case studies - huawei enterpriseenterprise.huawei.com/en/static/hw-360884.pdf · for network...

Case Studies

In Electric Power

ontentsIn Electric Power

P06

P08

P10

P12

P14

P04One Net: Connect Everyone, Connect as OneBuilding China's Robust Smart Grid InitiativesIntegrated Data Backbone Network Project (Phase Ⅲ) for SGCC

Huawei IPv6 Facilitates SGCC's Smart Grid DevelopmentSGCC's Trial Project of Next Generation Internet Technologies

Construction of a Reliable Optical Network for the World's Largest Hydroelectric EnterpriseChina Three Gorges Project Corporation (CTGPC) Fiber Ring Communication Network Project

Building a Robust 'Smart Grid' Bearer Network for Shandong Electric PowerOptical Transport Network (OTN) Solution Upgrades the Backbone Network for Shandong Electric Power

Securing Electric Power Grid OperationsSubstation Secondary System Security Protection Project for GPG

Building a Multiservice Unified Communications PlatformDistribution Automation, AMI, and FTTH Project for Beijing Electric Power Corporation

P20

P22

P24

P26

Make IT Simple, Make Business AgileSGCC Electrifies Its Dispatching System with Huawei's Servers

EPRI Implements Ecofriendly Practices with Huawei's OceanStor 18500

Huawei Business Continuity Disaster Recovery Solution Safeguards China Huaneng Group

State Grid of China Powers Up with Huawei Storage Solution

P30

P32

P36

P34

P38

P44

P46

Bringing Multi-modal Enterprise Collaboration to Your Fingertips

Boundless, Professional Wireless Broadband

Establishing a Reliable Video Conferencing NetworkAdministrative and Emergency Video Conferencing Project for SGCC

Huawei Provides Efficient Communications Services for PCCCPCCC UC Project

Reliable and Efficient Voice Communications NetworkSGJEPC Soft Switching System

Huawei Facilitates the Development of GZPS's Video Conferencing SystemGZPS Telepresence Project

Constructing a Modern Power Grid Marketing Services and Management System"95598" Contact Center for Guangxi Power Grid

World's First LTE Based Wireless Broadband Network for Power Distribution AutomationChina Southern Power Grid Chooses Huawei's eLTE for 'Smart Grid' Project

China's First CBD-Located Wireless Smart Grid Communications NetworkGuangzhou Power Supply Bureau TD-LTE Pilot Project for China Southern Power Grid

Huawei provides a full series of network infrastructure products and solutions such as routers, switches, Wi-Fi, WLAN, network security, optical transmission, microwave, PON, and network management. Through the collaboration between

different technologies, with the integration of solutions like network and security, wired and wireless networks, datacom and access, DCN and storage, Huawei can help enterprise customers build their network infrastructure platforms covering campus, branch offices, wide area connections, and data centers, to provide comprehensive enterprise network solutions.

One Net:Connect Everyone,Connect as One

In Energy &Power

One Net: Connect Everyone,Connect as One

4

Building China's RobustSmart Grid InitiativesIntegrated Data Backbone Network Project(Phase Ⅲ) for SGCC

BackgroundState Grid Corporation of China (SGCC) is a stateowned and the largest electric utilities company in the world. SGCC provides secure, reliable electric power support for Chinese social and economic development, which affects national energy safety and economic lifelines. SGCC currently operates its business in 26 provinces, autonomous regions, and municipalities—more than 88% of Chinese territory. SGCC has become a leading industry player in terms of gird construction by consistently building highly reliable, secure and IT-enabled networks.

Key ChallengesWith the rapid expansion of the Chinese economy, SGCC faced new challenges as its network grew both in aspects of scale and complexity. These challenges included the following:• Like other electric power utilities , SGCC had become more r e l i an t on i n fo rma t ion systems for a variety of applications, such as Office Automation(OA), Enterprise Resource

Planning(ERP), Call Center and Video Conference.These applications must be transmitted more reliably and effi ciently with differentiated Quality of Service, so that SGCC could substantially enhance their management capabilities and improve decision-makingefficiency.• Major events (such as the Beijing Olympic Games) and emergencies (for example, the Wenchuan earthquake and 2008 winter storms) demanded a more robust network that could quickly heal itself to ensure services being connected, even when some network nodes or links became faulty.

SolutionThe integrated data network mainly bears SCADA, office automation, communications, and video services. These services all have high requirements for network security and QoS. In response, Huawei offered a solution that used Multi-Protocol Label Switching Virtual Private Network (MPLS VPN) technology to isolate service systems and to improve network security. In addition, Huawei's VPN QoS technology provided differentiated QoS for different

In Electric Power

5

VPN services, ensuring that video (such as video conference and video surveillance), IP telephony, and data services could run securely and reliably.In SGCC's original integrated data backbone network, national, regional, and provincial networks were single-linked. If one link was faulty, all the other links could not function properly. Given this situation, Huawei's solution changed the original single-link topology to a mesh/partial-mesh network topology that prevents Single Point of Failure (SPOF) and implements redundancy protection for any links. Furthermore, Huawei's solution used a series of fast protection switching technologies, including Bi-directional Forwarding Detection (BFD), VPN Fast Re-Route (FRR), and IP Fast Re-Route (IP FRR), to ensure service continuity. When a network fault occurs, services will complete protection switching within 200 ms, before service systems can sense the fault. These technologies have laid a solid foundation for the secure operation of SGCC's services.SGCC selected Huawei's solution for three primary reasons:• Huawei's rich experiences in IP network construction and maintenance:Huawei, as a leading Information and Communications Technology (ICT) solutions provider, has constructed more than 130 national backbone networks and more than 700 Metropolitan Area Networks (MANs) for worldwide telecom carriers and broadcasting organizations. In China, Huawei has participated in China Mobile's IP bearer network project, China Unicom's IP bearer network project and SGCC's power Dispatch Data Network (DDN) backbone project.• Industry-leading network reliability technologies:Huawei's VPN FRR and IP FRR technologies each provide end-to-end network protection within 200 ms, which has been validated on live networks.• Large scale deployed routers:Huawei has shipped more than one million routers to customers world-wide. Offering reliability, stability andhigh-performancefeatures,thesefield-provenroutershavehelpedglobalcustomersreduceOperationand Maintenance (O&M) costs.

Customer Benefits• Capability of carrying more servicesTheunifiedIPnetworkcarriesmultipleserviceswhichareisolatedlogicallyandtreatedasdifferentiatedservices. This IP network reduces SGCC's network investment and enhances its ITenabled management capabilities.• Enhanced self-healing capabilitiesUpon SGCC's network optimization, its network fault rate decreases by 20 percent, and the number of key network disconnections falls by more than 30 percent.

SGCC's integrated data network mainly bearsSCADA, office automation, communications, andvideo services. These services all have highrequirements for network security and QoS. Inresponse, Huawei offered a solution that usedMulti-Protocol Label Switching Virtual PrivateNetwork (MPLS VPN) technology to isolate servicesystems and to improve network security. >>


6

Huawei IPv6 Facilitates SGCC's Smart Grid DevelopmentSGCC's Trial Project of Next Generation Internet Technologies

BackgroundSGCC was founded on December 29, 2002. The company's core services focus on grid development and operation, and provisioning of secure, cost-effective, eco-friendly, and sustainable power supply. SGCC's services cover 26 provinces across the country (accounting for 88% of China's total territory), providing services for 1.1 billion people. SGCC has over 1.86 million employees. As the world's largest public sector enterprise, the company ranked 7th in the Fortune 500 in 2012.Next-generation Internet plays a key role in smart grid development and operation. SGCC is making tremendous efforts to develop next-generation Internet to: • Improve the capabilities of providing, bearing, and supporting services.• Enhance system security.• Enableunifiedmanagementandcontrol.

Key ChallengesThe data communications network, serving as one of SGCC's key infrastructures, supports power generation, transmission, transformation, distribution, and usage. The network is like SGCC's nervous system. SGCC needed next-generation Internet technologies to leapfrog to smart-grid development. However, the development faced the following challenges:• Smart grid needed IPv6 to support the concurrent access of a large number of smart terminals.The smart grid has a large number of terminals. In addition to communications terminals and computers used in traditional grids, smart grids also have dedicated instruments, such as smart meters, interactive terminals, and grid control devices. Hundreds of millions of smart grid terminals are added each year. IPv4 technologies are no longer

In Electric Power

7

Huawei's IPv6 solution helps State Grid Corporation of China (SGCC) handle the massive increase in terminals access, address the challenges in high security risks, and compensate for low system reliability. >>

able to meet service requirements due to the limited IP address space. Moving towards IPv6 would be essential for SGCC to support massive increases in terminal access.• Network restructuring must not impact service continuity or system reliability.The communications network supports all service nodes and plays an important role in ensuring the secure, reliable, and stable operation of the smart grid. Therefore, the network restructuring has high requirements on performance, speed, security, and reliability. The communications network's topology depends on the smart grid. The network has diverse communications methods, devices, interfaces, and forwarding modes. The transformation must not impact network services.

Solution SGCC highly appraised the advancement and maturity of Huawei's solution, electing to use Huawei's NE40E high-end routers to upgrade the existing IPv4 MPLS data network. The new network supports IPv6 access and bears IPv6 services. SGCC launched trial projects in its branches in Shanxi, Ningxia, Qinhai, Liaoning, and Jiangsu provinces. The projects upgraded the substation LANs, application platforms, platform LANs, and access networks to support IPv6 services. • Huawei has rich experience in IPv6 evolution:• Solutions: Huawei provides the end-to-end IPv6 network evolution solution.• Technologies: Huawei supports diverse IPv4-to-IPv6 transformation technologies. • Devices: International authorities have certified that Huawei's devices, boards, and ports fully support IPv6 services.• Services: Huawei provides professional-grade IPv6 services enabling SGCC to complete smooth IPv4-to-IPv6 evolution.• Huawei's NE40E series router has the following features: • Uses reliable technologies at the network, service, and device layers to allow service switchover within 200 ms. These cutting-edge technologies provide end-to-end security protection for SGCC's network.• Employs Huawei-developed network processors. Each slot has a maximum routing capacity of 2 Tbit/s. These high-end routers have the industry-leading portdensityandsignificantlyimprovenetworkscalability.• Providesport-orientedfive-levelQOStoenableQoSfordiverseservicesand

to ensure the stable operation of key services.• Follows the industry trend of eco-friendly grid design and adopts energy-saving components for the routing platform. The power consumption of each GE port is less than 1 W, which is 30% lower than the industry average.

