINING FEE
SAVE $199*Oer applies to 12 month memberships only. Not available with any other oer. Minimum cost of 12 month membership is $1144.
2907&DVWOHPDLQH .\QHWRQ 0DU\ERURXJK :RRGHQG
6$6,B%:
0LWFKHOO6WUHHW%HQGLJRZZZNRVPDFDQGFOHPHQVFRPDX
2907
*Conditions Apply. Valid until 12/8/11
Bendigo
1300 PIZZA HUT1300 749 924PIZZAHUT.COM.AU
Add $1 extra for Chicken Mia
$21.00DeliveredWe Deliver!
All Day Every Day
-
10 news www.bendigoweekly.com.au BendigoWeeklyFriday,July29,2011
2207
-
Friday, July 29, 2011 Bendigo Weekly www.bendigoweekly.com.au NEWS 11
TWO Bendigo education organisations have se-cured $100,000 to help people with a disabil-ity develop employment skills.
Nationals Member for Northern Victoria Damian Drum presented the money to Continuing Education Bendigo and Radius Disability Services on Tuesday.
Mr Drum, a long-term campaigner for the disability sector, said the funding would go to de-velop a trade assistants training program to help
young students with a disability move from supported to open em-ployment.
This project provides us with another great
example of how Victo-rias registered training organisations, like CEB, are building partnerships with community organi-sations such as Radius
Disability Services, to help engage and support people with a disability, he said.
Established in 1953, Radius Disability Services
provides day programs and supported employ-ment services to people with a disability.
Today, it operates six distinct business
units and has grown to become Central Victo-rias longest-established provider of services and opportunities to people with a disability.
I commend CEB and Radius Disability Services in coming together to work on this exciting new program, Mr Drum said.
By drawing on their shared experiences in ed-ucation and community services, this partnership will help people with a disability gain the skills they need for a brighter future.
Bright future ahead
SKILLING UP: Rachel Sutherland shows Damian Drum some of her work. Photo: BILL CONROY
BIGGEST WINNER INFO
From Monday, Bendigo and district people and work-places can sign up for the 2011 12-week challenge.
This year there are 200 places available. August 1 to 21 Book in dates for entrants, at the UFS Pharmacy View Street
August 22 to September 4 Weigh-in for entrants *
November 14 to 27 Weigh-out for entrants *
November 29 Awards night at St John of God Hospital
*Weigh-out will be exactly 12 weeks after your weigh-in date.
Bendigo workplaces can have their weigh-ins in the workplace.
More from www.sjog.org.au/Bendigo go to events.
Registration/entry forms are available from: The website above St John of God Hospital reception
UFS Pharmacy,View St
Lifestyle Fitness, Bath Lane
The Bendigo Weekly reception, Woodbury Court, McIvor Road.
Biggest Winner is backINTEREST in this years St John of God Hospital Biggest Winner competition is growing fast, with the full details released today.
Entries will open on August 1 and run to August 22.
Registration/entry forms
St John of God Hospital
INTEREST in this years St John of God Hospital Biggest Winner competition is
I commend CEB and Radius Disability Services in coming together
AFS Licence No. 325211114 Queen Street Bendigo, VIC 3550
P 03 5444 2255E [email protected]
mo t i v a t e a c t u a t e i n n o v a t e
Home & Contents Private Motor Vehicle (Prestige, Vintage, Classic) Landlords Insurance & Strata Title Travel Insurance & Corporate Travel Trades & Construction Insurances Of ce, Retail & Business Commercial Property & Industrial Special Risks Commercial Motor Vehicle & FleetPeter Rainey
2907
Home loans at your convenience
ence.
eliveryou
Anthony Woodman can help you with: Home Loans Investment home loans Re nance loans Renovating loans Low docs for self employed Home, car and life insurance Loan protection
Important information. Applications for finance are subject to the Banks normal credit approval. Full terms and conditions will be included in the Banks loan offer. Fees
jand charges are payable. Commonwealth Bank of Australia ABN 48 123 123 124.
AVAILABLE 7 DAYS 24 HR LOAN APPROVAL
Anthony WoodmanMortgage Innovation ManagerAuthorised Representative of theCommonwealth Bank of AustraliaPhone: 5441 7661 Mobile: 0458 241 241Email: [email protected]: 92 Wills St, Bendigo 2
907
Support the pharmacy that supports your community
Phone 5446 820350 High Street, Eaglehawk
AS SEEN ON TELEVISION
Phone 5446 8203
ON TELEVISIONBillie Goat Soap$7.15 Members Price
Hand & Body Wash$11.15 Members Price
Bath Milk$9.95 Members Price
Mildura Beer & Wine Tour for Four
Experience the best of boutique wineries in the Sunraysia Region with
this exclusive tour package.
Taste wines at Oak Valley Estate, Nursery Ridge Estate, Chateau Mildura and even a range of beer at the Mildura Brewery
all with experienced local tour guide!
Includes lunch at Woodsies Gem Shop, where youll see gemstones like never before.
Tour any Saturday in August. Package includes 2 nights a in a brand new 2 bedroom,
2 bathroom apartment, for 4 people and group tour with lunch for 4.
Book now for $800 thats only $200/person
Phone 03 5002 0900 or online at www.questmildura.com.au
Valid August weekends only, terms and conditions apply.
2907
LunchWorks$7.95*Monday to Friday*Conditions Apply. Valid until 12/8/11
Must present this voucher
Bendigo all you
can eat
1300 PIZZA HUT1300 749 924PIZZAHUT.COM.AU
www.midlandirrigation.com.au Ph: 1300 664 67084-86 Strickland Rd, BENDIGO - 1009 Latrobe St, BALLARAT
55A Edgecombe Rd, KYNETON - * While stocks last!
2907
Friendly personalised service guaranteed
SCORCHA Drip Torch - Fire Lighter
Only $240
GRUNDFOS JP BASIC 2PC Auto Pressure Pump
50% OFFOnly while stocks last
Stock Troughs from $275
POLY PIPEOur poly pipe prices wont be beaten!
