1

FlexiRotorS 3000

Automatic rotor spinning frameContinua automática de hilar a rotor

2 3

F l e x i R o t o r S 3 0 0 0

FlexiRotorS 3000 / Duo-Spinner

Why?The need to supply smaller lots of yarn is increasingly felt also in the rotor spinning field where quick and reliable delivery times are a must.While the technologically advanced components of the spinning boxes and the ease and rapidity, with which they are changed, have made rotor spinning so highly flexible in terms of processing possibilities and ranges, it also holds true that the machines available on the market today do not have the same industrial flexibility.Because of this, it was essential to offer a “totally flexible” rotor spinning process besides guaranteeing the technological performances of quality and speed, which have already been reached by using a new high quality spinning box.

¿Por qué?También en el sector de la hilatura a rotor se va notando cada vez más la exigencia de suministrar partidas de hilado más -reducidas, con plazos de entrega cortos y ciertos.La evolución tecnológica de los componentes de las unidades de hilatura, junto con la facilidad y rapidez de sustitución de éstos, sí han hecho que la hilatura a rotor sea sumamente flexible por lo que respecta a posibilidades y gamas de trabajo, sin embargo las máquinas que hoy están a la venta no están provistas de la misma flexibilidad industrial.Por consiguiente era indispensable, además de garantizar las pres-taciones tecnológicas de calidad y velocidad, alcanzadas con el uso de un nuevo box de primera calidad, sobre todo ofrecer un proceso a rotor “totalmente flexible”.

Consequently FlexiRotorS 3000, besides guaranteeing the highest speed and take-up performances, ensures:• bestproductionplanning• minimised“unproductivetime”• highqualityyarnandpackages

thanksto:• indipendentsides• intelligentpiecinganddoffingtrolleys• “electronic”take-upofthecertifiedpackage.

Flexabilityiswhatweareofferingwithournewrotor spinning frame

De aquí la propuesta de Savio que, además de asegurar las más elevadas prestaciones de velocidad y recogida, garantiza:• lamejorplanificacióndelaproducción• lareduccióndelos“tiemposnoproductivos”• laaltacalidaddelhiladoydelasbobinas

mediantelarealizaciónde:• frentesindependientes• inteligenciadeloscarrosdeempalmeymudada• laformación“electrónica”delabobinacertificada.

Flexabilityesnuestrapropuestamediantelanueva continua de hilar a rotor

4 5

F l e x i R o t o r S 3 0 0 0

Electronicpackagetake-upFormaciónbobinaelectrónica

152 mm 100 mm B

Groovedrolltraverse/Carreraguíahilos

Thread

guidespeed/Velocid

adguíahilos

V1

Thread

guidespeed

Velocidadguíahilos

100 mt 100 mt

A

V2V3

V3V2V1

E.P.B. (Electronic PackageBuilding)

Speed profile within the traverse

Alternating variation of frequency

Perfil de la velocidad de carrera

Variación alternada de la frecuencia

All the parameters listed above can be set on the PC that controls the electronic driving device (Electronic Threadguide Drive) on the control headstock. Via the PC in fact, it is possible to make packages of different sizes, densities and crosswinding angles according to market requirements and the downstream processes. Packages can also be made with a different traverse and centring in relation to the centre line of the tube.

• Crosswindingangle• Threadguideunitdynamics: • threadguidespeedprofile

within the traverse• anti-patterningvariation • variationoftheanti-

patterning frequency • randomvariationofthe

anti-patterning frequency • axialdisplacement • axialdisplacement

frequency • traverseadjustment • variablelengthreserveTodos los parámetros mencio-

nados se pueden programar desde el PC que controla el dis-positivo de accionamiento elec-trónico (Electronic Threadguide Drive) situado en el cabezal de mando. De esta forma se pueden construir desde el PC, bobinas de distinto tamaño, densidad, ángulo de cruce en función de las exigencias del mercado y de los trabajos sucesivos e incluso bobinas con distinta carrera y centrado res-pecto a la mitad del tubo.

• Ángulodecruce• Dinámicadelgrupoguíahilos • perfildelavelocidaddel

guíahilos en el recorrido • variacióndelamodulación • variacióndelafrecuencia

de modulación • variaciónalazardela

frecuencia de modulación • desplazamientoaxial • frecuenciadeldesplaza-

miento axial • regulacióndelacarrera • reservadelongitud

variable

6 7

F l e x i R o t o r S 3 0 0 0

Certifiedelectronicpackagetake-upFormaciónbobinaelectrónicaycertificada

Packageswithamaximumdiameterof320mmincylindricalpackagesweighing6kilograms,thankstothecharacteristicsandE.P.B.(ElectronicPackageBuilding).Higher warping creel allocation and fewer tubes in circulation.This saving can be quantified as about 30% if it refers to the maximum weights obtainable with other machines with the same diameter.