Customer BenefitsSGCC chose Huawei as its partner to implement next-generation Internet technologies and upgrade the smart grid's communications network. This choice brings SGCC the following benefits:• Smooth evolution in trial projects: SGCC's backbone network and pilot branch LANs now fully support IPv6 services.• Higher network reliability: SGCC now has the industry-leading basic network platform, laying a solid foundation for SGCC's smart grid development.• F u t u r e - p r o o f n e t w o r k d e s i g n : T h e communications network supports concurrent access from a massive number of terminals, able to meet SGCC's service requirements for the nextfivetotenyears.


8

Construction of aReliable Optical Networkfor the World's LargestHydroelectric EnterpriseChina Three Gorges Project Corporation (CTGPC)Fiber Ring Communication Network Project

BackgroundChina Yangtze Three Gorges Project (TGP), as one of the biggest hydropower-complex project in the world, ranks as the key project for improvement and development of Yangtze River.The China Three Gorges Project Corporation (CTGPC) was founded in 1993 with registered capital of CNY111.598 billion and about 14,000 employees. As part of the initiative to build the Three Gorges Project and develop the Yangtze River, CTGPC was authorized to develop the hydroelectric resources in the main river and tributaries of the upper reaches of the Yangtze River and to build four massive hydropower plants.The four hydropower plants will have a total installation capacityof 385 MW and will produce 175.3 TWh of electricity per year, making the Three Gorges Project the world's largest hydroelectric project.

Key ChallengesIn 2003, CTGPC constructed an optical network for communications services with synchronous digital hierarchy (SDH) devices. As communications services of the Three Gorges project continuously increased over time, the existing bandwidth and operating mode were insuffi cient to meet present and future service requirements. In fact, some devices were no longer even manufactured and spare parts were unavailable. The original optical network was in a precarious state.• Network reliabilityMission Critical services (power dispatching, emergency command, office automation (OA), telephone dispatch, and video surveil lance services, etc.) in the Three Gorges project had high requirements for communication network reliabitlity. Anyincidents,suchasdevicefaults,fibercuts,and

In Electric Power

9

network management system breakdowns would put the operation of key services at great risk. So the solution providers had to take all these threats into consideration.• Network integrationThe geographic environment in Three Gorges was so complicated to lay the fiberinsomeplace.Somenodeswerenotsuitableforlayingoutfibers.Services were supposed to be connected through the optical network and microwave.Toimproveoperationandmaintenance(O&M)efficiencyandtoenable quick troubleshooting, the optical network and microwave had to be seamlessly integrated.

SolutionAfterathoroughanalysisofcustomer'sservicerequirementsandexistingfiberresources, Huawei offered a transmission network solution with following outstandingbenefits:• Comprehensive network protection strategiesThisprojectplannedtoconstructtwofiberringnetworks.Topreventservicesfrom being interrupted by several fiber cuts, Huawei's solution used the automatically switched optical network (ASON) technology to implement services as permanent 1+1 protection mechanism at the diamond level.Huawei's solution used a device-level protection mechanism by way of 1+1 hot backup for core components in OSN devices, such as the cross–connection board, main control unit, and power supply unit. When one board was faulty, the backup board would immediately take over services to prevent the device breakdown.Huawei's solution deployed one U2000 (a network management system) at the pivotal center and cascaded dispatch center. To improve network security, VERITAS (a third-party software) was configured to monitor the network management system and application services in real-time. In this way, a geographic hot backup was deployed to improve system reliability.• Seamless integration of the optical network and microwaveHuawei's microwave equipment was embedded with the switching matrix,

and could be integrated with the optical network to form a mixed networking of wireless and wired networks. In addition, U2000 is an integrated network management system. It is able to manage the transmission network, access network and datacom devices simultaneously to export end-to-end fault analysis reports. These reports will help quickly locate the faulty nodes, reduce management blind spots among conventional network management systems, and further improveO&Mefficiency.

Customer Benefits• Highly reliable transmission network, to guarantee the stable operation of core hydroelectric servicesThis project comprehensively and considerably improves the robustness of the network in terms of device, service, and network-level reliability. In particular, this project concentrates on developing CTGPC's advantages and leveraging its abundant fiberresourcestoconstructanASONnetworktoguarantee stable operation of its key services.• Unifed network management for wired and wireless networks to save customer's OPEX, expanding the transmission networkHuawei owns an integrated management system for wired and wireless (microwave) networks. This project takes full advantage of this system to connect the original isolated network "islands" and achieves fast end-to-end service deployment and centralized network protection. This system also enables the CTGPC to conduct precision management and O&M of wired and wireless networks simultaneously.• Proven new technologies, to set a model for the power generation industryAs the world's largest hydroelectric project, the Three Gorges project successfully applies ASON technology to its communications network to improve network reliability. The success of this project stands a model for other power generation enterprises seeking to construct bearer networks.

Huawei provided an opticalnetwork solution for China ThreeGorges Project Corporation(CTGPC), which guaranteedthe stable operating of corehydroelectric services. Besides,the easy and unified managementsystem reduced the operatingcosts. >>


10

Building a Robust 'SmartGrid' Bearer Network forShandong Electric PowerOptical Transport Network (OTN) SolutionUpgrades the Backbone Network forShandong Electric Power

BackgroundShandong Electric Power Corporation (Shandong Electric Power) is a wholly-owned subsidiary of the State Grid Corporation of China (SGCC). The number of 550 kV/220 substations has been growing at an average of 20 percent every year. By 2015, Shandong Electric Power will have constructed a smart grid connecting 17 cities, in which main grids use 500 kV and municipal grids use 200 kV.

Key ChallengesShandong Electric Power faced the following challenges when trying to construct a reliable, nextgeneration and high-bandwidth network.• High network security and stability requirements associated with smart grids:Important critical applications such as the relay protection have extremely strict security standards

and require comprehensive protection strategies. The new IP and Storage Area Network (SAN) services are emerging on a large scale and establishing new requirements for communication networks.• Comprehensive protection strategies to support complex networks:The Shangdong provincial backbone network connects 17 provincial and municipal electric power centers and 19 substations. The provincial center is the central node. Three 10 Gbit/s channels are deployed for each municipal center connected to the provincial center. All municipal services are aggregated and backed up in the provincial center. As a result, the entire mesh network is very complex, and protection policy plays a key role.• Evolution from SDH/PDH to IP and SAN services:The power company's communications network is transforming from early 2 Mbit/s services (SDH/

In Electric Power

11

PDH)todiversifiedservices(IPandSAN).Despite the growing popularity of IP data services, conventional Time-Division Multiplexing (TDM) services will continue to persist for many years.Thechallengewastofindatechnologythatcantransmitmulti-services(conventional and new), including large-capacity data services.

SolutionHuawei proposed a solution for a robust smart grid that integrated nextgeneration Optical Transport Network (OTN) and Automatically Switched Optical Network (ASON) technologies to construct the backbone network.Huawei's solution had the following three key features:• Comprehensive protection strategies:Huawei's solution combined OTN and ASON mechanisms to protect both optical and electric layers. The ASON-based protection strategy efficiently protectedthecommunicationsnetworkfromfibercutsandotherman-madedamage, ensuring a more secure and reliable electric power service operation.The entire network used Huawei OptiX OSN8800/OSN6800 that supports ASON technology at both electrical and optical layers. Huawei also deployed Reconfigurable Optical Add/Drop Multiplexers (ROADMs) for complex nodes and ASON grooming for electrical layers. Huawei OSN8800 devices' large cross-connection capabilities reduced the space required in equipment rooms. The OSN8800 supports a maximum of 80 channels, with each channel supporting data transmission at 10 to 100 Gbit/s.• Industry-leading grooming capabilities for small-granularity services:Huawei OTN devices are intelligent Wavelength-Division Multiplexing (WDM) products that automatically enable switching protection, adjust the

In order to build ShandongElectric Power Corporation's next-generation and high-bandwidthnetwork, Huawei proposed asolution for a robust smart gridthat integrated next-generationOptical Transport Network (OTN)and Automatically Switched OpticalNetwork (ASON) technologies toconstruct the backbone network.The solution simplified servicedelivery and enhanced networksecurity. >>

network,andfixnetworkfaultsformanynetworkexceptions. The devices support up to 6.4 Tbit/s non-blocking, centralized cross-connection capabilities. These devices enable intelligent cross-grooming between optical wavelengths and electric granules of GE/ ODU1 (2.5 G)/ODU2 (10 G). At the time of development, Huawei was the unique provider that could enable flexible grooming between optical wavelength and electric granules from ODU0 (2.5 G) to ODUk (k can be 1, 2, or 3).• Field-proven, mature products:Huawei holds 80 percent of key patents of OTN.Huawei has led development and promotion OTN standards for the last 10 years, and its OTN products are used by 40 of world's top 50 telecommunication carriers. By Q1 2012, Huawei had shipped more than 140,000 sets of OTN devices, and secured more than 80 percent of the worldwide OTN market share.

Customer BenefitsIn 2011, Shandong Electric Power began to deploy Huawei's OTN-compliant WDM devices. After one year's operation, achievements are as below:• Service delivery has been simplified and network security has been enhanced.• Huawei's smart OTN devices ensure the robustness of the transmission network. Huawei's solution not only supports the strategy of developing a smart national grid, but also helps Shandong Electric Power import power from other provinces. This project enhances Shandong ElectricPower's industryinfluenceandwillhelpSGCC to construct industry-leading smart grids before 2020.• The energy-efficient, low-noise OTN devices implements SGCC's principle of "constructing environmentally friendly projects and bearing more social responsibilities".


12

Securing Electric PowerGrid OperationsSubstation Secondary System SecurityProtection Project for GPG

BackgroundGuangdong Power Grid Corporation (GPG) is the largest provincial power grid in China, has a registered capital of CNY48 billion. It directly manages 36 municipality-level and 79 county-level power supply utilities.