We have the largest range of Philmac ttings in rural Victoria
Damian Drum MLCFor advice, support and assistance on
State Government matters.
239 Barnard Street, Bendigo 3550Phone 5443 6277
MEMBER FOR NORTHERN VICTORIA REGION
2907
-
12 NEWS www.bendigoweekly.com.au Bendigo Weekly Friday, July 29, 2011
LETTERS to the editoremail: [email protected]
Letters are not guaranteed to be included and may be edited for reasons of style or content. Letters will not be eligible for considera-tion if they contain defamatory material, or information of a personal nature which is not in the public domain.
Bequest for studentsYOUR report on rural students asking about university accommo-dation costs, Bendigo Weekly, July 15, is timely.
Readers may wish to know that Bendigo born and bred Dr Her-bert Gibson, who died suddenly last year, aged 64, left a generous bequest to Monash University, Melbourne, for this very purpose.
His bequest, The Dr Herbert V. Gibson Scholarship for Rural Health, pays living costs for stu-dents from rural Victoria studying for the medical degrees.
Dr Gibson played a leading role in the early days of the HIV/AIDS outbreak in Melbourne and later as a consultant covering the Loddon/Campaspe region.
He experienced and was aware of the need for more quali ed doctors to work in Australias ru-ral areas to help ll a serious gap and reduce the physical, mental and family pressures on the too few dedicated rural doctors work-ing under unacceptable pressure demands.
His bequest to the Medical Faculty of Monash University is intended to help ease this ineq-uity.
This scholarship is currently open to Victorias rural based stu-dents in need of nancial support to study for their medical degrees at Monash University.
Students are invited to apply for Dr Gibsons generous incen-tive by contacting the Univer-sity direct or via its website. www.monash.edu.au
Edward Chase,Bendigo
Desperate times POLITICS has changed so much in the last few years, it is hard for anyone to keep up with all the chest beating and mind changing.
But the latest set of circum-stances in the carbon tax barney, seem to be getting completely blown out of proportion.
Eminent scientists, and 85 per cent of economists, agree that ac-tion should be taken on climate change.
The opponents of such a measure, either keep changing their mind because of political ex-pedience, or just blatant hypocrisy.
The one man wrecking ball travelling the country, called Op-position leader Tony Abbott, has been telling people in supermar-kets, smoko rooms, and down mine shafts, that they are all going to lose their jobs, and the world as we know it will never be the same again.
Well, on his own admission he is not a tech head and doesnt have any interest in economics.
So I would suggest he is in no position to question eminent cli-mate scientists, or global ratings agency Standard and Poors, who totally reject Mr Abbotts com-ments, that a carbon tax would kill the coal, steel, cement, alu-minium, and motor industries.
Politicians rely on the general public having short memories, but there are some things that remain in ones mind, including the previ-ous governments position on cli-mate change.
Before the 2007 election, then Prime Minister John Howard said that he was going to introduce a carbon tax, and said, Australia will continue to lead internation-ally, globally, and in the paci c region on climate change.
In recent days, Mr Howard has been back-pedalling on his state-ment.
Over the decades, numer-ous Prime Ministers have broken promises.
As far as the Opposition goes, who can forget Tampa, children overboard an election won on a lie and Work Choices, intro-duced into the workforce with no warning or noti cation.
I believe the Opposition is be-ing a bit precious in their criticism of the present government.
Who can forget Mr Abbotts desperate pleas to the independ-ent members, and the Greens in his attempt to warm the Prime Ministers chair.
In 25 months time, I can only imagine the election ads that will be aired to remind people of the musical chairs position of the Op-position leader, and his despera-tion to get the keys to the lodge.
Ken Price,Eaglehawk
Controversial treesWE would like to thank the peo-ple that signed the petition to have the burnt dead trees result-ing from Black Saturday removed from the Bendigo Regional Park in Maiden Gully Road.
Maree Edwards of ce received a letter this week from the Minis-ter of Environment and Climate Change, Ryan Smith, stating the burnt trees cannot be removed.
Our Place Community As-sistance Centre with the Bendigo Council are working together to have the trees that have been felled and any dangerous trees hang-ing over the road removed and cleaned up.
We call on Mr Smith to come up and see our situation here in Bendigo and treat each case indi-vidually and not as part of a great big national park with hundreds
of hectares burnt out. Here in Bendigo we are differ-
ent, as it is in a residential area and Maiden Gully Road is a busy road connecting Maiden Gully, Califor-nia Gully and Eaglehawk.
In the letter from Mr Smith, it states rehabilitation works fol-lowing a bush re are focused on providing for public safety, and minimising the impact of re sup-pression efforts on the natural en-vironment.
We ask Mr Smith and Parks Victoria how do these dead trees provide for public safety when if anyone went in there, they could be injured or killed.
These trees are referred as widow makers by experienced bushmen, as they could fall at any time in any type of weather.
If another re does happen, do you think that they would let re-men, Parks Victoria or DSE work-ers go in there and ght a re?
We thought green trees were good for the climate taking the carbon out of the air, so why dont they replace the majority of these dead trees with new ones.
For those people that have supported us, please write a letter to Ryan Smith, the Minister for the Environment and Climate Change voicing your concerns.
Joy, Bob, Anne-Maree and Kathlene Bice,Maiden Gully
To buy a signed copy of any Glanville cartoon please phone 5442 5448
Bendigo Weekly, PO Box 324, Bendigo 3552. email: [email protected] Please include your name, address and a phone number.
Tell us your thoughts ...email [email protected]
Be listening every Wednesday morning at 9.30am to hear what they have to say next.
BendigoWeekly
Making wavesMaking wavesBendigoWeekly
with ... Ben Jones
and Anthony Radford
Ben Its the local you know 3BO and I am here with Bendigo Weekly editor Anthony Radford. Radders, its been a big week for news. Central Victoria has been in the news for all the wrong reasons, rstly at Long Gully last week and Castlemaine yesterday. As a journo, whats your take been on the last week.