Bobinascondiámetromáximode320mmenconfeccióncilíndricaconpesode6kilo-gramos,graciasalascaracte-rísticasdelE.P.B.(ElectronicPackageBuilding).Mayor asignación obrera para carga de la fileta del urdidor y menor cantidad de tubos en circulación. Estos ahorros se pueden valorar en un 30% si se relacionan con los pesos máximos que se consiguen con otras máquinas de igual diámetro.

FromacylindricaltoataperedpackageDesdelabobinacilíndricahastalabobinacónica

A simple “tapered take-up kit” can be fitted to each winding unit to change the package from cylindrical to conical type.

QuickchangeofthecradlecentresThanks to the particular configuration of the cradle, the cone holders can be changed easily using a simple tool.

Un simple “kit para recogida cónica” se puede incorporar a cada unidad de bobinado, en caso de cambio de bobina cilín-drica a cónica.

Cambiorápidodelascontra-puntasdelbrazoGracias a la particular geome-tría del brazo, se pueden fácil-mente sustituir las contrapuntas de éste usando una sencilla herramienta para el desmontaje y el montaje posterior.

PackagescertifiedforlengthanddensityOnce the package length is reached – set on the PC – the diameter is also checked during doffing. Any packages with diameters smaller or larger than the tolerance range set on the PC are not discharged and the unit goes into the alarm status.

Bobinascertificadaspormetra-jeydensidadAl alcanzar el metraje de la bo-bina, programado desde el PC, en fase de mudada se controla también el diámetro alcanzado. La bobina con diámetro inferior o superior al campo de toleran-cia programado en el PC, no se descarga y la unidad se dispone en fase de alarma.

8 9

F l e x i R o t o r S 3 0 0 0

FlexiblepiecinganddoffingcycleCicloflexibledeempalmeymudada

Control logicThe doffing and piecing trolley is able to control both sides of the machine as follows:• eachtrolleyisstrictlybound

toitsownside;• bothtrolleyscontrolthetwo

sidesseparately(automaticsharingoftheworkload);

• ifonetrolleyisbeingserviced,theotheronecontrolsbothsides.

When going from one front to the other, the trolleys are automatically set with the adjustmentsrequiredbythefront on which they are going to work.

TotallyflexiblepiecinganddoffingcycleShould one of the operations, necessary to complete the cycle fail, same is repeated. This is thanks to the total independency of all the devices which are powered individually by stepping motors.

Monitoring the cycleA set of sensors, mounted on the units, monitor not only the various mechanical phases of their movements or rotation, but also the presence and correct position of the yarn in each phase.Asaresult,mechanicalandtechnologicalsplicingrepetitivenessisguaranteed.

LalógicadelavigilanciaEl carro de empalme y muda-da (Doffing Piecing Trolleys) puede vigilar ambos lados de la máquina según las modalidades siguientes:• cadacarroestrechamentevinculadoasupropiofren-te;

• amboscarrosvigilaninde-pendientementelosdosfrentes(subdivisiónautomá-ticadelacargadetrabajo);

• encasodemantenimientodeuncarroelotrovigilalosdosfrentes.

Al pasar de un frente al otro, los carros automáticamente se ajustan según las regulaciones requeridas por el frente sobre el que están a punto de actuar.

ElciclodeempalmeymudadatotalmenteflexibleEn caso de que falle una de las varias operaciones que concu-rren a la realización del ciclo, se repite únicamente la operación “fallada”, esto gracias a la total independencia de los varios dis-positivos que están motorizados individualmente por motores paso a paso.

ElcontroldelcicloUna serie de sensores monta-dos en los grupos controlan no sólo las varias fases mecánicas de desplazamiento o rotación de los mismos, sino también la presencia y la posición correcta que el hilo debe tomar en cada fase.Porconsiguientesegarantizala repetición mecánica y tecno-lógicadelempalme.