Key ChallengesThe second network security construction of GPG contains horizontal and vertical links:Horizontally, the system is divided by production control area and information management area. The production control area contains security zone I and security zone II; information management area contains servers farm zone (security zone III) and office zone (security zone IV). Vertically, the provincial-level dispatch center, municipality-level dispatch center, and county-level dispatch center conduct communication through power dispatching data network and power enterprise data network.• Network securityHorizontally, real-time zone I services were core

services for GPG with the highest security grade. However, there was no security network border between realtime zones I and II. This loophole put real-time zone I services in danger.Vertically, data transmission between upper-level and lower-level networks was frequent; however, the original network system did not provide effective measures to safeguard network security. Once an internal user was attacked by the Internet or used files that contained viruses or Trojan horses, the security hazard would rapidly spread across the network, resulting in large-scale security threats.• Emergency handling capabilitiesAs GPG's grid architecture and operating mode became increasingly complex, faults at any site in the electric power system would threat GPG grid's operations. Especially when the fault happened in high level grid, it would spread throughout the gird and outage would happen if the fault was not resolved quickly.• Network scalabilityGPG intended to invest CNY125 billion in the electric power grid construction in 2010.Substation quantities (220 kV or more), transformed

In Electric Power

13

In order to solve the security problem of Guangdong Power GridCorporation (GPG), Huawei deployed security gateways withdiverse performance capabilities to conduct a risk assessmenton dispatch data networks and substations. The solutionachieved zero security incidents and considerably reducedGPG's substation optimization costs. >>

power volume and overall link length were, respectively, 1.97 times, 2.1 times and 1.96 times higher than those in 2005. GPG's rapid development set very high requirements for expansion of the information system and devices.

SolutionHuawei deployed security gateways with diverse performance capabilities to achieve a risk control on dispatch data networks and substations.Horizontally, Huawei deployed USG5000s in redundant back-up mode on the network borders between security zones I and II to isolate transmission of production and non-production data. In this way, non-production data transmission would not affect the transmission of production and control data.Vertically, Huawei deployed USG5000s between upper-level and lower-level networks ( in redundancy backup) to encrypt transmission data using a 128-bit Virtual Private Network (VPN) algorithm. Furthermore, Huawei constructed internal authentication centers to authenticate user access from lower-level networks to upper-level networks, preventing malicious intrusions (such as wiretapping) into the dispatch data network.Huawei's solution incorporates the following three key features:• Isolated data transmission and access authentication to reduce security risksHuawei's solution deployed hardware firewalls between safety zones I and II to strictly control user access. These firewalls are centrally managed to improveaccesscontrolpolicyefficiencyandpreventunauthorized or illegal access.Huawei also deployed firewalls within the

information management section, between provincial-level and municipality-level dispatch centers, and between municipality-level dispatch centers and substations. This kept upper-level and lower-level data transmission isolated to prevent large-scale network security threats.• Link and two-node clusters redundancy to minimize service interruptionsIn Huawei's solution, dual links (in redundancy back-up) are used to connect the control zone and non-control zone in GPG's dispatch center. Huawei also deployedonefirewalloneachlink.Thetwofirewallssynchronizetrafficandcommunication data between each other in order to back up. These measures effectively decreased the network fault rate and improved network reliability.TheMeanTimeBetweenFailures(MTBF)forthesefirewallsisupto500,000hours, and the protection switching time is less than 0.1s, ensuring service operation reliability and stability.• Highly scalable design to help facilitate the strategic goals of GPGCurrently, GPG has constructed the following different voltage substations:23*500 kV, 200*220 kV and 1,400*110 kV substations. By 2011, GPG would double the number of the following substations over the next five years: 50*500 kV, 400*220 kV and 2,000 kV substations.

Customer Benefits• Achievezerosecurityaccident,assistingGPGtofulfillrequirementsof No.5 regulation of National Power Supervisory CommitteeIt’s been two years since the deployment of Huawei equipments. In the past two years, the regional Power Bureaus and Substations of GPG achieved zero information security accident, zero information system operation accident and zero crucial data leakage accident, assisting GPG in satisfying regulations of the National Power Supervisory Committee.• Set up solid foundation for the substation digitalization of GPG plannedinthenation’seleventhfiveyearplanWith its high performance and scalability, Huawei USG series gateway can achieve smooth expansion of GPG network, both in port number and performance, greatly reduce the expenses caused by security network upgrades, avoid the risks of business breakdown caused by bringing new equipments into network, and significantly reduce the cost inputting in the substation digitalization of GPG.


14

Building a Multiservice Unified Communications PlatformDistribution Automation, AMI, and FTTH Project for Beijing Electric Power Corporation

BackgroundEstablished in 1985, Beijing Electric Power Corporation (BEPC) is a provincial subsidiary of the State Grid Corporation of China (SGCC). It provides services to 4.8 million customers in Beijing and surrounding areas, covering nearly 17,000 square kilometers.

Key ChallengesOver recent years, BEPC has been striving to build a Smart Grid, and it urgently needed to add related systems, particularly distribution automation and smart metering. The distribution automation system demands stringent requirements for network reliability and latency, while the smart metering system calls for high network reliability, wide network coverage, and multiservice support. Services include real-time power consumption

data collection, tariff control, telecontrol, abnormal power consumption analysis, electricity quality analysis, smart meter archive management, and data submission to the marketing service management system, among many others. However, BEPC's existing systems had faced the following challenges:Conventional wireless public networks (GPRS/CDMA) were not reliable enough. They failed to meet requirements for high network bandwidth, wide network coverage, and high network reliability. As China is enthusiastically encouraging “four-network convergence” (smart grid, data, video, and voicenetworks),BEPCfounditdifficulttorespondto this national advocacy because its existing networks could not support Gigabit Ethernet (GE), Fast Ethernet (FE), Voice over IP (VoIP), Wi-Fi, and Radio Frequency (RF) video interfaces simultaneously. As a result, BEPC's networks failed

In Electric Power

15

The Smart Grid is the future of power grids. As the closest part with customers, an efficient power distribution and consumption system is critical within the smart grid. As a company that specializes in power distribution and consumption, BEPC chose Huawei's industrial-grade xPassive Optical Network (xPON) solution to roll out distribution automation and Advanced Metering Infrastructure (AMI), as well as Fiber-To-The-Home (FTTH) services. The solution deployment had also proved that BEPC's new business model — optical fiber leasing and FTTH — was technically feasible. >>

to meet the convergence towards future networks.

SolutionIn response to BEPC's challenges and requirements, Huawei offered a field-proven xPON solution, which provides the all-service interfaces that BEPC needs and helps the organization embrace the Internet of Things (IoT) era by building a connected home network.Using a reliable, secure local optical network, this xPON solution makes it possibletotransmitcollecteddatasecurely,efficiently,andall thesehappeninreal time. This solution also provides various service interfaces (such as RS232, RS485, GE, and FE) for the user side, accommodating present and future service demands. For the Zhonghong and Jianbang residential areas in Beijing, Huawei helped BEPC deploy several Optical Line Terminals (OLTs) inside the 10 kV power distribution room, where the OLTs upload data to the control center. Each OLT provides16to32PassiveOpticalNetwork(PON)ports.Opticalfibercompositelow voltage cable (OPLC) is routed out from these PON ports, to optical splitters, and then to Optical Network Units (ONUs), namely, the Huawei MA5621/MA5621A, which are deployed in the power distribution cabinet located in the residentialbuilding.TheONUswerethenconnectedtothemetersoneachfloorof the building through RS485 cables to collect metering information in real time. To support FTTH services, BEPC also deployed other types of OLTs inside the power distribution room. Each OLT provides 32 to 48 PON ports. OPLCs are routed out from these PON ports to optical splitters, to the Optical Distribution


16

Frame (ODF), and then to the household power distribution box. The flat-dropcableisroutedoutfromthehouseholdpowerdistributionboxto the in-home ONU, offering a variety of broadband services, including Internet access, telephony, and television services.This solution has many compelling features, such as:• Dedicated electric power terminals feature high security, easy scalability, and easy maintenance.• Industrial-grade ONUs use a sealed casting aluminum shell to protect against water, dust, and corrosion. They can operate normally at temperatures of as high as 85°C. In addition, these ONUs support 6 kV surge protection for both user-side ports and power supplies.• The ONUs provide two uplink ports that use Small Form-factor Pluggable (SFP) optical modules. The two uplink ports can auto-adapt to work in an Ethernet Passive Optical Network (EPON), Gigabit Passive Optical Network (GPON), or GE mode to meet different site requirements. • The solution employs a full series of OLTs that adopt a unified platform and implement redundancy protection for key components• Huawei's full series of OLTs are well suited for diverse scenarios requiring small, medium, and large capacities. Unlike similar products from other vendors, Huawei's OLTs adopt a 1+1 redundancy design for bothmaincontrolboardsandpowersupplies,thefirst-of-its-kindintheindustry.• The OLTs support GPON, EPON, 10 G GPON, and 10 G EPON simultaneously and allow a smooth bandwidth evolution to 10 Gbit/s.• By using unified software and hardware platforms, all OLT service boardsarefullycompatiblewitheachother,significantlyreducingthe

In Electric Power

17

number of required spare parts. • The solution provides a comprehensive protection mechanism to ensure network security and service continuity.• Huawei's xPON solution supports Type B/C/D protection as well as hand-in-handprotection.Huaweiisalsothefirstvendortousedual-uplink(hotbackup)technology, in which dual ONU uplinks are connected to the upstream devices. This dual-uplink design eliminates the need for link switchover and ensures service continuity. • The OLTs use Bidirectional Forwarding Detection (BFD) technology in the upstream direction and work with routers and switches to provide redundancy protection for uplinks, ensuring network protection.

Customer BenefitsHuawei's xPON solution has brought many benefits to BEPC, including the following:• BEPC has optimized its power consumption data collection system into an IP-based one, signifying a further step towards the IoT era. This new IP-based system streamlines data collection, facilitates metering, and offers a two-way communication platform to remotely manage power consumption, enabling automated smart grid marketing and enhancing marketing and service capabilities.• With xPON FTTH, BEPC can gradually implement “four-network convergence,” so users can experience bundled, top-notch triple-play services. • Huawei'sxPONsolutionusesanefficientNetworkManagementSystem(NMS)that does not require a large number of maintenance personnel. As a result, BEPC can easily manage and maintain the entire network.


With the development of cloud computing, Huawei offers customers storage, servers, cloud computing and data centers, and ICT products and solutions. Huawei also cooperates with more than 400 partners such as Intel,

SAP, and CA, to provide IT industry solutions. These solutions enable customers tobuildadvanced,efficient ITplatformswhichhelp themadapt to changes in enterprise business.

Make IT Simple,Make Business Agile

In Energy &Power

SGCC Electrifies Its Dispatching System with Huawei's ServersBackgroundFounded in December 2002, State Grid Corporation of China (SGCC) is the largest state-owned electric utilities company in the world. SGCC serves 1.1 billion people in 26 provinces, autonomous regions, and municipalities in China, which equals to 88% of the country's territory.