Anthony One of the good things about my job is when you walk into work every day you never know what is going to happen. From that point of view, we have had a busy week and our website at www.bendigoweekly.com.au was providing updates regularly, as soon as they happened. When it came to the Long Gully issue last week, while it was scary for those involved, it was important we all worked as quickly as we could to get the information out to the Bendigo public.
Ben Also, social media has played a big role in coverage of events recently. Last Friday, a police helicopter was circling Long Gully looking for a man who went missing from an aged care home. People were talking about escaped inmates from a Melbourne prison that had made their way to Bendigo. In our role in the media it is important we double check the facts before we publish because if you cause a panic, the repercussions can be very ordinary.
Anthony This is an interesting aspect of social media, or anti-social media as many call it. Twitter and facebook information has to be treated as simply rumour, it cannot be taken as fact by anyone, until it is con rmed. Those who post and read this stuff have to be very careful. At the end of the day, the only real credible place in the web to get news is news organisations websites, such as the Bendigo Weeklys. We are paid to only publish correct information.
We will not publish something on the web that hasnt been con rmed. There are big consequences for getting it wrong or for assuming things. Its all about credibility and trust. We need to trust journalists more than we trust facebook and twitter. When it comes to updating news, a news website or a radio station is the only way to get the right information.
Located in the heart of the city, 14 Pall Mall, Bendigo.
We have been fortunate to have three famous chefs, come over from Malaysia, and Hong Kong to cook traditional Malaysian and Chinese dishes to tempt and satisfy the taste buds of the people of Bendigo.
Our dishes suit Australian tastes
Ph: 5442 8819 14 Pall Mall, Bendigo Bookings Welcomed
1. Chicken Curry Laksa2. Fried Kuay Teow3. Mee Goreng4. Beef and Black Bean on Rice5. Sweet and Sour Pork on Rice6. Lemon Chicken on Rice
7. Hainanese Chicken Rice8. Five Spice Chicken on Rice9. Singapore Noodles10. Curry Beef Rice11. Curry Chicken Rice12. Special Fried Rice
WORKERS LUNCH SPECIALS
Discount Take Away FoodFrom Monday to Saturday - Free Home Delivery
Trading Hours 11.30am - 3.00pm 5.30pm - 10.00pm 7 days a week
Bendigo you work so hard you deserve a workers lunch
Dine-in DiscountPresent this voucher for a10% OFF on any dine-in meal. Dinner Only
Di i Di
WORKERS LUNCH SPECIAL Over 12 Varieties to choose from. Plus a can of soft drink for only $8Dine in or take away2207
-
Friday, July 29, 2011 Bendigo Weekly www.bendigoweekly.com.au news 13
v iewpointopinion email: [email protected]
Our public libraries are an unlikely battleground for an emerging conflict, but thats exactly what they have become after a State Government deci-sion to slash its funding of li-brary services across the state by 1.35 per cent.
And while the exact amount of the extra burden does not seem like a lot $15,000 in the case of the City of Greater Bendigo it seems the State Government is now discovering that sometimes its the smallest cuts (think paper cuts?) that hurt the most.
An analysis of per capita expenditure on our public li-braries shows how bad things have become in Victoria, where in 2008-09 just $35.89 per person was spent on pub-lic libraries, com-pared to $45.97 in South Australia, $44.69 in Western Australia, $41.95 in New South Wales and $40.86 in Queensland.
In other words, if Bendi-go was in South Australia, in 2008-09 wed have received an extra $1 million for our library than we otherwise did.
The Coalition State Govern-ment is not the first to utilise the much-despised practice of cost-shifting onto local govern-ment, but it seems this months decision to do just that has be-come a tipping point.
The timing of this news has not been lost upon those who work in the local government sector, as the bad news came
not long after every single one of the states councils had al-ready produced, tabled and ad-opted their yearly budgets.
Claims of hypocrisy, too, have emerged as critics of the cutbacks have been quick to re-mind the government of what it said about the former Labor Government and cost-shifting only 12 months ago.
Speaking in Bendigo one year ago, then-Shadow Local Government Minister Jeanette Powell said councils had been increasingly burdened by John Brumbys constant cost-shifting without adequate support, leaving them to fund services originally provided and funded
by the government.The then-government led
by John Brumby was accused of blatantly ignoring the needs of local councils and loading them up with state responsi-bilities.
We will clarify and define the roles and responsibilities of each tier of government and eliminate unfunded cost shifting by the state onto local councils, Ms Powell said.
Councils will have greater security in knowing that any extra services provided by them on behalf of the state will be funded appropriately, Ms Powell said.
This week, now Local Gov-
ernment Minister Jeanette Powell said the previous Labor Governments poor financial management had impacted negatively on recurrent funding for public libraries in Victoria, and that the Coalition Govern-ment inherited a reduction of more than $2 million to the public libraries grants program from its predecessors.
Minister Powell says the Coalition Government has suc-cessfully protected public li-braries recurrent funding from further reductions in difficult economic circumstances.
The Coalition has also re-established the Ministerial Council on Public Libraries,
and the Ministerial Mayors Ad-visory Panel to provide more meaningful dialogue between the two levels of government.
Life in Opposition can be a lot easier than life in gov-ernment, but the community has a rightful expectation that a change in government will bring with it change on the ground. Thats why people vote for change in the first place.
In the meantime, what was once described in Op-position as a looming crisis in regional Victoria has now become a crisis at least in the minds and budgets of councils and library users across Victoria.
Smallest cuts hurt the mostPKwithPeterKennedy
Bendigo the winnerITS been a slow and gradual change, but finally, Bendigo has accepted its status as a cultural centre.
With its proud history as a work-ers city, Bendigo is cautious about fancy titles and big claims. We need to see the runs on the board before we declare the innings won.
With all eyes on the Bendigo Art Gallery as it prepares to open its new blockbuster, the game has finally been declared and Bendigo is the winner.
The battle to build was hard-fought. That debate about whether money should be spent on develop-ing the art gallery and cultural pre-cinct was full of passion.