Machineefficiencywith2trolleysEficienciamáquinacon2carros > 240 spinning units/unidades de hilatura > 288 spinning units/unidades de hilatura> 312 spinning units/unidades de hilatura> 360 spinning units/unidades de hilatura

Machineefficiencywith4trolleysEficienciamáquinacon4carros > 240 spinning units/unidades de hilatura > 288 spinning units/unidades de hilatura> 312 spinning units/unidades de hilatura> 360 spinning units/unidades de hilatura

60

50

70

80

90

100

54,543,532,7

60

50

70

80

90

100

54,543,532,7

60

50

70

80

90

100

54,543,532,7

60

50

70

80

90

100

54,543,532,7

Efficiency % / Eficiencia% Efficiency % / Eficiencia%

Packagetake-uptime(hr)Tiempodeformaciónbobina(hr)

Packagetake-uptime(hr)Tiempodeformaciónbobina(hr)

10 11

F l e x i R o t o r S 3 0 0 0

Piecingdynamics/DoffingdynamicsDinámicadeempalme/Dinámicadelamudada

Piecingdynamics-HighefficiencyandpiecingconstancyYarn piecing is done at the constant speed of the rotors.Piecingspeedcanbeadjustedvia the PC and can vary from 60-100% of the normal working speed.After piecing, the trolley wind the yarn into the package until the package reach the winding speed.Throughout the piecing process, the yarn, including the splice, is constantly monitored by the electronic clearer.

Dinámicadeempalme-AltaeficienciayconstanciadelempalmeEl empalme del hilo se realiza a velocidad constante de los rotores.El valor de la velocidad de empalme es regulable desde el PC y puede variar en un 60-100% de la velocidad de trabajo normal.Después del empalme el carro enrolla el hilo en la bobina, esperando que ésta alcance la velocidad de régimen.Durante todo el proceso de empalme, el hilo, incluida la junción, está constantemente controlado por el purgador.

100%

80%

Piecing/Empalme

Rotorspeed/Velocidadrotores

60%

DoffingdynamicsWhile the package is being removed from the cradle, a new tube is sent automatically from the centralised magazine and loaded on the trolley. The auxiliary package, always on the trolley, supplies the yarn for piecing. The splice is eliminated and the yarn is simultaneously placed on the tube for the reserve before being sent to the threadguide. A simple display on the trolley shows the coded piecing and doffing sequence as well as any alarms.

Devicetofacilitatepackagedischarge

Dinámica de la mudadaMientras se retira la bobina del brazo, un nuevo tubo es enviado automáticamente, desde el depósito central de conos, y cargado en el carro. La bobina auxiliar, siempre presente a bor-do del carro, proporciona el hilo para el empalme. La unión es eliminada y al mismo tiempo el hilo se dispone en el tubo para la formación de la reserva, antes de ser entregado al guíahilos. Un sencillo display en el carro identifica las secuencias codifi-cadas de empalme y mudada y las alarmas eventuales.

Dispositivofacilitadodedes-cargadelasbobinas

12 13

F l e x i R o t o r S 3 0 0 0

Ne = 6 - Efficiency = 93% / Ne6Eficiencia=93%

Ne=18-Efficiency=95,5%/Ne18Eficiencia=95,5%

Ne = 6 - Efficiency = 82% / Ne6Eficiencia=82%

Ne=18-Efficiency=96,5%/Ne18Eficiencia=96,5%

180u.f.

132u.f. 180u.f.

180u.f.

180u.f.

1u.f.

1u.f

1u.f

1u.f.

360336312288264240216192

Ne 18

Ne 680

90

100

Productivity%/Rendimiento%

Spinning units / Unidad de hilatura

IndependentsidesFrentesindependientes

The two separate sides ensure maximum flexibility because it is possible to work with two different materials, counts, twists, drafts, rotor speeds, combing roller speeds, densities, diameters, etc.

Optimum planning of system productionThe different ongoing productions can be divided for a single front instead of for a single machine and, as a result, responding quickly to requirements of yarn lots with short delivery terms.

Thefactthatthetwofrontsareindependenttogetherwiththeabilityofthetwotrolleysto simultaneously control one machine front, leads to a more efficient:• lotchange,• machinefrontmaintenace.

Los dos frentes independientes garantizan la máxima flexibilidad, porque permiten elaborar dos distintos materiales, títulos torsio-nes, estirajes, velocidad rotores, velocidad cardas, densidad, diá-metros, etc.

Óptimaplanificacióndelapro-duccióndelainstalaciónLas distintas producciones en trabajo se pueden subdividir para cada frente, en lugar que para cada máquina, para satis-facer rápidamente las exigencias de partidas de hilado con plazos de entrega más cortos.

Laindependenciadelosdosfrentes,juntoconlacapacidaddevigilanciadelosdoscarros al mismo tiempo en un solo frente de la máquina, conlleva el aumento de la eficiencia para:• cambiosdepartida,• findepartida,• mantenimientofrentedelamáquina.