Key ChallengesThe power grid system is a critical part of the national infrastructure, and its stable operation is closely linked to people's livelihood and the economic health of the country. The power grid dispatching system is the "nerve center" of the entire power grid system, which ensures the secure, reliable, and economical operation of the power grid.SGCC used a system called D5000 as the platform for the dispatching automation system. D5000 is a complex system that consists of servers, storage devices, network devices, operating systems, databases, middleware, and application software. D5000 provides a wide assortment of key services, including Supervisory Control and Data Acquisition (SCADA), Energy Management System (EMS), Operations Planning and Scheduling (OPS), Security

Checking System (SCS), Operator Management System (OMS), and Dispatcher Training Simulator (DTS).SGCC used an x86 server cluster to replace traditional midrange computer systems in the D5000 system to provide computing capabilities required by all SGCC key services. As the foundation of the D5000 system, the x86 server faced the following challenges:Security and compatibility: SGCC concentrated on the security of servers that are the most fundamental computing platform. Since 2010, x86 servers running the secure Linux operating system provided the infrastructure platform for the power grid dispatching automation system. The Linux operating system was customized according to characteristics of the power grid industry. In this way, the server that functions as the computing platform must be highly compatible to run the customized Linux operating system.Reliability: The server and storage device reliability directly affects the proper running of the key service systems such as the SCADA and EMS systems and the stable operation of the entire power grid. All dispatching automation devices must meet the reliability requirements of the Chinese government,

20

In Electric Power

Huawei's servers have been applied in the SGCC dispatching system for a long period of time. Their high performance, stability, and reliability meet our service requirements. In addition, Huawei is a trusted solution provider who can provide fast after-sales service. >>

which specifies that the average annual availability rate must be more than 99.99%, and the mean time between failures (MTBF) must be greater than 25,000 hours.Performance: The power grid dispatching automation system is a real-time processing system. The frontend communication server installed in the dispatching center needed to process a large amount of telemetry and telecommand data reported by the SCADA system. Additionally, the server runs key service systems (for example, EMS) which computed and analyzed the collected telemetry and telecommand data, to deliver remote control and commissioning instructions to substations. For example, according to theindustryspecificationsreleasedbytheChinesegovernment,workstatuschanges of substations must be reported to the dispatching center within 1s. In addition, the dispatching center must respond to dispatch tasks of higher priorities within 2s. For large-sized power grids, midrange computers were commonly used to meet computing requirements of dispatching tasks.

SolutionAfter analyzing SGCC's special requirements for IT devices, Huawei enhanced its cooperation with industry partners such as Beijing Sifang Automation Co. Ltd and Nanjing Nari-Relays Electric Co., LTD and set up special workgroups for clarifying customer requirements and designing solutions. After thoroughly analyzing the customers' requirements on D5000, Huawei proposed a system consisting of the RH2485 V2 4-socket server, E6000 blade server, and S5600T storage devices, and conducted technical tests in accordance with SGCC's requirements.• RH2485 V2 4-socket serverA variety of online service systems (such as the SCADA and EMS) were deployed on Huawei RH2485 V2 servers. Multiple RH2485 V2 servers were deployed in cluster mode to provide computing capabilities for D5000. An RH2485 V2 is 2U high and supports a maximum of four Intel E5-4600 CPUs and 1.5 TB memory, which provides high-performance and highly reliable computing capabilities for upper-layer service applications. • E6000 blade serverOffline service applications, for example, DTS, were deployed on Huawei E6000 blade servers. Each E6000 blade server provides space for 10 server blades in an 8U subrack. One subrack supported a maximum of 40 CPUs,

which provides strong computing capabilities for DTS. In addition, the Huawei E6000 blade server also supports both GE and FC switching modules,whichsimplifiesthesystemarchitectureand provides an integrated computing and network solutionthatsatisfiesDTSrequirements.As for the "x86 server + Linux operating system" infrastructure platform, Huawei servers can be adjusted and optimized based on customers' requirements, which greatly enhances the platform compatibility and ensures security of upper-layer service applications.

Customer BenefitsHuawei servers and storage devices have been widely used for the D5000 dispatching systems at SGCC and its subordinate provincial power companies.• High securityHuawei's servers leverage a variety of innovative technologies and customer-specific onsite optimization functions to ensure high security for the power grid dispatching system. Huawei's servers and storage devices have passed security and compatibility tests conducted by third-party software. • Lowered TCOHuawei's RH2485 V2 and E6000 have helped the customer reduce maintenance costs by 30% compared to similar products. Meanwhile, the high-density E6000 blade server decreases about 50% footprint and 10% energy consumption without compromising computing capabilities.With continuous performance and reliability increase of x86 servers, the "x86 server + Linux operating system" infrastructure has become the mainstream architecture in the power industry. In recent years, Huawei has enhanced its cooperation with industry partners such as Beijing Sifang and Nanjing Nari-Relays to promote the application of Huawei's Tecal series servers in China's smart grid market. Yu Bin, R&D Manager of Beijing Sifang, stated, "Because of x86 server's achievements in performance, reliability, cost-effectiveness, and technical service, the power grid dispatching system starts to deploy high-end x86 servers in batches instead of Unix servers. We have realized that x86 servers will be more extensively applied in the power industry, ranging from power grid dispatching systems to substations."

21


EPRI Implements Eco-friendly Practices with Huawei's OceanStor 18500BackgroundFounded in 1958, the Electric Power Research Insti tute (EPRI) of Guangdong Power Grid Corpora t ion p rov ides t echn ica l r e sea rch , development , and appl ica t ion services for Guangdong Power Grid Corporation and its power supply bureaus. It is home to 11 dedicated bureaus, 7 advanced testing centers, and 33 labs. To date, it has received 22 national-level electric power awards and 31 provincial-level technology awards. It is a technically-capable research institute with a comprehensive range of dedicated equipment.

Key ChallengesThe EPRI is tasked with developing smart grid products and implementing eco-friendly practices.After years of research, the EPRI has achieved fruitful results in energy conservation. For example, the EPRI has built a sulfur hexaflouride (SF6) recycling center that boasts the largest scale, strongest processing capability, and most complete testing devices in China. Since its establishment, the recycling center has processed 16.1 tons of SF6

gas (the equivalent of reducing emissions of carbon dioxide by 382,000 tons) and recycled 14.4 tons of gas.The EPRI also has rigid energy conservation requirements for its data center that bears its research achievements. According to its IT team, there was still room for improvement in energy conservation. IT service systems were deployed separately, resulting in low resource utilization and high energy consumption. As a result, the IT team found an urgent need for an eco-friendly data center.

SolutionThe IT team planned to leverage virtualization technology to improve resource utilization while reducing energy consumption.To address customer challenges, Huawei proposed a high-end storage solution OceanStor 18500 to centrally store service system data. The solution has the following highlights:• High resource utilizationThe solution leverages a variety of technologies to improve resource utilization:

22

In Electric Power

Huawei's OceanStor 18500 has helped us maximize resource utilization, accelerate response speed to data access requests, and reduce energy consumption for implementing eco-friendly practices. >>

• RAID2.0+:virtualizesandpre-configuresharddiskstobalanceloads,eliminatingidle and hot spare disks.• SmartMotion: automatically balances data among added hard disks after a capacity expansion.• SmartThin: allows the customer to purchase devices based on their requirements, greatly increasing resource utilization.• Low service interferenceMutual interference among services is likely to occur after the service data is centrally stored to a single device. In response, the solution adopts SmartQoS and SmartPartition technologies to obtain a response delay within 2 ms, protecting key services from being interfered by other services.• Low energy consumptionWith virtualization and centralized storage, the solution reduces energy consumption by about 50%.Six months after the solution was put into use, the EPRI smoothly increased the controller quantity to 4 and expanded the hard disk capacity to 100 TB to accommodate new service systems. With the intelligent matrix system architecture, the solution supports smooth capacity expansion without compromising the response speed. To accommodate the rapid growth of data volume in the future, the customer can also smoothly increase the controller quantity to 16 and expand the hard disk capacity to 7 PB.

Customer BenefitsHuawei's OceanStor 18500:• Delivers a virtualization architecture to improve resource utilization and eliminates idle and hot spare disks to avoid unnecessary energy consumption.• Protects key services from being interfered by other services.• Supports smooth capacity expansion without compromising the response speed.

23


Huawei Business Continuity Disaster Recovery Solution Safeguards China Huaneng Group

BackgroundChina Huaneng Group (Huaneng) is the largest power generation company in China. In 2013, Huaneng ranked 231st in Fortune 500 Companies. The company currently has 48 wholly-owned subsidiaries and branches, with a workforce of 150,000. Its core business divisions cover electric power,coal,andfinancesectors.

Key ChallengesHuaneng considers IT development as a long-term priority. With safety and reliability at the forefront, Huaneng is dedicated to building a highly reliable data center to ensure business continuity. However, the company faced many challenges that compromised business continuity:• Huaneng had more than 30 mission-critical business systems, including enterprise asset management (EAM), comprehensive database

applications, HR management, office automation (OA), email, and portal systems. These systems interacted with each other but were disparate in system characteristics and priorities. One of these systems had crashed twice, which seriously affected the company's business. So, what measures could be adopted to ensure business continuity for all systems? Huaneng was unable to meet this goal by simply backing up data. Therefore, after reviewing all business systems, the company decided to pursue business-specificend-to-endcontinuitymeasures.• To ensure business continuity, Huaneng required a disaster recovery (DR) system. The DR system generally carried no load under normal conditions. If Huaneng built a homogeneous DR system, it would incur additional purchases and maintenance costs aswellassignificantlywasteresources,resultingina low price/performance ratio. Therefore, Huaneng sought a DR system with a high price/performance ratio that could accommodate their rapidly growing

24

In Electric Power

We attach great importance to high business reliability. Following a thorough analysis of our businesses, Huawei provided us with a custom solution to meet our needs. This solution has helped us resolve business continuity issues. We now have trouble-free IT systems in place, which will act as the cornerstone for our future business growth. >>

business demands now and in the future. (Note: In its production systems, Huaneng had used a large number of UNIX servers.)