It meant we were able to weigh both sides of the argument and get it in perspective.
As the city grows there are so many demands on government funds
its important to get the balance right.Now, the city is preparing to build
another extension to the art gallery, and hopefully to get the go-ahead for a new theatre, and the timing looks perfect.
Listening to the community has resulted in good planning, and re-sponsible management, which have made it possible for the city to host a world premiere that is setting the benchmark for exhibitions of this kind.
This will bring visitors from near
and far, to see the extraordinary col-lection from the Victoria and Albert Museum, as well as fashions created by Australias top designers. This is both haute couture and social history, so theres something for everyone.
Past shows at the gallery have also been a shot in the arm for businesses in View Street and in the rest of the city. Its been a tough year for retail and hospitality, so this is a crucial boost for them, too.
Karen Quinlan and her gallery staff know this is a turning point for the gallery and consequently for the city.
We wish them all the best in the months ahead as they show off their fashion show to Bendigo and to the world.
And we look forward to more dar-ing ideas coming to town in the future.
The Coalition State Government is not the first to utilise the much despised practice
EditorialComment
Bendigoweekly
EASY DOES IT: The dresses are prepared. Photo: BILL CONROY
All remaining winter ladies fashion clothing now...g
Ladies Fashion Clothing 37 Williamson Street Bendigo Phone 5443 0411
Final Winter Clearance3 Days Only: Thursday 4th, Friday 5th & Saturday 6th August
HURRY ONLY WHILE STOCKS LASTPRICE
2907
Now Stocking the new
gure shaping jeans
$110
WINTERSPA CLEARANCE
63 - 69 Powell Street, White Hills Phone: 5441 6111www.advancebendigo.com [email protected] Bendigo
2207
Limited time offer
5 PersonGetaway Spa
MORE SPAS AVAILABLE
Introductory Price is
$5,490Including
Delivery in BendigoRRP $5,999 plus delivery
Powered by
-
14 LIFE www.bendigoweekly.com.au Bendigo Weekly Friday, July 29, 2011
FOR those who enjoy the magni cent collection on display from Monday at the Bendigo Art Gallery, there is a companion book available, published by the Victoria and Albert Museum.
Written by curator Edwina Ehrman, it documents the history of British wedding dresses, and how styles were in uenced by both in uential women and their designers. Its a lavish publication, as much a social history as a fashion catalogue.
Much has been made, in the leadup to the opening of the show, of the importance of Queen Victorias decision to wear white for her wedding to Prince Albert in 1840.
Well-to-do ladies had always chosen the glimmer of white and ivory, but the Queen made it desirable for everyone, from the working class through to high society, to try for a white dress.
It wasnt possible for those who knew their frock would have to be worn for best following the wedding, but that date did begin the custom of
wearing white, then packing away the dress for future generations.
Ehrman is a careful and informative writer, as she takes us down through the years to current day wedding fashion.
Along the way we learn about how some things never change: in 1992, when a model married a celebrity chef in a dress designed by Bruce Old eld, the groom was shocked by the sexy cutaway frock.
Apparently, he believed a woman should dress only for the man she is marrying. It is not recorded in the book whether that marriage lasted.
Rosemary SorensenFor this weeks Top Ten, go to www.bendigoweekly.com.au/book-club. Join up, and send comments to [email protected]. Bookclub members can also send poems (original or favourites) for our Refrain poetry le.
BendigoWeekly
BOOKCLUB
wearing white,
away the dress
Ehrman is a careful
The Wedding DressEdwina EhrmanV&A Publishing, $70
pick of the week Food FossickersBy ROSEMARY SORENSEN
WITH six children between them, including four-month-old twins, you would imagine Brendan and Nicole Tuddenham have enough on their plates.
But they are the kind of people who say, were busy, lets get busier.
This weekend, they open up their new kitchen and dining room at the Belmont Hotel on Skene Street.
They have big plans to make this quiet little corner of Bendigo into a child-friendly, family-attrac-tive, good-value eating place.
And as for the current growing trend to offer low-price lunches, the Tuddenhams are upping the ante: they are hitting the ground running at the Belmont with a two-course $10.50 lunch.
It will be real food, not pre-packaged meals, Brendan says.
And our idea is to have a small menu with lots of specials,
so we can change often. Ill be featuring my braised ox cheeks very soon, and were doing a sh and chips that is served in a grill-ing basket, something a bit dif-ferent.
It will be an emphasis on healthy, real food.
Brendan has been in the food game for 23 years, with time at Redesdale and Bazzanis (now La Piazza).
When they were offered a lease on the Belmont dining room, at a very good deal, Bren-dan said they couldnt say no.
Our Kidz in the Kitchen is starting to take off, so weve been looking for somewhere to ex-pand that, Brendan says.
We want to make it afford-able for families and also have lots of different things happen-ing.
The Belmont is a well-estab-lished local, so it will be interest-ing to see how these new ideas change the scene.
Nicole is hoping to experi-
ment with a high tea concept, already cheered on by Bendigo-nians keen to see new ideas take off.
Brendan wants to try meat nights, with the butcher on hand to show how a carcass is pre-pared.
A posting on their Facebook page has asked them not to for-get the vegetarians of Bendigo, sometimes left out of foodie dis-cussions.
Yes, well have a go at that too, Brendan says, because we know theres not too much cater-ing to vegetarians in Bendigo.
We want to have special events, and specials on the menu, so theres all kinds of things happening here.
Weve got the advantage of lots of parking available, so we hope we can even have a kids food festival here, sometime in the future.Food Fossickers online this week: Nicole Tuddenhams Kidz in the Kitchen recipe for dairy-free Chocolate Hedgehog.
BIG PLANS: Brendan Tuddenham outside
the Belmont.
MUSTENDMONDAY!