Startingthefront,lotchange, maintenanceArranquefrente,cambiode partida,mantenimientoA 1 trolley per front 1 carro para cada frenteB 2 trolleys per front 2 carros para cada frente C Increased production Aumento de la producción

50%

kg

Startingtime(hr)/Tiempodearranque(hr)

50%

kg

Startingtime(hr)/Tiempodearranque(hr)

100%

75% Efficiency / 75%Eficiencia

T T/2 T

kg

T/2 T

Startingtime(hr)/Tiempodearranque(hr)

CBA

Packagesofdifferentcolourscan be processed on the same front without any possibility of contamination thanks to the large waste collecting channel, strategically positioned under the spinning box. A set of mobile brushes with reciprocating motion discharge the waste into a suction unit.

In addition, thanks to the way in which the two trolleys control the sides, one of the trolleys can be assigned a number of units from the other front to increase capacity.

Lasbobinasdedistintoscolores se pueden trabajar en el mismo frente sin contaminación, gracias al amplio canal de recogida de los desperdicios, oportunamente situado debajo de la unidad de hilatura. Una serie de cepillos móviles que con movimiento alternado descargan los desper-dicios en el específico sistema de aspiración.

Además, gracias a las modali-dades de vigilancia de los dos carros, es posible asignar a uno de los dos, un número de unida-des del otro frente para aumen-tar su rendimiento.

14 15

F l e x i R o t o r S 3 0 0 0

ControlheadstockCabezaldemando

All spinning process parameters are set via the PC for each machine front:• Rotorspeed• Combingrollerspeed• Draft• Twist• Windingtension• Crosswindingangle• Antiribboning• Axialdisplacement• E.P.B.(electronicpackage

take-up)• Suction• D.P.T.Piecing/doffing

trolleysSetting is also possible when the machine is working.A “safety” software guarantees monitoring and constancy of the work parameters as well as the ratios between them.As a result all machine settings are maintained even in case of a temporary power cut and/or if the machine is switched off.

Mediante el PC se programan, para cada frente de la máquina, todos los parámetros del proce-so de hilatura:• Velocidadrotores• Velocidadcardas• Estiraje• Torsión• Tensióndeenrollado• Ángulodecruce• Modulación• Desplazamientoaxial• E.P.B.(formaciónelectróni-cabobina)

• Aspiración• D.P.T.Carrosdeempalme/

mudadaEl ajuste se puede efectuar incluso con la máquina en trabajo. Un software de “segu-ridad” garantiza el monitoreo y la constancia de los parámetros de trabajo y de las razones rela-tivas entre los mismos.Por tanto todas las programa-ciones de la máquina se con-servan aunque se produzca un corte temporal de fluido eléctri-co y/o se apague la máquina.

The package cradle counterweight and damping arepneumaticallyadjustablewith separate systems, but centralised in the headstock of each machine side.Henceminimaloperatorinterventionisrequired.

PalmComputerRadio-communicationandmachine parameter setting system.A portable palmtop PC interacts via radio with the whole electronic system of the machine so the person in charge can remotely monitor machine performance and set all data as if he were in front of the main PC. This palmtop PC can work on all machines in the room.

El contrapeso y embrague del brazo portabobinas son neumá-ticamente ajustables con siste-mas separados pero centrales en el cabezal de cada frente de la máquina.Laactuacióndeloperador,portanto,seminimiza.

PalmComputerSistemaderadio-comunicaciónyprogramaciónparámetrosdelamáquina.Un PC “palmar” y portátil inte-ractúa por radio con el entero sistema electrónico de la máqui-na y hace que el contramaestre pueda controlar las prestaciones de la máquina a distancia y programar todos los datos igual que si estuviera delante del PC principal.Este PC Palmar puede actuar sobre todas las máquinas de la sala.

16 17

F l e x i R o t o r S 3 0 0 0

18 19

F l e x i R o t o r S 3 0 0 0

Spinning unitUnidad de hilatura

The consistancy of yarn quality is, first of all, the result of the spinning unit’s drive mechanism box is configurated and its position in relation to the machine body’s control devices; in fact, the spinning frame body has been built with:

• acompactandall-in-onebody;

• interfaceconstancywiththesliverfeedshaft;

• all-in-onefibreconveyorchannel.

La constancia de la calidad del hilado nace antes de todo del sistema de realización de la caja de la unidad de hilatura, y de su posición respecto a los dispositivos de mando del cuer-po máquina; de hecho la caja de hilatura está realizada con:

• cuerpocompactoyúnico;• constanciadeinterfacecon

elárboldealimentacióncinta;

• canaldetransportefibrasenunaúnicapieza.

El soporte de las fibras, com-pletamente integrado en el alo-jamiento de la carda, garantiza una acción de paralelización constante y eficaz y por con-siguiente una calidad del hilo constante.

El árbol de alimentación de la cinta está siempre engranado en el árbol principal, también durante la fase de apertura unidades para el empalme o mantenimiento. Así que se eli-minan los saltos eventuales que producen fallas en el hilo.

