dairy forum booklet 2015
DESCRIPTION
Heart of America Dairy Expo 2015 - Missouri Holstein Convention, Springfield, MOTRANSCRIPT
Presented by Hiland Dairy Foods
PAGE 1
PAGE 2
2015 Heart of America Dairy ExpoThursday, January 22, 201510:30 a Missouri Dairy Growth Council (MDGC) Annual MeetingandBoardMeeting (Bora Bora Boardroom)1:00p.m. TradeShowSetupthrough5:30 (Grand Ballroom)4:00 MissouriStateMilkBoardmeeting (Bora Bora Boardroom6:00 GrandOpeningTradeShowReception7:30 Early Bird Seminar: “Dealing with the 2015 Dairy Downturn, Ryan Yonkmon, DairyRisk Manager,RiceDairy,Chicago (Grand Ballroom)
Friday, January 23, 20158:00a.m. Registrationopen(Grand Ballroom Lobby)8:00 TradeShowOpens,Coffee,Milk&Pastries, sponsored by Kraft Springfield, Southwest Dairy Farmers and Waikato Milking Systems (Grand Ballroom) 9:25 ExpoWelcome-Larry Purdom,MissouriDairy Association(MDA)President (Grand Ballroom)9:30 “Stop,LookandListen-MorethanJustGetting the Chores Done”-Tom Lorenzen, sponsored by Alltech10:10 “2=5.TreatingMastitisEffectivelywithFewer AntibioticDoses” Dr. Brent Cousin,DVM,DACT, ProfessionalServicesVeterinarianfortheEast Centralregion, sponsored by Boehringer-Ingelheim10:50 Break, sponsored by Missouri Trucking Association and Southwest Dairy Farmers 11:20 “HowtoReduceCostlyCalfhoodDiseasethrough Immune Support”,Dr. Dan Tracy,DVMMS, TechnicalServicesVeterinarian, sponsored by MultiminNoon PorkChopLuncheonsponsored by Hiland Dairy Foods Company, Missouri Pork Association & Missouri Soybeans, Quality Liquid Feeds and S&L Sales, LLC Keynote Speaker: “FutureofAmerican Agriculture:PotentialandPressure”, Andy Vance sponsored by Central Life Sciences (Coco & Maui)1:30 p.m. “EvaluatingyourRiskManagementOptions”, Farmer Panel, Moderator Joe Horner, University ofMissouri,Panelists:EricHoffman,Trenton; NathanRoth,MountainGrove;BernieVandalfsen, Reeds;andAnitaRokey,Sabetha,KSsponsored by Missouri Soybeans - brought to you by your soybean checkoff (Grand Ballroom)2:10 . “APathForward-ThePotentialofDairy’s FutureintheMidwest””, Joe Horner and Ron Grusenmeier, sponsored by Midwest Dairy Association 2:50 President’sIceCreamSocialandVisitwith Exhibitorssponsored by F&H Food Equipment
Company, Southwest Dairy Farmers and Turner’s Special Supply (Grand Ballroom)3:00 Sho-MoDairyHeiferGrowersAssociationAnnual Meeting(Bora Bora Boardroom)3:15 MissouriDairyAssociation30thAnnualMeeting withPolicyDevelopmentSession (Grand Ballroom4:30 MDA30thAnnualMeetingAdjourns4:30 MissouriHolsteinAssociationCommittee Meetings(Coco &Maui)5:00 MissouriGuernseyBreedersAssociation(MGBA) CommitteeMeetings(Sahara)6:30 MissouriHolsteinAssociationdinner, sponsored by Select Sires Mid-America (Grand Ballroom)7:00 MissouriHolsteinAssociation2014Cowofthe Year,All-Missouri&Jr.All-MissouriPresentations7:00 MGBABoardMeeting(Sahara)7:30 MissouriStateHolsteinConventionSale (Grand Ballroom)
Saturday, January 24, 20157:00a.m. Registration/Check-in,TradeShowOpen, (Grand Ballroom) Coffee,Milk&Pastriessponsored by FCS Financial, S&L Sales & Southwest Dairy Farmers8:30 MissouriHolsteinAssociationBoardMeeting (Bora Bora Boardroom)9:00 MissouriJuniorGuernseyBreedersMeeting (MGBAAnnualMeetingimmediatelyfollowing) (Sahara B)
9:00 MissouriHolsteinPrincess/LittleMissInterviews (Sonoran)10:00 MissouriBrownSwissAssociationAnnualMeeting (Fiji Ballroom)10:00 MissouriHolsteinAssociationAnnualMeeting (Grand Ballroom)10:00 MissouriJuniorHolsteinAssociationAnnual Meeting(Sahara A)10:00 MissouriJerseyCattleClubAnnualMeeting (Mojave)10:30 MidwestMilkingShorthornAnnualMeeting (Arabian)Noon TradeShowcloses Luncheon MissouriHolsteinAssociationJuniorAwards, Scholarship&CrowningofHolsteinPrincessand LittleMiss,sponsored by Association of Missouri Electric Cooperatives and the Missouri Corn Merchandising Council (Coco & Maui)1:00 p.m. MissouriHolsteinAnnualMeetingReconvene (if necessary, room TBA)1:00 MissouriAyrshireAssociationMeeting (Fiji Ballroom)