Grundig (22) 55cm Full High Definition LEDLCD Television with Built-In DVD Player. G22FLEDV
Toshiba 32 (81cm) High DefinitionLCD Television. 32AV800A
LG (42) 106cm High DefinitionPlasma Television. 42PT250
clivepeeters.com.au
211768_BDG
Product offers end 01/08/11
MEM
NEWMODEL!
GREATVALUE!BUILT-IN DVD
PLAYER
BendigoRocklea Homemaker Court,239 High St, Kangaroo Flat
5447 5200$598$467$348
2907
)XQILOOHGIDPLO\+ROLGD\V
-
Friday, July 29, 2011 Bendigo Weekly www.bendigoweekly.com.au NEWS 15
By ROSEMARY SORENSEN
They have indexes of every headstone in the Bendigo Cemetery, early records from the courts and hospital, and newspaper births, deaths and marriages notices from way back.
If you have always want-ed to dig a little into your family history, this is the place to start.
You have more fun if you do it yourself, presi-dent of the Bendigo Regional Genealogical Society Judith Pearmain said.
And we are all here to help you get started.
Today is the rst day of National Family History Week, with the Australasian Federation of Family History Organisations also promot-ing their campaign to Say yes to question 60.
Its important to save the census, Mrs Pearmain says. All that information is destroyed and its invaluable for family histories, so we are
urging people to tick the box that says yes, your census in-formation can be saved.
The Genealogical Society works in one corner upstairs at the Bendigo library in Har-greaves Street.
In another corner is the Historical Society, with rep-resentatives available on Monday afternoons to steer people towards the resources they might need.
And between the two cor-ners is the of ce of the archi-vist, Margaret Sawyers.
Betty Jackman joined the Genealogical Society in 1977 and has been indexing the births, deaths and marriages information ever since.
Youll probably end up in Melbourne if you want to trace your family history, but weve got most of the docu-ments specialising in Bendi-go right here, Mrs Jackman said.
Weve all learnt slowly how to get access to certain records, it takes a while to work it out.
One of the rules for family history is to start with yourself and work backwards.
And the other thing is get verbal with your relatives, before they die.
So many of us leave it too late.
Bendigo Regional Ar-chives Centre at the library is holding a tour during Na-tional Family History Week on Wednesday, August 3, 10.30am to 11.15am: book-ings 5449 2700.
Both the Historical So-ciety and the Genealogical Society are at the library on Monday afternoons, to help people begin their research into local and family history.
Our time team
...get verbal with your relatives,
before they die.
ON THE TRAIL: (From left) Elwyn Hunt, Judy Pearmain, Betty Jackman and Gay Toman.
The City of Greater Bendigo and the Bendigo Business Council together are creating a series of four unique events to benefit the Bendigo Business Community by raising awareness of the resources available to boost your business.
Each of the four events is to be designed by representatives of the following sectors of our business community:s "USINESS#OACHES&INANCIAL!DVISERSAND"ANKSs )NFORMATION4ECHNOLOGYs !RTISTSs 2ETAILExpressions of interest are sought from representatives of each of these sectors to be a part of the steering committee created for each sector specific event. The four steering committees will be fully resourced financially and administratively.
Event Partners:
We want you! Boost your business. Boost your Industry.
Please contact Frank Cinquegranaon 0416 061 947 or 5446 1558 [email protected] to register your interest. For more information on Business Together Bendigo visit www.businesstogether.com.au
ADVERTISEMENT
CLEAVE Removals have reopened at The Palms, Midland Highway, Epsom, after a short closure with new owners.
The new owners have been involved in the furniture removal industry for more than 35 years and are determined to make Cleave Removals one of the most respected removal companies in Central Victoria.
New Manager Phillip Bulger, has the knowledge and experience to take the business to the next level.
With a new look team full of enthusiasm, Cleave Removals will focus on local moves making sure that people get the move they want at a great price.
Moving can be a very stressful time especially when you are trusting strangers to relocate your furniture and belongings you have worked so hard to obtain over the years, so personal service is very important.
With great removalists along with new management, new of ce staff and eet of new trucks they guarantee you will be satis ed with the job.
Cleave Removals has the ability to move goods to anywhere in Australia be it to the next street, interstate or even to the other side of the world. Cleave Removals have the connections to make it happen.
As well as relocating your
furniture and effects Cleave Removals can also arrange for pet transportation, vehicle relocation as well as house and commercial cleaning and even accommodation if required.
Not only can Cleave Removals relocate household furniture they also specialise in Of ce Relocations.
Cleave Removals are also able to offer short or long term storage at a reasonable prices.
The staff can wrap and pack your belongings to ensure they are well protected.
Self Storage facilities do not offer this service and if you want to wrap your goods you have to provide the packing materials and stack it yourself.
At Cleave Removals you only pay for the storage space you use and are not charged for any empty volumetric space.
As Cleave Removals are members of the Australian Furniture Removals Association, they are able to offer you Transit Insurance for your move or Storage Insurance if you wish to store you furniture.
From residential to commercial, business to executive moves give Phil a call for a free no obligation quote on 5448 5060 or call into Cleave Removals at The Palms, Midland Highway, Epsom.
Cleave Removals are back bigger and better than before
WOULD LIKE TO WELCOMEDR Gary Berryman MBBS FRACGP
TO OUR PRACTICE.COMMENCING 1st, August 2011.
Please call 5443 5885 FOR APPOINTMENTS.New patients are welcome.
Bendigo Family Practice38 Williamson Street
-
16 news www.bendigoweekly.com.au BendigoWeeklyFriday,July29,2011
Quality food costs less
When you spend $30 or more in one transaction at Coles. Valid until 3rd August 2011^8 perlitreHURR
Y!
ENDS WED 3rd AU
G.