SolutionAfter a meticulous selection process, Huaneng selected Huawei's Business Continuity Disaster Recovery Solution. Huawei's solution entailed the following:• Provided a custom high reliability architecture after a full analysis of business impact and transaction per second (TPS) on the live network.After conducting a business impact analysis (BIA) on the live network and fully considering the characteristics of each business system, Huawei provided a custom business continuity DR solution with the following features:• Disparate business systems use varied recovery time objective (RTO) and recovery point objective (RPO) solutions.• DRmeasuresarerisk-specific, includingcityincidents, in-buildingevents,storage system crashes, and host logic errors.This custom DR solution implements Tier 5 DR defined in SHARE 78 standards, guaranteeing the business system continuity in the face of a variety of risks.• Introduced an X86 architecture, replicated database and middleware data from UNIX servers to X86 servers, and increased the price/performance ratio by 50%.Huaneng primarily used UNIX servers in its production systems. Huawei analyzed the TPS of all business systems running on the live network and found variation in TPS levels across these systems.Based on these findings, Huawei proposed to continue using UNIX servers to build DR for business systems with heavy workloads and to deploy X86 servers to build DR for business systems with light workloads. Huawei also made it possible to replicate database and middleware data from UNIX servers to X86 servers. All these factors increased the price/performance ratio by 50% while not compromising system reliability.• Reused legacy resources to protect investments.Huawei's solution was maximally compatible with heterogeneous systems. It enabled replication of database and middleware data from UNIX servers

to X86 servers, but also fully utilized storage virtualization products and Huawei's OceanStor 18800 high-end storage system as DR equipment for the original storage arrays in the product systems. Therefore, original storage arrays were reused. This ensured high I/O performance, enhanced DR capabilities, and maximally protected investments.• Fully leveraged network advantages to support smooth capacity expansion in the future.The DR system needed to be able to smoothly expand to meet future business demands. To meet this requirement, Huawei provided its CE12800 data center switch — a flagship switch that supports Transparent Interconnection of Lots of Links (TRILL), an open large Layer 2 technology — to flatten the network structure. With its million-level input/output operations per second (IOPS) and scale-out architecture, this switch makes it possible to seamlessly scale up the DR system.

Customer Benefits• Business-specificDR,withuptoTier5DRasdefinedinSHARE78standards• Replacement of the UNIX server architecture with an X86 server architecture to build DR, increasing the price/performance ratio by 50% • Reuse of legacy equipment, protect ing investments worth more than CNYxx million• Purchase and operating costs reduced by more than CNYxx million, while not compromising system reliability

25


State Grid of ChinaPowers Up with HuaweiStorage SolutionBackgroundState Grid Corporation of China (SGCC) was ranked the 7th largest company in the world in 2011, according to the Fortune Global 500 ranking, and is the world's largest electrical utilities company. The company's core businesses include the construction and operation of a power network covering 26 provinces, autonomous regions and municipalities. Its service area represents 88 percent of China's territory and serves a population of more than 1.1 billion people.

Key ChallengesState Grid uses an Energy Management System (EMS) to guarantee the security, stability and proper operation of the electric power system and provide a sufficient,reliablepowersupply.Tomoreeffectivelyaccomplish this task, the EMS system was divided into a series of application systems. Among these application systems, the Supervisory Control And Data Acquisition (SCADA) system had the highest priority and provided data to other application systems, making SCADA's work effi ciency and data security essential for the entire EMS. In evaluating revisions to the existing system, State Grid looked at:

• PerformanceThe SCADA system was mainly used to collect data returned by Intelligent Electronic Devices (IEDs) in the electric power system and to transmit the data to the control zone and management zone systems. The live network contained a huge number of terminals, putting enormous strain on SCADA's data storage capabilities.• StabilitySince the SCADA system was the primary data source for all application systems in the EMS, any faults on SCADA's storage functions would directly impact operations across the entire system; therefore, the SCADA system needed to be completely reliable and stable.• SecurityWithin the electric power system, the EMS directly controls the grid system operation. Any attack-induced faults on the system would cause major outages.

SolutionThe basic SCADA system functions included data collection, information display, data monitoring, alarm handling, information storage, report

26

In Electric Power

generation, event interval recording, and post disturbance reviews. The thousands of IEDs in the electric power system generate massive amounts of data related to device status and this information is refreshed every few seconds, which presents a serious challenge to data storage device performance.As demonstrated in earlier tests and verifications, Huawei S5600T devices achieved up to 1,000,000 IOPS performance ratings and were well suited for addressing the regional and provincial networks' application requirements. In addition, the electric power system could enhance the performance of Huawei S5600T devices through Solid-State Drive (SSD) acceleration to meet future service requirements, protecting customer's original investments.• Level-3 acceleration facilitates system performance improvement.Huawei T series storage devices use next-generation PCIe 2.0 bus and SAS 2.0 high-speed I/O channel technologies. The internal switching bandwidth is up to 36 Gbit/s. These storage devices provide a solid foundation for overall

storage system performance. When future services impose additional strain on storage devices, customers can use the SmartCache feature to cache data to SSD hard disks to accelerate device performance or directly use SSD hard disks to store data.• Redundant ar chi tec ture minimi zes downtime.Huawei T series storage devices use dual power supplies, dual controllers, data safe, hard disk precopying and hard disk bad sector repair to ensure the reliability of both the hardware and software platforms.• Huawei propr ie tary s torage system improves response time.Huawei T series storage devices use Huawei's industry-leading, proprietary, high-performance storage system, which meets customized storage requirements.

Customer Benefits• Highly reliable data storage and high-speed data exchangeHuawei T series storage devices can satisfy even the most stringent customer requirements due to their redundant architecture and outstanding performance. A redundancy back-up design for components prevents Single Points Of Failure (SPOFs). A series of software technologies, such as data safe and file system mirroring, are available to improve system reliability. In addition, customers can use host-based agent software to achieve fast application-level backup, restorationanddisasterrecovery.Recent in-fieldtests have shown that Huawei's state-of-the-art storage devices can successfully guarantee the security and stability of EMS.• Industry-leading interoperability performanceHuawei T series storage devices work with software products from mainstream EMS vendors. To improve the interoperability between them, Huawei has worked with partners to set up interoperability labs to ensure that T series storage devices are interoperable using the latest software products. These efforts have enabled Huawei to provide industry-leading IT infrastructure that ensures secure electric power system operations.

To support the rapid growth ofpower consumption in China, theState Grid Corporation is buildinga large-scale electrical systemwith more than 20,000 high voltagesubstations. Unfortunately, thepower demand is unbalancedwith the generation requirements,requiring that power be shiftedbetween different parts of thecountry, based on instantaneousdemand. Controlling this complexenvironment requires rapidaccess to vast amounts of data,but State Grid's current storagesystems could match the needs.By deploying a powerful, reliableand scalable storage system fromHuawei, State Grid was able to meetthe challenges of their businessand keep the lights on throughoutChina. >>

27


Huawei'sfivecoreproducts–unifiedcommunications,contactcenters, converged conference, telepresence, and video surveillance–providesolutionsthatfreeindustrialcustomersfromgeographicalandspacelimitationsandhelptobuildunifi

edandefficientteams.Familiarapplicationsincluderemoteeducation,banking, offices, consultation, court sessions, and transportation monitoring.

Bringing Multi-modalEnterprise Collaboration toYour Fingertips

In Energy &Power

Bringing Multi-modal EnterpriseCollaboration to Your Fingertips

Establishing a ReliableVideo ConferencingNetworkAdministrative and Emergency VideoConferencing Project for SGCC

BackgroundState Grid Corporation of China (SGCC) is the largest utilities in the world, and also one of the most essential state-owned enterprises in China. SGCC provides electricity to more than one billion users across the country and is crucial to national energy safety and economic prosperity. SGCC is committed to provide safe, economical, clean, and sustainable electric power for social and economic development. Environmentally conscious and efficient operations are of primary importance in completing this mission. Today, China's power grid carries unprecedented traffic, creating growing challenges. In response, SGCC is striving to ensure that the power grid continue running securely and stably.SGCC is determined to establish a reliable video conferencing system to quickly and effi ciently respond to natural disasters and minimize the economic and social impact on people's lives.

Key ChallengesSGCC's existing SD video conferencing system, mainly used for office administrat ion, was constructed in 2000. It has several serious defects, such as poor image quality and lack of dual-stream transmission and multi-channel image uploading.As SGCC raised the stability requirements for power grid, the original conferencing system faced the following issues:• Diff icult device management since the original conferencing system was built with devicesfromfivedifferentvendors.The original conferencing system was very unstable. Management and maintenance personnel were continual ly concerned about network failure, especially when large-scale and important conferences were held.• Low resolut ion and unable to provide emergency command and dispatch services.In early 2008, a severe winter storm swept through

30

In Electric Power

most of China's territory, and the strain on communications systems was unprecedented. The original conferencing system could not handle the workload and was only capable of transmitting CIF-level images of the affected areas to SGCC headquarters command center. Image quality defects seriously affected decision-making when responding to storm damage.

SolutionHuawei's highly stable, fully-compatible, and emergency industry-dedicated video conferencing system addresses customer requirements for system stability and ease of use.After in-depth and rigorous consultations with the customer, the Huawei video conferencing system was selected to satisfy these requirements. SGCC is very satisfied with the solution, based on the following:• SGCC demanded that the conferencing system must guarantee around the clock stability. In response, Huawei incorporated a full redundancy backup architecture for all Multi-point Control Units (MCUs), MCU boards, links, and terminals to ensure that the video conferencing system continues running uninterruptedly in the event of Single Points of failure (SPOFs). Tested in more than one hundred conferences, the full backup mechanism ensures 24/7 system stability. Huawei's video conferencing system fulfills the customer's strict requests for an efficient and robust system. This system is also compatible with other products from standard protocol-compliant vendors (including the five vendors used in the original solution) to help protect the customer's original investments.

Huawei's highly stable, fully-compatible, and emergencyindustry-dedicated video conferencing system addressesSGCC's requirements for system stability and ease ofuse. According to SGCC's statistics, in one year, SGCCheadquarters held 1,123 telephone and video conferences,with a total of 644,000 participants, which reduced travelcosts and improved work efficiency. >>

• Huawei's video conferencing system provides 1080p video quality, delivers 20 times clearer images than the original system, and supports multi-channel cascading. In electric power emergencies, the provincial command center needs to quickly transfer highquality images from municipalities to SGCC's headquarters command center. The Huawei VP8660 MCU's embedded video wall function transfers the images to the video wall in SGCC's headquarters command center, helping SGCC executives make decisions quickly and minimize any repercussions caused by the emergency. For example, when typhoon Haikui hit the east coast of China in August 2012, the Huawei video conferencing system played an important role in responding to the disaster.