The fibre support, incorporated inside the combing roller seat, guarantees a continuous and effective paralleling action which provides constant yarn quality.

The sliver feed shaft is always meshed with the main shaft even when the unit is opened at piecing time and during maintenance. This means there arenojerkymovementswhichwould cause yarn defects.

20 21

F l e x i R o t o r S 3 0 0 0

SpinningboxUnidad de hilatura

The SC-S spinning box features all the latest developments in the high speed rotor spinning field.Thanks to the wide choice of components it is possible to reach maximum results with all fibres.No tools are needed to work on the spinning box and each component can be changed easily by hand.

La unidad de hilatura SC-S incorpora la entera gama de los últimos avances en el sector de la hilatura a rotor de alta velocidad.La amplia selección de componentes permite que se alcancen los máximos resultados con cualquier fibra.Ninguna necesidad de herramientas para intervenciones sobre las unidades de hilatura, cualquier componente se puede sustituir fácil y manualmente.

22 23

F l e x i R o t o r S 3 0 0 0

SC-S:aconsolidatedrotorspinningtechnologySC-S:unaconsolidadatecnologíadehilaturaarotor

SpecialspinningboxforManMadeFibreswithSPEED-PASSAs synthetic and man made fibres are bulkier than cotton, it was necessary to modify the combing roller compartment to allow for a better separation of the fibres going from the combing roller to the conveyor channel.SPEED-PASS helps increase the volume of air needed at the entrance to the conveyor channel in order to remove all the fibres from the combing roller and straighten them completely during their acceleration in the rotor.This is why by using SPEED-PASS you will also benefit in processing cotton and cotton blends with coarse counts.

UnidaddehilaturaespecialparaManMadeFibersconSPEED-PASSPor tener las fibras sintéticas y artificiales una voluminosidad mayor que el algodón, se ha vuelto necesario modificar el alojamiento de la carda, para consentir la mejor separación de las fibras desde la carda hasta el canal de transporte. El SPEED-PASS contribuye a aumentar el volumen de aire requerido a la entrada del canal de transporte, para eliminar todas las fibras de la carda y rectificarlas completamente durante la aceleración de éstas en el rotor.Por esta razón el uso del SPEED-PASS es provechoso también para la elaboración de algodón y mezclas de algodón con títulos gruesos.

The all-in-one fibre conveyor channel ensures there is no undesired air turbulence and hence a perfect control of the fibres that are accelerated in the rotor groove.

SlivercleaningandBy-PassAccording to the impurities of the sliver, the by-pass makes it possible to optimise the balance of the technological air required for spinning as well as the air needed to separate the scraps in counter stream.

El canal de transporte fibras realizado en una única pieza asegura la ausencia de turbu-lencias de aire indeseables, y por tanto el control perfecto de las fibras que se aceleran en la garganta del rotor.

LimpiezaCintayBy-PassEl by-pass consiente optimizar, en función de las impurezas de la cinta trabajada, el equilibrado del aire tecnológico necesario para la hilatura, y la separación en contracorriente de los des-perdicios a descartar.

24 25

F l e x i R o t o r S 3 0 0 0

ThelatestTwindiscgenerationTwindiscdeúltimageneración

NewTwindiscThe new Twin disc has been optimised to reduce energy consumption • Discswithabigger

diameter• Tangentialbeltwitha

reducedsection• ShorterrotorshaftA new “lubricating cartridge” ensures:• preciseaxialpositioningof

the rotor• nolubricatingdirt• acartridgethatiseasyto

serviceandreplace

NuevoTwindiscEl nuevo Twin disc está optimi-zado para reducir el consumo energético • Discosdemayordiámetro• Correatangencialdesec-ciónreducida

• Longitudreducidadelejerotor

Un nuevo “cartucho de lubrica-ción” garantiza:• precisoposicionamiento

axial del rotor• ausenciadesuciedaddelubricación

• fácilmantenimientoysusti-tucióndelcartucho

26 27

F l e x i R o t o r S 3 0 0 0

Yarn pathRecorrido del hilo

Clearers(optional)Capacitive and/or optical clearer systems can be applied to eliminate defects on yarns, including foreign fibres.

Purgadores(opcionales)Posibilidad de aplicar siste-mas de purga capacitivos y/u ópticos para eliminar las fallas del hilado, y también las fibras extrañas.

Electronic Yarn FeelerMaximum functionality even with the finest counts or when soft packages are made. High sensitivity and rapid intervention.

Waxingunit(optional)Characterised by a single drive control, rotation stops if the yarn breaks, no dispersion or dropping of wax. Even consumption, easy to replace, wide range of settings for the quantity of wax.