SAVE $3.13kg WAS $12.98kg.Red Cherries*Product of the USA
$985 kg
SAVE $2 WAS $4.98.Hass Avocado, 3 Pack*$0.99 per each
$298 pk
SAVE $2.20kg WAS $4.98kg.Pink Lady Apples*
$278 kg
SAVE $2kg WAS $4.98kg.Zucchini*
$298 kg
SAVE $1 WAS $2.98.Cherry Tomatoes 250g Punnet* $7.92 per kg
$198 pk
VIC
-
Friday, July 29, 2011 Bendigo Weekly www.bendigoweekly.com.au news 17
COME ON AUSTRALIA!VOUCHERTerms & condition
s apply coles.com.au/sportsforsch
ools
Come on Australia!Make sure your school isregistered at coles.com.au
START COLLECTING
TODAY!Collect a voucher for every $10 you spend at Coles
at
On sale until Wed 3rd August 2011. *Produce specials are available until Thurs 4th August, and are subject to availability. Advertised prices apply at Victorian stores, Coles Albury and Lavington. Advertised prices not available at Coles Express and Coles Central. ^ Terms and conditions: Offer provides 8 cents per litre (cpl) fuel discount receipt for purchases of $30 or more in one transaction between 21/07/2011 and 03/08/2011 at participating Coles (excluding Coles Express), BI-LO or Pickn Pay stores and coles.com.au. Standard 4cpl fuel discount receipts remain redeemable at Coles Express for 4cpl discount. Limit of one fuel discount receipt per fuel purchase up to 150 litres per vehicle per customer. Not valid for Fleet Card, Shell Card, Motorcharge or Motorpass purchases. Purchases of gift cards or tobacco and tobacco related products in QLD, SA, ACT or NSW or coles.com.au delivery/service fees do not contribute to qualifying spend. Offer not to be used in conjunction with any other offer or receipt. Valid in conjunction with additional 2 cents per litre discount for in-store spend at Coles Express. Coles Express Fuel Discount and Save 6c Terms and Conditions also apply, see in-store or colesexpress.com.au. For Coles Express store locations, also see web. Fuel discount voucher valid for four weeks from date of issue.
SAVE $2.07 WAS $4.06Berri Juice 2.4 Litre $0.83 per litre
SAVE $2.15 WAS $4.29Cadbury Dairy Milk, Fruit & Nut Hazelnut, Snack, Caramello or Old Gold Dark Original Block Chocolate 200g-220g These varieties only
$1ea $6ea
SAVE 67 WAS $1.67Heinz Baked Beans or Spaghetti 420g $0.24 per 100g
SAVE $10.19 WAS $20.19SunRice Long Grain White Rice 10kg
$0.10 per 100g
Mighty Soft Crumpet Splits 6 Pack $0.23 per crumpet
SAVE $3.88 WAS $9.88Kleenex Cottonelle Toilet Tissue 12 Pack $0.26 per 100 sheets.
Buy 1 get 1
FREE $279 ea
Price
1/2
$214 ea
$199 ea
$10ea
VIC
-
18 LIFE www.bendigoweekly.com.au Bendigo Weekly Friday, July 29, 2011
OBVIOUSLY, its really start-ing to grate.
As many people would know, overusing the grey mat-ter and over thinking thingscan be both a blessing and curse.
Its pretty helpful when somebody comes at you with a big sack of bullsh*t, push-ing an agenda, but bloody annoying when you ask somebody out on a date, she says absolutely not and all you can think is What did she really mean by that?
Its an admirable quality to be a bit of a thinker, but theres a line drawn some-where.
Unfortunately, any self respecting reporter (you know, the type that doesnt hack into peoples phones) has to sweat the small stuff to get the job done right. Be-cause just like a town crier, your mistakes with detail dont go unnoticed by the public.
Another downside to having an overly tuned-in so-cial antennae is that the little things in life begin to bug you pretty quickly.
Especially when it comes to how people speak.
Were all slaves to fash-ions and fads, but theyre not exclusive to clothes, dance moves and reunion tours for bands that were big for two months in the 1980s.
Trends can also come in the form of words. And an absolute belter has emerged this year.
From the makers of lit-erally, seriously, like and whatever comes the
latest overused word to in-vade conversations across the country: obviously.
Maybe its a sign I watch too much sport, but it seems every second sentence ut-tered by a sports person in the media begins with this sometimes needless word.
Ive got nothing against it.
As words go, its pretty well constructed, a hell of a lot less pretentious than evi-dently and much quicker to say than that ve syllable be-hemoth, unmistakably.
However, people have fallen into the habit of using it in almost every sentence,
even when the information contained is only obvious to a select few, at best.
For example, you might hear this from an AFL cap-tain: Obviously the boys and I have had a few private words behind closed doors or, Obviously Ive been se-cretly carrying an injury for the past month.
Secondly, it feels like peo-ple these days try to add a bit of gravitas and intelligence to their otherwise banal and or-dinary sentences, by sticking a big obviously at the be-ginning. Like adding a bit of intellectual parsley to a plate of bangers and mash.
Its just like how some people use the word utilise instead of use.
On my rst day on the job in a factory many years ago, I accidentally spilled some water on the oor in the staff canteen.
Quick as a ash, my su-pervisor leapt to his feet, and unnecessarily told me to quickly utilise that mop.
Finally though, obvi-ously is used when its really not required. Like when the sentence contains info that is obviously obvious, like Ob-viously wed love to get the four points this weekend or Obviously I was dropped
last week for poor form, but obviously Ill be working hard to tick all the boxes on the training track.
The point is, some things are best left unsaid. Obvi-ously.
But dont underestimate the power of a trendy word, everybody falls under its spell at some stage.
The other night, after watching Sports Tonight with a friend, our conversation went a bit like this:
Bloody hell, does ev-erybody talk the same these days?
What do you mean?Havent you noticed
lately how it seems every Tom, Dick and Harriet in professional sport begins their sentences with the word obviously.
Calm down, youre over thinking things again, mate. What do you want for tea?
Well, obviously Im not picky...
Thankfully, its only a matter of time before itll be replaced by some other word.
Which is obviously something to think about.