Ramada Oasis Hotel & Convention Center, Springfield, Missouri
Andy Vance communicatestoday’sissuesintheagriculture and food retail industries throughpowerful storytelling. A compelling speakerand expert commentator, Andy shows howto navigate the often distinct perspectives offarmers and consumers. He has presents todozensoffeedandlivestockgroupsannuallyandbeencalledupontomoderatediscussionpanels
forTheAnimalAgricultureAlliance, theNationalAssociationofFarmBroadcastingandothers.AndybeganhiscareerinjournalismatABNRadioinColumbus,Ohio, andenjoyed several years as FarmDirector atWRFD-AMpriortojoiningFeedstuffsasthepublication’sfirst-everbroadcasteditor. An award-winning broadcaster, Andy has earned theHorizonAwardfromtheNationalAssociationofFarmBroadcastingand,withhisteamatABN,earnedmultiplenewscastandnewsserviceawards.Duringhistimebehindthemicrophone,healsobecameanotedauthorityonnewandsocialmediainagriculture
Joe Horner worksas adairyandbeefeconomistfor the Commercial Agriculture Program at theUniversity ofMissouri. In his position he assistsproducers in analyzing farm finances, createsinformal adult educational opportunities forproducersandassists inprojects that strengthenMissouri’s dairy and beef industry. A SouthwestMissourinative,Hornerhasworkedforextensionfor 26 years. He spent the first 12 years of
his extension career as a regional extension dairy and farmmanagement specialist in southeastMissouri beforemoving tohiscurrentstatewideassignmentin2000.
Ron Grusenmeyer grew up on a dairy farm insouthwestOhio.Heholdsabachelor’sdegreeindairysciencefromtheOhioStateUniversityandhasspenthisentirecareerinagriculture.RonistheRegionalDirectorofIndustryRelationswithMidwestDairyAssociation.InthisroleRonworkswith dairy farmers, dairy farmer leaders,
dairy industryrepresentativesandotherkeydairyorganizationstoenhancethesupportandunderstandingofthedairypromotionprogram.Hecollaboratewithindustrycontactstobuildconsumerconfidence in dairy producers and the industry as it relates tosustainability,theenvironment,animalcareandfoodsafety.Previously,RonwastheDirectorofMemberRelationsforDairyFarmersofAmericawherehewasresponsiblefortheirnationalyoungleaderdevelopment,theorganization’spolicydevelopmentprocess, and initiatedanddirected an international agriculturalexchangeprogramforyoungdairyfarmers
Ryan Yonkman grewupandworkedonamidsizedairyfarminnorthernMichiganinanareawhere dairy and agriculture are the premierindustries.HeinternedforRiceDairyandplayedamajorroleinthedevelopmentofthemargincalculator thatRiceDairyuses todetermineadairy’sbreakevencost,allowingthemtoprojectup to 2 years ahead and therefore effectively
hedge their inputs and outputs. He also took on several otherprojectsconsistingofbuildinginformativedairyspreadsheets.Heopenedahedgeaccount forhisMichigandairy farm (YonkmanDairy)backhomeandhasmanagedthefarm’shedgessincethen.RyanjoinedtheRiceDairyteaminJuneof2011withjobtitleofAnalyst.Inthisrole,oneofRyan’smaingoalsistoworkwithRiceDairy staff to serve dairymen clients, and continue developingproductsandservicestohelptheirhedgingneeds.
Tom Lorenzen hasspentadistinguishedcareerserving the dairy industry, looking for non-nutritional bottlenecks that affect quality milkproduction and performance. He focuses onthree areas: dairy audits, education throughmilking technician schools, and educationthroughmilkqualitypresentations to thedairyindustry. Tom developed an Udder Health and
Sanitation program for a major milking equipment company.HehaspresentedtotechnicalandproduceraudiencesatAfrigaTechnical Milk Production Conference at the University of VetSchoolinLugo,Spain,WorldDairyExpoinChina,CigalDairyShowinMexico,Wisconsin Fieldman Conference inWisconsin, DairyConferenceinJerusalem,Israel,andtheNationalMastitisCouncilMeetingintheUS.