PalpadordelhiloelectrónicoMáxima funcionalidad también con los títulos más finos o para la confección de bobinas sua-ves. Alta sensibilidad y rápida intervención.

Parafinador(opcional)Se caracteriza por el mando con motorización individual, paro de la rotación al romperse el hilo, ausencia de disper-siones y caída de parafina. Consumo regular, fácil sustitu-ción, amplia regulación de la parafina.

IndividualPCmonitoringEach spinning unit is equipped with an alarm monitoring system. The operator is informed in real time of any alarm that has been detected.

IndividualPCmonitoringCada unidad de hilatura está equipada con un sistema de monitoreo de las alarmas. El operador se entera en tiempo real de la alarma presente.

28 29

F l e x i R o t o r S 3 0 0 0

2200

4000

450

0

3000

4410

85 12551650 1250 366

3342 890

3124

(*)

2924

(*)

2064

(*)

1988

(*)

1274

(*)

1500

3398

1850

1512

1122

1050

1311

1048

1488

2988

860

3135

(*)

4598

750

1220

(*)

2582

1896 (B)

1692 (B)

466 (A)690 (A)

1978 (B)

5000

2870 (

*)

282028202820

Suction systemSistemadeaspiración

The main inverter controlled suction unit creates the vacuum and volume of technological air for the spinning boxes and piecing and doffing trolleys.

The technological air channels of the boxes and trolleys are separate and independent so that waste is collected in the relative filters.

TimedfiltercleaningisadjustableonthePCandcanbedonewhile the machine is working thanks to a by-pass system started by its own pushbutton.

The PC also modifies the pneumatic working parameters of the main suction unit, on a timed basis, according to the waste from the boxes, to guarantee suction constancy during spinning.

Un aspirador principal, controlado por inverter, se hace cargo de crear la depresión y el volumen de aire tecnológico para las unida-des de hilatura y para los carros de empalme y mudada.

Las canalizaciones del aire tecnológico de las unidades y de los carros están separadas y son independientes y los desperdicios de cada una se recogen en los filtros correspondientes.

La limpieza temporizada de los filtros es regulable desde el PC y se puede efectuar mientras la máquina está trabajando gracias a un sistema de by-pass que se acciona con el botón correspondiente.

Además el PC modifica los parámetros neumáticos de trabajo del aspirador principal, en modo temporizado, en función de los desperdicios de las unidades, a fin de garantizar la constancia de succión durante la hilatura.

DimensionsandinstallationlayoutDimensionesmáximasyesquemasdeinstalación

Machineinstallation-MinimumdimensionsinmmInstalaciónmáquinas-Medidasmínimasenmm

Spinning Machine units length Unidad Longitud de de hilatura la máquina N. mm 48 12134 72 14954 96 17774 120 20594 144 23414 168 26234 192 29054 216 31874 240 34694 264 37514 288 40334 312 43154 336 46264 360 49084

MACHINELENGTHLARGOMAQUINA

18” pots - Botes de 18”

Air from the trolleysAiredesdeloscarros

Spinning unit airAireunidadesdehilatura

Suction unitAspirador

Air from the trolleysAiredesdeloscarros

Spinning unit airAireunidadesdehilatura

Suction unitAspirador

With 46” and 48” cans, the measures (*) increase of 100 mm.(A) with 336 - 360 S.U.: + 150 mm.(B) with 336 - 360 S.U.: + 290 mm.

Con botes de 46” y 48” las medidas (*) aumentan de 100 mm.(A) con 336 - 360 husos: + 150 mm.(B) con 336 - 360 husos: + 290 mm.