Over thinking can
be both a blessing and curse
ON LIFE
BENCAMERON
Wordsmith Ben is tying himself up in the name of the game... obviously
Obviously, the word is out
%(1',*27$)(5HDO7UDLQLQJIRUWKH5HDO:RUOGZZZEHQGLJRWDIHHGXDX$W %HQGLJR 7$)( ZHYH JRW WKHRSSRUWXQLW\\RXUHORRNLQJIRU:LWK PRUH WKDQ FRXUVHV DQGFDPSXVHVLQ%HQGLJR(FKXFD.\QHWRQDQG&DVWOHPDLQHWKHUHVVRPHWKLQJIRUHYHU\ERG\%HQGLJR7$)(FDQJLYH\RXWKHVNLOOVDQGFRQGHQFH\RXQHHGWRVXFFHHG(QUROPHQWVDUHQRZRSHQ)RU PRUH LQIRUPDWLRQ RU WR DSSO\YLVLWZZZEHQGLJRWDIHHGXDXRUFDOOXVRQ%HQGLJR 7$)( KHOSHG EXLOGP\ SHUVRQDO FRQGHQFH DQGDGMXVWWRDQHZFDUHHU ,WZDVYHU\RYHUZKHOPLQJDWUVWEXWP\ WHDFKHUV DQG ZRUNSODFHJDYHPHWKHVXSSRUW,QHHGHG%2%+$,*+ &DUSHQWU\$SSUHQWLFHVKLS7HVWLQJDQG7DJJLQJ 2YHUKHDG3RZHUOLQHV6SRWWHUV&RXUVH%ULFNOD\LQJ3UH$SSUHQWLFHVKLS &HUWLFDWH,,,LQ*HQHUDO(GXFDWLRQIRU$GXOWV3ROLFH(QWUDQFH([DP3UHSDUDWLRQ7KLVDSSUHQWLFHVKLSFRXUVHSURYLGHVWKHWUDLQLQJFRPSRQHQWRIDFDUSHQWU\IUDPHZRUNIRUPZRUNQLVKLQJDSSUHQWLFHVKLS 7KLVFRXUVHSURYLGHVWKHNQRZOHGJHDQGVNLOOVQHFHVVDU\WRDSSO\IRUDOLFHQFHWRVSRWIRUSODQWZRUNLQJQHDURYHUKHDGSRZHUOLQHV 7KLVFRXUVHSURYLGHVWKHRSSRUWXQLW\WRGHYHORSOLWHUDF\DQGQXPHUDF\VNLOOVDQGPD\EHVWXGLHGDVDSUHSDUDWLRQIRUIXUWKHUVWXG\7KLVSURJUDPHQDEOHVRZQHUVRIDSSURYHGWHVWLQJDQGWDJJLQJHTXLSPHQWWREHFRPHFRPSHWHQWWRWHVWDQGWDJHOHFWULFDOHTXLSPHQW 'HVLJQHGIRUWKRVHZKRZLVKWRJDLQDQDSSUHQWLFHVKLSLQEULFNOD\LQJ7KHHPSKDVLVRIWKLVFRXUVHLVRQPDQXDOVNLOOVGHYHORSPHQW ,QWKLVVKRUWFRXUVH\RXZLOOOHDUQVNLOOVDQGWHFKQLTXHVWRDVVLVW\RXWRFRQGHQWO\XQGHUWDNHWKHHQWUDQFHH[DPLQDWLRQIRUWKH9LFWRULDQ3ROLFH)RUFH
-
Friday, July 29, 2011 Bendigo Weekly www.bendigoweekly.com.au LIFE 19
IT is dif cult to imagine what the area described as Irishtown was really like during the rst decade of Bendigos existence.
Even though the name of the overall town-ship had been changed to Sandhurst, to many locals, particularly those who had been here since the earliest years of the gold rush, the original name reigned supreme.
The Bendigo Creek had not been renamed the Sandhurst Creek. Sim-ilarly institutions, compa-nies and businesses that had their roots in our early history were keen to hold on to the original name of Bendigo.
A prime example of this at Irishtown was the Bendigo Gas Company not the Sandhurst Gas Company.
Even bodies that were set up almost two decades after the original rush such as the Society of Old Bendigonians, never entertained the idea that they should use the name Sandhurst, even though the majority of members were then already part of the establishment.
We can imagine the physical attributes of Irishtown in the rst dec-ades following the discov-ery of gold.
As we commute along Nolan Street today, it
seems almost unbeliev-able that in 1861 it would have been impossible for a horse and cart to nego-tiate the mud, and deep slush that was particularly concentrated in the valley of the Bendigo Creek.
Nolan Street between Lucan and McCrea Street was impassable except for foot traf c, even then, ex-treme caution had to be taken.
Amongst the detritus
of alluvial mining activ-ity in Irishtown, as men-tioned in the past weeks, there was a community of predominantly the very poor and their fami-lies.
Even though the area was the regular haunt of these socially disadvan-taged people there was a serious attempt by the churches to help provide community infrastructure facilities in the form of schools.
These schools initi-ated by religious organi-sations were referred to as Denominational Schools.
There existed another
stream in the educational system of the time, the National Schools, which were under governmental control and funding.
There were at least two Denominational Schools in Irishtown, both situ-ated in Lucan Street not far from Bakewell Street.
In February 1861, ten-ders were being called for the repair of the Church of England School at Irishtown.
Evidence suggests that this was the school known as St Johns. The very fact that the St
Johns School was being repaired indicates that it had been in existence for some time.
The Wesleyans, or Methodists, were also present in Irishtown as an 1863 report in a local newspaper indicates.
The reporter wrote: Ere many more weeks have elapsed the scattered but thickly populated district of Irishtown will host amongst other places of worship its Wesleyan chapel and schoolroom.
The edi ce which was commenced at the instiga-tion of the Reverend George Daniel is now fast draw-
ing to completion, and will shortly be suf ciently ad-
vanced for the consecration of the building, which is in the pointed Gothic style and built entirely of brick, is adjacent to the Church of England School in the same locality and will put to the blush the weatherboard erection of the established church.