Brent Cousin, DVM, DACT, joined BoehringerIngelheimVetmedica,Inc.inthespringof2013.Dr. Cousin currently serves as the ProfessionalServicesVeterinarianfortheEastCentralregion,andhasspecializedadvancedtraininginanimalreproductionandisexperiencedinmilkquality
Dr. Dan Tracy isa2001graduateofMississippiStateUniversityCollegeofVeterinaryMedicinewhere he earned a doctorate of veterinarymedicineaswellasamastersindairyproductionmedicine.Aftergraduation,Dr.Tracyworkedasa large animal practitioner specializing in dairyproduction medicine and nutrition. Duringhiscareerhehashadtheopportunity toserve
smallandlargedairiesinVA,TX,KY,andTN.Currentlyheresidesin Kentucky with his family and works as a technical serviceveterinaryforMultiminUSA.
Heart of America Dairy Expo Speakers
PAGE 3
2015 Heart of America Dairy Expo Sponsors
Gold Level Sponsors
PAGE 4
S&L Sales, LLC
brought to you by your soybean checkoff
Silver Level Sponsors
Bronze Level Sponsors
Platinum Level Sponsor
AssociationofMissouriElectricCooperatives—SaturdayluncheonFCSFinancial—Saturdaymorningrefreshments&ProgramPrinting
F&HFoodEquipmentCompany—FridayafternoonbreakGravesInsuranceGroup,LLC-FriendsoftheDairyFarmer
Industrial&EnvironmentalConcepts,Inc-Mailing&PrintingKraftSpringfield—Fridaymorningbreak
MissouriAgribusinessAssociation—FriendsoftheDairyFarmerMissouriCornGrowersAssociation--SignageandSaturdayluncheon
MissouriTruckingAssociation-FridaymorningbreakOrganicValley/CROPPCooperative—Programprinting
QualityLiquidFeeds—FridayluncheonSouthwestDairyFarmers—milkforbreaks
Turner’sSpecialSupply—FridayafternoonbreakWaikatoMilkingSystems—Fridaymorningbreak,Programprinting
WestCentral/SoyPlus/SoyChlor-FriendsoftheDairyFarmer
ABSGlobalAltaSeeds
BayerAnimalHealthBobcatofSpringfield
Boehringer-Ingelheim(doublebooth)BrownfieldNetwork
CentralLifeSciences(doublebooth)EagleBankandTrust
ECOSYLFASTRACK(OwnersBelinda&DavidSchapeler)
FloryDairyEquipment/DeLavalHilandDairyFoodsCompany(doublebooth)
HotsyEquipmentCompanyHustlerEquipment
I.D.ologyJerdenDairyCompany
Jim’sMotorsInc.LewisHybrids/CoverCropSolutions
MASBDAMFAInc.
MidwestDairyAssociationMidwestMilkProductsMillerFeedService
MissouriBeefCattleIndustryMissouriDairyAssociation-DairyHallofHonors
PAGE 5
2015 Heart of America Dairy Expo ExhibitorsMissouri Dairy Growth Council
MissouriDepartmentofAgricultureMissouriDepartmentofConservation
MissouriSoybeansMQTLabServices
MUExtension&CAFNRCommercialAgricultureMultiminUSAInc.(doublebooth)
NutriadOrganicValley/CROPPCooperative
OzarkShavingsPaulMuellerCompanyQualityLiquidFeedsRSICalfSystems
SelectSiresMidAmericaS&HFarmSupply
S&LSalesSoyBest
The Case CompanyTheSmartBlock-MartinVanBeek
USDA-FSAUSDA-MissouriAgStatisticsService
USDARuralDevelopmentVigortone
WachaAlfalfaFarms,LLCZTags
Additional Dairy Expo Sponsorships
PAGE 6
2014-2015 Board of DirectorsGene Wiseman (Chairman)MissouriStateMilkBoard1616MissouriBlvd,POBox630JeffersonCity,MO65102573/751-3830fax573/751-2527(termexpires2016)
Ed Donnell (Secretary)F&HFoodEquipmentCompanyPOBox3985G.S.Springfield,MO65803417/881-6114fax417/881-7314(termexpires2015)
Gary WheelerMissouriSoybeanAssociationPOBox104778JeffersonCity,MO65110573/635-3819fax573/635-5122(termexpires2015)
Dr. Scott PoockUniversityofMissouriA331ClydesdaleHallColumbia,MO65211573/882-6359fax573/884-9139(specifiedbybylaws)
Craig WestfallMissouriDairyAssociation4671HwyHHalfway,MO65613417/445-2220cell417/770-3350(specifiedbybylaws)
Keith BohlanderDairyFarmersofAmerica10220NorthAmbassadorDriveKansasCity,MO64153816/801-6270cell816/507-7642(termexpires2016)