Customer Benefits• Improved system stability and reduced O&M pressureThecustomerwasextremelysatisfiedwiththe24/7stabilityofthe Huawei video conferencing system. The system also shortens time spent setting up the system from several hours to about a half hour. The system's stability and ease-of-use vastly improved OperationandMaintenance(O&M)efficiencyovertheoriginalsystem and resolved many troublesome issues O&M personnel had previously faced during large-scale video conferences.• ReducedtravelcostsandimprovedworkefficiencyAccording to SGCC's statistics, in one year, SGCC headquarters held 1,123 telephone and video conferences, with a total of 644,000 participants. If the per-person travel cost is CNY1500, the Huawei videoconferencing system has helped SGCC save approximately CNY1 billion.Once deployed, the Huawei video conferencing system can simultaneously transmit High-Definition (HD) images from multiple locations to SGCC's headquarters command center. These HD images help SGCC executives clearly understand electric power infrastructure damage in emergency situations and make quick decisions to minimize the economic and social impacts on people's lives.

31


Huawei Provides Efficient Communications Services for PCCCPCCC UC Project

BackgroundPower Construction Corporation of China (PCCC) is an ultra-large power group founded with the direct approval of the State Council of People's Republic of China. The company is China's only organization that provides comprehensive hydroelectr ic engineering services, covering infrastructure design, survey, consultancy, supervision, construction, management, investment, and operation. The company has hundreds of affiliated agencies that provide services for over 80 countries around the world. In 2013, PCCC ranked 354th in the Fortune Global 500, 15th among the world's 225 top international engineering contractors, and 16th among the world's largest design companies. PCCC required an integrated UC system to meet the company's requirement on global operation.

Key ChallengesPCCC had a legacy communications system

tha t he lped the company to provide bas ic communications services. However, this system could not help PCCC enhance regulation compliance or improve communications efficiency due to its following disadvantages:• Costly voice communicationPCCC's global branches mostly communicated with each other using their own voice switching systems and telecommunications carriers' group services. The company lacked a private communications network, resulting in high communications costs.• Isolated conferencing systemsThe legacy video conferencing systems in PCCC's branches had high-end hardware and flexible software. These systems worked independently and could not integrate with other communications systems, disabling advanced functions, such as unified conference scheduling and conference notification.• Lack of real-time unified communications system

32

In Electric Power

Huawei's highly reliable, open, and collaborative UC solution provides rich multimedia communications services and supports seamless integration with third-party systems, lowering operating costs, and improving communications and office efficiency. >>

PCCC lacked real-time unified communications system. Some branches, such as the hydroelectric group, had their own real-time communications system that operated independently, disabling advanced functions, such as instant messaging (IM) and corporate directory query.

SolutionHuawei integrates PCCC's existing communications systems to develop a UC system that enables convenient and cost-effective communication. The solution significantly improves PCCC's communicationsefficiencythankstothefollowingfeatures:• High security, reliability, and stabilityThe PCCC HQ develops the core platform, controls voice switching, provides communications services, andmanagesusersinaunifiedmanner.Asaccessunits,branchesdeployaccessgatewaystoconnecttothe core platform over private IP networks. This dual-center structure improves the security, reliability, and stability of internal communication and service interaction.• Optimal multimedia service experienceThe core platform provides access units with multiple advanced services, such as voice over IP (VoIP), corporate directory, IM, voice conferencing, multimedia conferencing. Users can easily join conferences with simple mouse clicks and enjoy high quality progressive communication.• Open and collaborative architectureThe core platform provides open interfaces and IP multimedia subsystem (IMS) to integrate video conferencing, email, and office automation (OA) systems, significantly improving PCCC's communicationsefficiency.

Customer BenefitsThesolutionoffersPCCCthefollowingbenefits:• Group-wide VoIP services lower communications costs.The IP network covers PCCC's HQ, branches, subsidiaries, business departments, and project faculties worldwide,loweringthecompany'scommunicationscosts.Thecompanyusestheunifieddialingrulesthat simplify users' operation. IP phones use the 48 kHz sampling rate to provide CD-quality audio services.• Diversecommunicationapplicationsimprovecollaborationefficiency.The solution provides diverse multimedia UC applications, such as IM, corporate directory, multimedia video, data conferencing, and voice mailbox. These applications cover from basic voice communicationstoserviceinteraction,improvingPCCCemployees'collaborationefficiency.• Communication systems integrated into service systems improve the company's office efficiency.The solution integrates the UC system with PCCC's OA system, allowing users to query others' status and place calls with simple mouse clicks. This improves the company's incident response capabilities andserviceprocessingefficiency.

33


Huawei Facilitates the Development of GZPS's Video Conferencing SystemGZPS Telepresence Project

BackgroundAs a subsidiary of China Southern Power Grid (CSPG), GZPS provides power supply services for Guangzhou's 12 districts. The company has 8000 employs and serves 4.38 million population scattered across an area of 7434 square kilometers. GZPS develops an HD video conferencing system to facilitate internal communication, simplify policy implementation, reduce travel costs, and improve service quality.

Key ChallengesGZPS has frequent service conferences that require a reliable and secure communications system to ensure smooth service operation. GZPS faced the following challenges:

• Outdated SD devices suffered from low stability.Devices used in GZPS ' s l egacy SD v ideo conferencing system were aged and outdated, causing f requent network outage and high maintenance costs. The system could not meet GZPS's service development requirements.• The conferencing system lacked unified management.GZPS has 5 affiliated agencies. The legacy SD video conferencing system did not support micro controller unit (MCU) cascading and decentralized management. The system could not meet GZPS's conferencing requirements.• GZPS required interconnection with CSPG's HD video conferencing system.GZPS's legacy system did not support the

34

In Electric Power

Huawei provides the highly reliable HD telepresence solution for Guangzhou Power Supply Co. Ltd. (GZPS). The solution connects to the GZPS's already-in-place Cisco devices to enable flexible conference management, improve communications and decision-making efficiency, and reduce maintenance costs. >>

interconnectionwithCSPG'sHDvideoconferencingsystem,disablingunifiedconferencingservices.

SolutionHuawei provides the HD telepresence solution covering GZPS's HQ and branches. The solution uses MCUs, HD terminals, and service management center (SMC) to provide the following features:• High reliability and HD videoHuawei deploys two sets of SMCs and two sets of MCUs to enable hot backup, and uses Synchronous Digital Hierarchy (SDH, also known as 4E1) and IP networks to ensure stable networkconnection,significantlyimprovingthesystemreliability.• Layered managementThe solution deploys MCUs to enable automatic cascading and layered user rights management.Thisdedicateddesignbalancesconferencingandmanagementtrafficwhilelowering the system's network bandwidth requirements.• Seamless interconnection with CSPG's HD videoconferencing systemCSPG's HD videoconferencing system uses Cisco devices. The solution supports digital MCU cascading to improve the system's scalability and to enable the interconnection with third-party devices.

Customer BenefitsHDtelepresencesolutionprovidesthefollowingcustomerbenefits:• HDexperienceandhighercommunicationsefficiencyThe solution uses the 1080p video and stereo to provide face-to-face conferencing experience,improvingcommunicationsefficiency.• Flexibleconferencingmanagementandhigherdecision-makingefficiencyUsers can easily hold and retrieve instant conferences based on service requirements, allowing efficient incident processing, and minimizing casualties and economic loss. Convenient operation also brings higher system usage, further improving the communicationsanddecision-makingefficiency.• Lower maintenance costsThe system features high reliability, allowing unmanned maintenance, and 24/7 uninterrupted operation, substantially lowering the system's operation and maintenance costs.

35


Reliable and Efficient Voice Communications NetworkSGJEPC Soft Switching System

BackgroundSGJEPC is a wholly-owned subsidiary of State Grid Corporation of China (SGCC). As an ultra-large power supply enterprise, SGJEPC's business focuses on developing, managing, and operating the grid to support Jiangxi's economic development. SGJEPC has 25 subsidiaries (including 12 municipal power companies) and 96 wholly- and partly-owned local power companies. SGJEPC has a total of 63,000 SGJEPC employees who provide services for 14 million households in Jiangxi. SGJEPC plans to develop a voice communications network in its newly established provincial subsidiary for trail usage, which will be expanded in the future to cover all SGJEPC branches in Jiangxi.

Key ChallengesSGJEPC's legacy communications network uses program-controlled switching technologies to provide services. This existing network has the following disadvantages:

• Outdated devicesSGJEPC's already-in-place devices are aged and outdated, and suffer low capacity. SGJEPC urgently needed to reform and upgrade its network to meet service requirements. • Low security and reliabilitySGJEPC's existing switches were provided by different vendors. The system suffered a high fault rate due to the lack of unified management. Switches deployed in local power companies had low performance and reliability, resulting in high network fault rate, frequent service interruption, inefficientinternalcommunication,andslowserviceresponse. These issues considerably lowered the network's service experience.

SolutionHuawei uses the advanced next generation network (NGN) architecture to provide a cutting-edge communications network for SGJEPC's provincial subsidiary, laying a solid foundation for SGJEPC's

36

In Electric Power

Huawei provides State Grid Jiangxi Electric Power Company (SGJEPC) with the highly reliable, open, and integrated soft switching solution. This solution replaces outdated devices in the legacy network to improve system reliability, utilizes already-in-place devices to reduce investment costs, and provides rich multimedia services to enable efficient communication. >>

network development in other branches. The solution has the following features:• Dual-center architecture, ensuring network security and reliabilityThe solution deploys the SoftX3000 soft switching device in both the active and standby distribution centers. These two centers connect to each other in the dual-homing mode using the IP network. Huawei alsoinstallsfirewallsandlayeredusermanagementsystemstoprovidesecurity protection services.• Open and integrated network architecture, ensuring smooth network reform and upgradeThe network consists of the following components:• UMG8900 general media gateway: connects to the public switched telephone network (PSTN) and uses diverse relays, such as No.7, No.1, DSS1, PRA, R2, and Q series, to connect to existing devices.• UA5000 large-capacity access gateway: supports the access of analog devices.• Highlyscalablesystem:enablessystemexpansionandmodificationbased on users' requirements on functions and performance.• Standard interfaces: enables the deployment of diverse practical multimedia services.

Customer BenefitsTheadvancedNGNsolutionbringsSGJEPCthefollowingbenefits:• Unified network management lowers the investment and system O&M costs.The solution uses open and integrated architecture that allows SGJEPCtoupgradeandmanageexistingdevicesinaunifiedmanner,significantly lowering the project's investment costs and simplifying system O&M.• The dual-center architecture significantly improves network reliability.Huawei deploys soft switching devices in both the active and standby distribution centers. These two centers work in two-node cluster node, ensuring network security and reliability.• Richvalue-addedservicesallowmoreflexible interactionandimprovecommunicationsefficiency.The solution implements soft switching technologies to enable diverse basic services, such as call control and signal protocol processing. SGJEPC can deploy application servers to provide voice, video, and data conferencing, and messaging services to simplify internal communication and improve user experience. Users can employ multimediaconferencingapplications,suchasdesktopsharingandfilesharing,substantiallyimprovingcommunicationsefficiency.