30 31

F l e x i R o t o r S 3 0 0 0

Technical summarySíntesistécnica

Rotor spinning frame with two independent sides featuring automatic distribution of the empty tubes and an automatic system for piecing, package doffing and rotor cleaning.24-unit modules on 2 fronts.Maximum number of units per machine: 360Gauge: 230 mmTechnologicaldataProcessable materials: cotton, man-made and synthetic fibres, blends, technical fibres (Kevlar, Nomex).Maximum fibre length: 60 mm.Sliver count: Ne 0.08 – 0.27 (6000–2200 Tex)Yarn count: Ne 4 – Ne 60Feeding pots: max. height: 42” (1066 mm) with possibility of raised machine to reach a clearance of up to 1270 mm for 46” and 48’’ high pots 16” and 17.5” diameters (on two rows)18” and 20” diameters on three rowsDraft range: 16 ÷ 400Twist rate: 115 ÷ 1500 T/mWinding tension ratio: 0.9 ÷ 1.1Spinning unitRotors: diameter: 28-30-31-33-34-36-37-40-41-46-47-48-56-57 mm speed: 35.000 ÷ 150.000 r.p.m.Combing rollers: sawtooth; diameter: 75 mm; speed from 7.000 to 10.000 r.p.m.Navels: in ceramic, with and without notchesTwist-trap: smooth surface or insert with 3 twist-retaining bars Sliver cleaning: highly efficient thanks to the centrifugal and gravity effectTransporting impurities: with Sweep CatWindingunitDimensions of standard take-up tubes:cylindrical: Ø 54 x 170 mm Ø 54/43 x 170 mm with inverted tiptapered: 3°51’ also with inverted tip 4°20’ also with inverted tipDimensions of special take-up tubes:on tapered machine: Ø 79/69x170 mm Ø 68/55x170 mmcylindrical type: Ø 41.28x170 mm Ø 54x170 mm Ø 69x170 mm Ø 75 / 69x170 mmon cylindrical machine: tapered 1°51’ also with inverted tipPackage dimensions: cylindrical Ø 320 mm tapered Ø 280 mmGrooved roll traverse: 100÷158 mm settable on the PC

Package densities: cylindrical: 0.5 – 0.32 kg/dm3 tapered: 0.45 – 0.36 kg/dm3

Crosswinding angles: variable from14°÷20° settable on the PC, steps 0,1°Take-up speed up to 250 m/min.Electronically controlled anti-patterning systemAxial displacement command up to 6 mm settable on the PC for an even package edge densityPneumatic counterweight system and package damping with mechanical vibration damper. Centralised control.Mechanical tapered package compensatorElectronic yarn length measuring deviceElectronic yarn feeler: it stops feeding of the sliver in case of yarn breakageAutomatedsystemPossibility of using 2 trolleys on the same frontTrolley translation speed: 25 m/min.Rotor cleaningProgrammable preventive rotor cleaningCycle time: doffing: 27 seconds; piecing: 22 secondsProgrammable doffing at set lengthsAutomatic tube feed device with a capacity of 150 tubes per frontTubes without prewound yarn Elimination of yarn splice before the beginning of the new packagePackage unloading on two completely independent beltsFeed sliver detection systemAnti-marriage sliver safety deviceDiagnostics during trolley cycle phasesAdjustmentofpiecingparameterswhengoingfromonefronttotheotherSelection of the number of piecing attempts for start up and normal operationHeadstokComputerised system for setting, checking and viewing all spinning and winding parameters.Programmer for the number of packages unloadedMachine generated air and sliver cleaning air can be discharged through underground or overhead ductsMotors cooled by air taken from outside the headstockFire warning system with automatic isolation of the vacuum ductsAutomatic powering system of the electrical axes in the case of power cuts (up to 3 seconds)OptionaldevicesIndividually controlled waxing unitClearers: USTER QUANTUM (either optical or capacity with FF) LOEPFE 3N1 (optical) with FF+POLYPROPYLENEAuxiliary trolleyInstallation of 3 or 4 trolleys

Continua de hilar de rotor de dos frentes completamente independientes provista de distribución automática de los tubos vacíos y de automatiza-ción para el empalme del hilo, la mudada de la bobina y la limpieza de los rotoresMódulos de 24 unidades en 2 frentesCantidad máxima de unidades por máquina: 360Ecartamiento: 230 mmDatostecnológicosMateriales elaborables: algodón, fibras artificiales y sintéticas, mezclas, fibras técnicas (Kevlar, Nomex)Longitud de la fibra de hasta 60 mm.Título de la cinta: Ne 0.08 - 0.27 (6000-2200 Tex)Título del hilado: Ne 4 - Ne 60Botes de alimentación alto máx. 42” (1066 mm) con posibilidad de so-breelevar la máquina para espacio libre de hasta 1270 mm para botes de 46” y 48’’ de altodiám. 16” y 17,5” dispuestos en dos filasdiám. 18” y 20” dispuestos en tres filasCampo de estiraje: 16 ÷ 400Campo de torsiones: 115 ÷ 1500 T/mRelación tensión de encanillado: 0,9 ÷ 1,1Unidad de hilaturaRotores: diámetro: 28-30-31-33-34-36-37-40-41-46-47-48-56-57 mm velocidad: 35.000 ÷ 150.000 r.p.m.Cardas: de dientes de sierra; diámetro: 75 mm; velocidad de 7.000 a 10.000 r.p.m.Embudos: de cerámica, con y sin ranurasTwist-trap: liso o con barritas de 3 tiposLimpieza de la cinta: de alta eficiencia por efecto centrífugo y gravedadTransporte impurezas: mediante Sweep CatUnidaddebobinadoDimensiones de los tubos de recogida estándares:cilíndrico: Ø 54 x 170 mm Ø 54/43 x 170 mm punta rebordeadacónico: 3°51’ también con punta rebordeada 4°20’ también con punta rebordeadaDimensiones de los tubos de recogida especiales:en la máquina de tipo cónico: Ø 79/69x170 mm Ø 68/55x170 mmtipo cilíndrico: Ø 41.28x170 mm Ø 54x170 mm Ø 69x170 mm Ø 75 / 69x170 mmen la máquina cilíndrica: cónico 1°51’ también punta rebordeada.Dimensiones confecciones: cilíndricas Ø 320 mm cónicas Ø 280 mmCarrera guíahilos: 100÷158 mm programable desde PCDensidad de las bobinas: cilíndricas: 0.5 – 0.32 kg/dm3 cónicas: 0.45 – 0.36 kg/dm3