The undermined state of the ground has rendered it necessary to form the foundations of tarred logs placed on the surface of the soil, which we cannot say gives an ornamental char-acter to the chapel: the roof is to be of corrugated iron, preparations for which are
already complete. An embrasure is left
in one of the gables for the reception of an inscription, which will certify the date of completion. We should imagine that this effort of the Irishtown Wesleyan de-nomination will stimulate other outlying districts to follow in their train.
The St Johns School by contrast had a shingle roof compared to the cor-rugated iron that was to be installed on the roof of the Wesleyan School.
The tar used on the foundation logs was from the Bendigo Gas Com-pany works, which along with the nearby Tysons Reef Mine was a substan-tial employer of Irish-town men.
Tar was one of the by-products of the gas from coal process.
DISCOVER BENDIGO
Whats in a name?WITHJAMESLERK
Businesses were keen to hold on to the original name of Bendigo
Whats in a name?Whats in a name?Whats in a name?Whats in a name?Whats in a name?Whats in a name?
PAPERWORK: Gas Company receipts show the use of place names.
&5,&263URYLGHU1XPEHU$ZZZEHQGLJRWDIHHGXDX6XLWDEOHIRUWKRVHZKRDSSO\DEURDGUDQJHRIDGPLQLVWUDWLYHVNLOOVLQDYDULHW\RIZRUNVLWXDWLRQV&HUWLFDWH,,LQ%XVLQHVVFRPPHQFLQJ0RQGD\$XJXVWDQG&HUWLFDWH,,,LQ%XVLQHVV$GPLQVWUDWLRQFRPPHQFLQJ0RQGD\$XJXVW$SSOLFDWLRQVDUHDOVREHLQJVRXJKWIRU&HUWLFDWH,9LQ%XVLQHVV$GPLQLVWUDWLRQ)RUIXUWKHUFRXUVHLQIRUPDWLRQRUWRDSSO\YLVLWRXUZHEVLWHZZZEHQGLJRWDIHHGXDX%86,1(66$1'%86,1(66$'0,1,675$7,213/$&(6$9$,/$%/()256(0(67(57:2Habitat Native Plant Company,
a long established wholesale plant business, opens as a retail nursery
Maiden Gully Road, Maiden Gully
0417 544 [email protected]
Extensive range of native plants from seedlings through to advanced specimens Rare and unusual varieties Drought tolerant and arid zone species also available
Derek FraserBSc (hons), quali ed Botanistwith 25 years of experienceOpen Wednesday-Sunday
and all public holidays 10am-5pm
Our Audi range,
now more attractive than ever.
*Interest rate 7.99% per annum to approved Business Applicants of Audi Finance** Applicable to all new, demonstrator & Audi Approved:plus vehicles. O er applies to new, demonstrator & Audi approved plus vehicles ordered and delivered before
31st July 2011. O er ends 31st July 2011 or while stocks last, whichever comes fi rst. Standard fees and charges apply. Not available to fl eet, government or rental buyers. Full conditions are available on application. **Audi Finance is a trading name of
Volkswagen Financial Services Australia Pty Limited. ^ Price excludes CTP, 3% stamp duty & dealer delivery charges. Overseas models shown. MLCT:10758.
Audi Centre Bendigo
140 - 150 High St, Bendigo, VIC 3550 l Tel. (03) 5443 1122
Audi Approved :plus
2 year factory backed unlimited kilometre warranty
115 point mechanical and safety inspection
24 hour roadside assistance
For a limited time, fi nance a
prestigious Audi at 7.99%*
For July only, take advantage of our o ers across
the Audi range and exclusive 7.99%* p.a. fi xed rate.
Visit Audi Centre Bendigo to arrange a test drive today.
2010 Audi A3 2.0 TDI S tronic Ambition,
Ibis White, Comfort Package, Plus Free On Roads, XWD419 ........................................................$50,350
2011 Audi A4 2.0 TDI multitronic,
Ibis White, Bluetooth Phone Prep, Plus Free On Roads, XZB026 ...................................................$55,400
2010 Audi A3 Cabriolet 1.8 TFSI S tronic Attraction,
Ice Silver, 17 Alloys, Comfort Package, Heated Front Seats, Plus Free On Roads, YKA605 ...............$56,850
2010 Audi Q7 3.0 TDI quattro tiptronic,
Ice Silver, Sunroof, Burr Walnut Interior, Plus Free On Roads, XZB033 ..........................................$96,244
2010 Audi A5 2.0 TFSI quattro S tronic Coupe,
Aruba Blue, S line Sport Pack, Front & Rear Parking, B&O Sound, Plus Free On Roads, XZB036 ..........$93,946
2010 Audi A4 1.8 TFSI multitronic,
Quartz Grey, Bluetooth Phone Prep, XWD633 ..........................................................................$48,000^
2008 Audi A4 2.0 TDI multitronic,
Ice Silver, S line Exterior Pack, Sunroof, XAF651 .......................................................................$49,900^
2007 Audi A4 Cabriolet 3.2 FSI multitronic,
Quartz Grey, Bose Speakers, UKE898 ......................................................................................$54,000^
2010 Audi TTS Roadster 2.0 TFSI S tronic,
Phantom Black, 19 Alloys, Bose Speakers, XZB045 ..................................................................$78,900^
Audi A5 Cabriolet 3.0 TDI quattro S tronic,
Amethyst Grey, 19 Alloys, Aluminuim Facette, B&O Sound, XZB027 ...........................................$95,000^
Audi demonstrator opportunities with free on roads Audi Approved:plus opportunities
Drive Away
Visit Audi Centre Bendigo today.
www.audicentrebendigo.com.au
2907
-
20 news www.bendigoweekly.com.au BendigoWeeklyFriday,July29,2011
Whatsthis? advertising feature
This Census night, shed some light
online.Tuesday August 9
This coming Census night, August 9you have a choiceYou can either fi ll out the Census form delivered to your home, or you can complete the eCensus online at census.gov.au. If you decide to complete it online, an SMS will notify the Collectors not to come back to your home.
When you fi ll out your Census form, shed some light on who you are. What you say will light the way forward for health, education,