37


Constructing a Modern Power Grid Marketing Services and Management System"95598" Contact Center for Guangxi Power Grid

BackgroundA wholly-owned subsidiary company of China Southern Power Grid Co., Ltd., Guangxi Power Grid Company has 22 branches (14 city-level power supply bureaus), 43 wholly-owned subsidiaries (42 county-level power supply bureaus) and one subsidiary holding company. It also has temporary jurisdiction over two county-level power supply bureaus.Guangxi Power Grid Company constructed its "95598" contact center system (including interactive voice response and manual voice services) for all its city-level power supply bureaus in 2002 and gradually extended the system to its county-level power supply bureaus afterwards. In 2005, a customer service center was set up in the

headquarters of the city-level power supply bureaus to monitor all city-level contact centers and handle incidents reported by customers. In the same year, an online customer service center was established, which enabled customers to access various services without having to go through the power supply bureaus. To generate a work ticket in response to a customer request, Huawei’s solution used C&C08 UAPs to route a 95598 call through a city-level power supply bureau before automatically generating a work ticket at a county-level power supply bureau. This process eliminated the need for county-level power supply bureaus to interact directly with customers. As the original "95598" contact center system could not meet the customer’s capacity and functional

38

In Electric Power

In order to better serve its customers, China’s Guangxi Power Grid Company deployed a comprehensive solution from Huawei featuring an IP contact center, comprehensive security protection mechanisms and industry-leading system architecture. The company’s "95598" contact center has since become the benchmark for all power grid company contact centers in China. >>

requirements, the need for a new contact center became increasingly urgent.

Key ChallengesIn 2009, Guangxi Power Grid Company initiated its plan to construct a brand-new "95598" contact center system. However, in this phase, Guangxi Power Grid Company encountered the following challenges:• Out of warranty equipmentThe company’s existing contact center devices had been in operation over five years and were outside the hardware warranty period. In addition, portions of the software had reached end-of-life, so scalability was a problem.• LackofbusinessflexibilityContinuous development of contact center capabilities enables companies to react to changing business requirements quickly. In the case of Guangxi Power grid Company, legacy contact center systems were running outdated hardware andsoftwarearchitectures.Asaresult, itwasverydifficult toensureconsistentservices across all power supply bureau areas, and some areas were unable to offer certain services.• ManagementdifficultiesEach of the Contact center systems used by the power supply bureaus worked in isolation from the rest. This made it impossible to establish a pool of agent resourcestobeallocatedthroughunifiedrouting,whichinturnledtoinefficientresource utilization. For instance, during high call traffic times or emergencies, some agents would become overloaded, while other agent resources in other contact centers were idle. In addition, data in each contact center was independently stored, resulting in poor data integration, problems sharing data and inefficientmonitoringofcontactcentersystems.• Need to reuse existing equipmentAlthough the hardware was past warranty and the software deployed was no longer supported, the systems remained operational. In order to realize the best possible

39


ROI, the customer needed to upgrade its contact center systems to accommodate new IP-based functions, while retaining backwards compatibility with existing equipment.

SolutionHuawei provided the Guangxi Power Grid Company a new "95598" contact center solution with the following features:• Centralized deployment and managementAll system devices are centrally deployed, with a pool of physically separated agents sharing a centralized single allocation system. The systemsupportsagentmonitoring,configurationandqualitycontrol,greatly reducing management and maintenance complexity.• Multi-level backup mechanismsTwo centers are deployed, as well as core devices in a two-node hot standby cluster, which ensures the proper operation of the contact center system in the event of a network fault.Agents can simultaneously access UAP2100s (IP) and C&C08 UAPs (TDM), which enables and ensures local trunking reliability.Multi-level backup mechanisms are supported, which enhances the reliability of the entire contact center system.• Reuse of existing devicesThe existing Huawei C&C08 UAPs are reused to create a TDM backup link through the E1 trunk, which ensures the proper operation of voice services if an IP link experiences a fault.

Customer Benefits• Highly-Reliable contact center systemLeveraging comprehensive security protection mechanisms, tandem center models, dual backup and dual links (IP and TDM), Huawei constricted a highly reliable and secure contact center solution for the customer. This solution has grown into a prototype example for China Southern Power Grid, and contact center projects throughout China.

40

In Electric Power

• EfficientSystemmanagementBy integrating service and information resources, the system operator gained the ability to monitor and manage all contact center services from a centralized console, enabling the customer to reorganize and optimize the service management process.• Improved customer satisfactionHuawei’s "95598" contact center solution provides agents access anytime, from anywhere within the workspace, and in any mode. And Huawei's solution also delivered improved service quality and customer satisfaction by developing the power company’s call center function into a comprehensive business offering capable of delivering other services to market. • Save investment of existing equipmentIn making full use of existing C&C08 UAPs to provide a TDM backup link, Huawei’s solution not only improved system reliability but also greatly saved on additional investment by the customer.

41


Utilizing its solid background in LTE, CDMA, and GSM mobile communication technologies, Huawei offers enterprise customers broadband trunking, video surveillance, long-distance coverage, E2E encryption, Location-Based Service

(LBS), SMB solution LitePTT, GSM-R railway wireless dispatch, and high-speed train control infrastructure solutions.

Boundless,Professional WirelessBroadband

In Energy &Power

Boundless,Professional Wireless Broadband

World's First LTE BasedWireless BroadbandNetwork for PowerDistribution AutomationChina Southern Power Grid ChoosesHuawei's eLTE for ‘Smart Grid' Project

BackgroundChina Southern Power Grid Co., Ltd. (China Southern Power Grid) is a large state-owned enterprise in charge of the investment, construction a n d m a n a g e m e n t o f p o w e r t r a n s m i s s i o n , transformation, distribution, etc.The company wanted to upgrade automatic control of its power distribution network with wireless communications technologies. From mid of 2011, the China Southern Power Grid has started the construction of small-scale wireless smart grid pilot.

Key ChallengesThe cons t ruc t ion o f a power d i s t r ibu t ion communication network faced the following challenges:• Unreachable wired network for some areas

In the past, China Southern Power Grid constructed wired networks. However, i t was becoming infeasible to construct wired networks in some places such as old urban areas. These and other shortcomings in the existing system led China Southern Power Grid to investigate broadband wireless networks.• High rent cost and poor quality of public wireless networksPublic carriers' networks, including 2G/3G network, failed to meet service requirements due to their poor privacy,highrentcost,andsomeotherinsufficientresources. China Southern Power Grid is forced to findabetterwirelesscoveragemodebecauseofallof the above limitations.• Limitat ions of short-distance wireless communicationsAs for limitations in the transmission distance and

44

In Electric Power

sensitivity to the geographic environment, the short-distance wireless communications technology is only suitable for simple business application in a small range, unable to meet the full-service demands of power distribution automation.

SolutionHuawei submitted an ultra-bandwidth wireless automatic distribution communication network according to the service requirements of China Southern Power Grid. This solution is based on 4G eLTE technology, and it was designed to meet the needs of distribution automation, metering automation, and distribution network video surveillance services.This solution adopted an industry-dedicated wireless spectrum (1785 - 1805 MHz). Under the Non- LOS conditions, the solution could provide high bandwidth data access services in both fixed and mobile scenarios, and also some value-added services such as emergency communication and video surveillance.The solution provides the following features:• High-bandwidth services with wide coverage and large capacity:For base station part, Huawei puts the RRU on towers and uses multi-antenna technology; as to terminal part, Huawei provides LTE outdoor data collection terminals which can support IP67 protection level, and they can connect with highgain antenna, andoffermultiplemodesspecifictoavarietyofdeploymentscenarios. For example, in dense citys where 10 MHz bandwidth is used, Huawei's solution is below:

• The average throughput of a single carrier can reach 20 Mbps, and coverage radius is as large as 4 km. The solution can satisfy the high-bandwidth transmission requirements of distribution automation and smart metering.• A single carrier could support up to 1,200 online users, and the number of online users is up to 10,800 for one cell. The features well meet the requirement of large capacity for smart gird.• Minimal access latency for precise controlAn automatic power distribution system must precisely control the power distribution services. Especially for remote control, the E2E delay should less than 1s. Take the application layer, network management system and other protocols into consideration, the maximum acceptable wireless access latency is100ms.Toensureefficientpowerdistribution,HuaweieLTEuses a minimum access latency solution to ensure it is less than 100 ms. Under "live" conditions, downlink access latency does not exceed 11 ms (average 8.8 ms), and uplink access latency does not exceed 59 ms (average 36.9 ms), which fully meets the requirements of mission-critical applications, such as SCADA.• Multilevel QoSDifferent service applications have different priorities. The LTE system centralizes radio resource management to ensure end-toend Quality of Service (QoS) based on service levels. Huawei's LTE QoS mechanism develops priority strategies for multiple service levels, which ensures that important data, such as remote control data, is transmitted before other services.Huawei combined the LTE QoS mechanisms and power service needs together, and designed the specific priority strategy. The solution could fully support all the services; meanwhile, it can ensure the priority transmission of some important data such as distribution automation remote control data.

Customer BenefitsHuawei's ultra-bandwidth smart grid solution provided three key benefitstotheChinaSouthernPowerGrid:• VerifiednewmodeforpowerdistributionnetworkThis project verified the feasibility of broadband wireless communication networks for power distribution automation, while improved the flexibility and reliability in constructing communications networks.• Reduced deployment and maintenance costsBroadband wireless networks efficiently avoided fiber network construction by establishing wireless coverage in both old and new urban areas. And all services including distribution automation, smart metering and video surveillance could be carried by the wireless networks, so network maintenance costs were greatly reduced.• Improved customer satisfactionHuawei's wireless communication solution improved customer satisfaction by enhancing power supply reliability and delivering optimal services.