Ángulodecruce:variablede14°÷20°programabledesdePC,paso0,1°Velocidad de recogida de hasta 250 m/min.Dispositivo anti-cordón con gestión electrónicaControl desplazamiento axial hasta 6 mm programable desde PC para uniformar la densidad del borde de la bobinaContrapeso neumático y embrague bobina con amortiguador mecánico de las vibraciones. Mando centralCompensador mecánico para bobinas cónicasMedidor electrónico de la longitud del hiladoPalpador electrónico del hilo: corta la alimentación de la cinta al romperse el hiladoAutomatizaciónPosibilidad de utilizar 2 carros en el mismo frenteVelocidad de traslado del carro de automatismos: 25 m/min.Limpieza del rotorLimpieza preventiva del rotor a intervalos programablesTiempo del ciclo: mudada: 27 segundos; empalme: 22 segundosMudada con metraje programableDispositivo de alimentación automática de los tubos con capacidad de 150 para cada frenteTubos sin hilado previamente enrollado Eliminación del empalme del hilado antes del inicio de la nueva confección de bobinaDescarga de las bobinas en dos cintas totalmente independientesControl de la presencia de la cinta de alimentaciónDispositivo de seguridad anti-marriage cintaDiagnóstico de las fases del ciclo del carro de automatizaciónReajuste de los parámetros de empalme al pasar de uno a otro frenteSelección del número de tentativas de empalme para las fases de arranque y régimenCabezaldelamáquinaSistema computerizado para la programación, el control y la visualización de todos los parámetros de hilatura y bobinado.Programador del número de bobinas descargadas.Evacuación del aire tecnológico y para la limpieza de la cinta en túnel subterráneo o tubería aéreaRefrigeración de los motores mediante aspiración de aire desde el exterior del cabezalDispositivo indicador antincendio con bloqueo automático de la conexión con el conducto de aspiración del aireSistema de autoalimentación de los ejes eléctricos a falta de fluido eléctrico (hasta 3 segundos)DispositivosopcionalesParafinador controlado individualmentePurgadores: USTER QUANTUM (ópticos o capacitivos con FF) LOEPFE 3N1 (óptico) con FF+POLYPROPYLENOSegundo carro de automatizaciónAplicación de 3 o 4 carros de automatización

32

F l e x i R o t o r S 3 0 0 0

SAVIOMACCHINETESSILIS.P.A.33170 PORDENONE (Italy)Via Udine, 105Tel. +39 0434 3971Fax +39 0434 397599E-mail: order@saviospa.itwww.saviospa.it

SAVIOINDIALTD.Nallattipalayam, Tamaraikulam - PostPollachi, Coimbatore - 642109Tamil Nadu, IndiaTel. +91 4259 304555Fax +91 4259304567E-mail: mail@savioindia.inwww.savioindia.in

SAVIO(SHANDONG)TEXTILEMACHINERYCO.,LTD.No.6 Torch Industry Park, No. 2166 Chongwen Dadao,High&New Tech IndustryDevelopment Zone, Jining,Shandong, P.R. China 272000Tel. +86 0537 2395206/101Fax +86 0537 2395216 E-mail: info@saviochina.com

Savi

o Ad

verti

sing

Dpt

. - F

oto:

Ric

card

o M

aria

Mor

etti

- PN

- Ed

izio

ne 0

3/20

12 -

ingl

ese-

spag

nolo

FlexiRotorS 3000

We reserve the right to modify the characteristics of the machines described herein without prior notice. The data given in this brochure are not intended as a guarantee. Savio machines are equipped with safety devices in compliance with existing regulations.Nos reservamos el derecho de modificar las características de las máquinas detalladas sin previo aviso. Los datos reseñados en este folleto no constituyen garantía. Las máquinas de Savio están equipas con dispositivos de seguridad conforme a las leyes vigentes.