Huawei submitted anultra-bandwidth wirelessautomatic distributioncommunication networkaccording to the servicerequirements of ChinaSouthern Power Grid.This solution is basedon 4G eLTE technology,and it was designedto meet the needs ofdistribution automation,metering automation, anddistribution network videosurveillance services. >>

45


China's First CBD-Located Wireless Smart Grid Communications NetworkGuangzhou Power Supply Bureau TD-LTE Pilot Project for China Southern Power Grid

BackgroundChina Southern Power Grid is a large state-owned enterprise that handles the investment, construction, a n d m a n a g e m e n t o f p o w e r t r a n s m i s s i o n , transformation, and distribution across five of China's southern provinces. Guangzhou Power Supply Bureau is a large power supply company affiliated with China Southern Power Grid and provides power supply services to 10 Guangzhou administration districts and two counties. The company announced, in the Technology Development Planning component of its Twelfth Five-Year Plan, it would continue researching and applying new power distribution communications systems (based on wireless communications technologies) and focus on upgrading its automatic power distribution network. To accomplish these tasks, China Southern Power Grid would construct an integrated data collection platform and optimize the power distribution system's data analysis functions.

In mid-2011, China Southern Power Grid began building small-scale test zones to develop its wireless smart grid. Guangzhou Power Supply Bureau was chosen to pioneer the wireless smart grid and verify whether the smart grid distribution network could function reliably in highly populated cities. To this end, Guangzhou Power Supply Bureau selected Yuexiu District as the pilot area and set up base stations in the most populated district in Guangzhou.

Key ChallengesGuangzhou Power Supply Bureau is listed in the rankings of cities with the largest user density in China. To improve service efficiency and address end users' service requirements, Guangzhou Power Supply Bureau urgently needed to provide automatic power distribution, automatic and intelligent metering, video surveillance, and Bring Your Own Device (BYOD).Guangzhou, as a megacity, extends its distribution

46

In Electric Power

China Southern Power Grid Co., Ltd. (China Southern Power Grid) needed to improve distribution network communication efficiency and expedite the construction of its IT-enabled electric power service. After meticulous analysis of the requirements, Huawei offered China Southern Power Grid a TD-LTE-based, fourth-generation, wireless smart grid solution, which laid a solid groundwork for China Southern Power Grid's further future development. >>

terminals (secondary devices with 10 kV or less voltage) from substations to numerous communities and factories via power supply cables. In Guangzhou, more than 100,000 distribution terminals are scattered throughout the city and are operating in harsh environments. Against this backdrop, Guangzhou Power Supply Bureau's smart grid development was bottleneckedbypoorcommunicationefficiencybetweenthepowercontrolsystemsinthe equipment room and the numerous distribution terminals. Over the past few years, Guangzhou Power Supply Bureau has tried multiple traditional communication modes toimproveefficiency;however,duringconstructionofthetraditionalcommunicationmodes, Guangzhou Power Supply Bureau was primarily challenged in the following aspects: • Some regions had no wired access. Wirednetworkconstructionwasgreatlyinfluencedbythegeographicalenvironment.It was infeasible, if not impossible, to build wired networks in certain areas. For example, construction projects in populated downtown areas must be reviewed and approved by government civil labor agencies. Such constructions are complicated with long implementation periods. In addition, these constructions require excessively high material and labor costs, as well as complicated follow-up maintenance; therefore, to better support its service development, Guangzhou Power Supply Bureau chose to construct wireless networks in these areas.• Public networks were too costly or failed to meet service requirements.Publicnetworksfailedtomeetservicerequirementsduetoinadequateconfidentiality,high lease costs, and insufficient service resources. These shortcomings forced Guangzhou Power Supply Bureau to turn to wireless networks.• Available bandwidth for short-distance wireless communication was limited and prone to environment-induced obstacles.Short-distance wireless communications transmission was limited and substantially affected by the geographic environment. As such, short-distance wireless communications could only be used to transmit some simple services on a small scale

47


and could not meet all power distribution network service requirements. With the development of 4G wireless communications technologies, China Southern Power Grid could alleviate many automatic power distribution network construction problems. Wireless broadband private networks could not only free wired networks from environmental restrictions but could also overcome 2G/3G public network disadvantages, such as poor performance and insufficient resources; therefore, the organization preferred wireless broadband private networks for building the power distribution network.

SolutionTo fully address Guangzhou Power Supply Bureau's requirements for simple deployment, high reliability, and high-speed access, Huawei offered a wireless smart grid solution, based on 4G wireless Time Division Long Term Evolution (TD-LTE) communications technologies. The solution set up TD-LTE base stations in the customer's existing substationsandofficebuildings,operatingonanindustry-dedicatedwirelessspectrumof1.8G. In addition, Huawei deployed dedicated TD-LTE modules with distribution terminals, such as Remote Terminal Unit (RTU), Data Transform Unit (DTU), and Feeder Terminal Unit (FTU). These base stations converge data collected from multiple electric power terminals and send it to the host station located in the central equipment room via the customer's existingtransmissionnetwork.Thisefficientlyconnectselectricpowerterminalstopowercontrol systems in the control center, achieving automatic distribution. Huawei's wireless smart grid solution was developed for the electric power industry to help customers achieve wide coverage in complex environments and to provide quality diversifiedservices.Thissolutionincludesthefollowingkeyfeatures:• High-bandwidth service with wide coverage for a large number of users• Generally, power stations (such as distribution rooms and ring main units) are scattered across the city, and base station height is rather low in populated areas. In response, Huawei used an array of industry-leading technologies, including Multiple-Input Multiple-

48

In Electric Power

Output (MIMO), high-gain antennas and High Power Amplifiers (HPAs) to improve transmission power for enhanced and widened coverage. One base station supports a 1.5-kilometer coverage radius, ‘five-nines’ reliability, and more than 30 Mbit/s bandwidth. To this end, Huawei's base stations are providing full access for distribution terminals around the transformer stations and are satisfying the high-bandwidth requirements for automatic power distribution, automatic metering, and video surveillance services. • Automatic power distribution and automatic metering technologies involve numerous communication sites. Each site has a small information volume, but, added together, the total volume can be massive. For this project, Guangzhou Power Supply Bureau needed to provide concurrent access for more than 400 terminals in one square kilometer. In response, Huawei optimized access capabilities, enabling one base station to support more than 3,000 concurrent users. This allows full access for current service power distribution terminals and supports follow-up capacity expansions to provide access for a variety of service terminals, including automatic metering and distribution terminals and charging piles. • Multipleindustry-specificterminaldeploymentmodes• The bureau’s electric power terminal models varied, requiring different deployment approaches. Huawei had successfully helped multiple electric power enterprises, such as Guangdong Zhuhai Power Plant Branch and Dalian Electric Power, build intelligent wireless networks; therefore, after thorough analysis, Huawei was able to offer diverse modular deployment modes. For example, underground cabinets and ultra long-distance deployment were used to improve coverage and enhance communications quality without compromising operational security and electric power device stability.• Multi-level QoS assurance and less than 100 ms access latency• In the automatic power distribution network, different service applications have differentpriorities.Basedonrefinedservicelevel-basedmanagement,theLTEsystemintegrates radio resource management to ensure end-to-end Quality of Server (QoS). Huawei’s customized priority strategies for electric power services, based on the LTE

49


QoS mechanism, can support multiple services while ensuring that important data, such as automatic remote service data, is preferentially transmitted.This QoS mechanism works with Huawei's industry-leading, real-time onlineterminalsandflagshipsolutiontominimizelatency,ensuringlessthan 100 ms end-to-end latency and easily addressing power distribution network requirements. Another highlight worth mentioning, Huawei's TD-LTE solution uses an array of end-to-end data protection methods, including 128-bit Advanced Encryption Standard (AES) encryption and authentication encryption to ensure high data security and reliability.• Fast, high quality deliveryHaving built 77 percent of the global commercial networks for international telecom carriers and setting up multiple wireless smart grid demonstration sites, Huawei has developed a solid track record in deploying electric power wireless projects. These projects have given Huawei an in-depth understanding of customer requirements and application scenarios. Huawei has considerable experience in wireless network design, implementation, and service migration, enabling fast smart grid construction without compromising network security.

Customer BenefitsHuawei helped China Southern Power Grid pioneer the construction of a wirelessmegacitysmartgridnetworkthatofferedthefollowingbenefits:• Verification of Central Business District (CBD) wireless smart grid network feasibility• As a megacity, Guangzhou has numerous skyscrapers, increasing electric power terminal deployment difficulties and complicating wireless network construction. Compared with smaller cities, coverage and access requirements are more stringent, and Huawei had no examples to follow. Despite these obstacles, Huawei was able to develop multiple technological innovations and breakthroughs, meeting China Southern Power Grid’s requirements for a CBD wireless smart grid.• Simple deployment and maintenance, improving power distributioncommunicationefficiencyandreducingmaintenancecosts• A single base station in the customer's existing building can provide greater than 1.5-kilometer coverage radius, enabling regional electric power terminals to quickly access the smart grid using TD-LTE modules. Air interfaces connect communication sites, dramatically improving deployment efficiency of power distribution communication networks and saving follow-up maintenance costs. • Multi-service application• Huawei's solution can satisfy the high-bandwidth requirements of power distribution network communications and an array of advanced applications, High-Definition (HD) video surveillance, BYOD, and multimedia clusters. Huawei's solution helps the customer improve securitymonitoring,marketing,andofficeefficiencyandachievehigherelectric service informatization. This project lays a solid foundation for China Southern Power Grid's future development.

50

In Electric Power

Huawei Enterprise Business Group ("Huawei

Enterprise") is one of the three business groups

of Huawei, a leading global information and

communications technology (ICT) solutions

provider. By leveraging our strong R&D

capabilities and comprehensive technical expertise, Huawei's

strategy in the enterprise domain focuses on close cooperation and

integrationwithpartnerstodeliverawiderangeofhighlyefficient

customer-centric ICT solutions and services that are based on a

deep understanding of customer needs. In line with our strategy,

we offer a broad portfolio of innovative ICT solutions that cater to

global vertical industry and enterprise customers across government

andpublicsector,finance, transportation,energy, largeenterprises,

communications and multiservice operators (MSOs), and small

and midsize enterprises (SMEs). Our portfolio covers enterprise

networking, unified communications & collaboration (UC&C),

cloud computing & data center, enterprise wireless, network energy

and infrastructure services.

AboutHuawei

When ICT experts share their views on technological trends, you get the information you need to move forward with crucial choices. This is ICT Insights. This is a new window into ICT that reveals a deep understanding of today's challenges, with accurate analysis and forecasts of changes in the information and communications industry. Join us as we converge on practical technology - a better way.

51

enterprise.huawei.com

Copyright © Huawei Technologies Co., Ltd. 2014.

All rights reserved.No part of this document may be reproduced or transmitted in any form or byany means without prior written consent of Huawei Technologies Co., Ltd.

case studies - huawei enterpriseenterprise.huawei.com/en/static/hw-360884.pdf · for network...

Documents