Larry Schmidt (Vice-Chairman)MissouriDairyAssociation216HwyJJLaredo,MO64652660/286-2781cell660/654-2156(specifiedbybylaws)
Kyle BounousGrasslandsLLCDFAPOBox703Monett,MO65708cell417/235-4450(termexpires2015)
Kelly SmithMissouriFarmBureauPOBox658JeffersonCity,MO65102573/893-1416fax573/893-1560(specifiedbybylaws)
Dr. Tom McFaddennUniversityofMissouriS110ASRC,920ECampusDriveColumbia,MO65211573/882-8336fax573/882-6827(specifiedbybylaws)
Bradley SchadMissouriCornGrowersAssocation3118EmeraldLaneJeffersonCity,MO65109573/893-4181fax573/893-4612cell573/378-3399(termexpires2016)
Bob Idel (Treasurer)FCSFinancial1934EastMillerStreetJeffersonCity,MO573/636-7809ext122fax573/635-4367(termexpires2015)
David KlindtAssociationofMOElectricCooperativesPOBox1645JeffersonCity,MO65102573/659-3403fax573/635-2314cell573/694-2932(termexpires2015)
Richard FordyceDirectorMODepartmentofAgriculture1616MissouriBlvd,POBox630JeffersonCity,MO65102573/751-5617fax573/751-1784(specifiedbybylaws)
Dr. Alan WesslerMFA,Inc201RayYoungDriveColumbia,MO65201573/876-5248fax573/876-5498(termexpires2015)
Steve DavisMissouriDairyProductsAssociation800WestTampaSpringfield,MO417/865-9641cell417/848-4983(termexpires2016)
PAGE 7
The Missouri Dairy Growth Council Mission: “to grow astrongerandmoreviableMissouridairyindustry”
2014 Members:Gold Level ($1,000ormore)
AssociationofMissouriElectricCooperativesDairyFarmersofAmerica
FCSFinancialF&HFoodEquipmentCompany
MFA,Inc.MissouriDairyAssociation
MissouriDepartmentofAgricultureMissouriSoybeanProgram
OpiesTransport
Silver Level ($500.00ormore)MFAOilCompany
MissouriAssociationofRealtorsMissouriCornGrowersAssociationMissouriDairyProductsAssociation
MissouriFarmBureau
Bronze Level ($250.00ormore)Alltech
MissouriFieldmen’sandSanitarian’sAssociationMissouriStateMilkBoard
Individual ($100.00 or more)GaryL.Aggus
PAGE 8
The newest study shows that when it comes to curing mastitis in your herd, five treatments are three too many.1
To find out more, visit BI-Vetmedica.com/today, and talk with your Boehringer Ingelheim Vetmedica, Inc. representative.
PREVENTION WORKS.
1Schukken YH, Zurakowski MJ, Rauch BJ, et al. Non-inferiority trial comparing a first-generation cephalosporin with a third-generation cephalosporin in the treatment of non-severe clinical mastitis in dairy cows. ToDAY is a registered trademark of Boehringer Ingelheim Vetmedica, Inc. ©2013 Boehringer Ingelheim Vetmedica, Inc. BIVI-4717-8B
PAGE 9
For more information, contact the Farmer Hotline at (888) 809-9297. To learn more about CROPP Cooperative go to www.farmers.coop.
Join America’s Leading Organic Farmer Cooperative
• Stable Organic Premiums - 2015 average projected Midwest mailbox pay price is $34.93/cwt.• Transition Assistance - $3.50/cwt. for 12-month transition period• Veterinary & Agronomic Support• Feed & Forage Sourcing
Attend one of our upcoming meetings in your area to learn more about our cooperative.
All meetings are from 11 a.m. to 2 p.m.
Monday, January 26Morgan County Seed House
18761 Kelsay Rd.Barnett, MO 65011
Tuesday, January 27Ramada Hotel & Convention
Center - Kalahari Room 2546 N. Glenstone Ave. Springfield, MO 65803
Wednesday, January 28Calvin & Marian Zimmerman
Home 139171 Bay Rd.
Purdin, MO 64674
PAGE 10
MidwestDairyCheckoff.com
•Growing Sales and Demand
•Inspiring Consumer Confidence
•Defending Dairy’s Place in a Healthy Diet
Your Dairy Checkoff Investment
For ideas and resources call1-877-360-3276
For monthly updates on dairy issues,email [email protected].
PAGE 11
We’re up when you’re up.dairyherd.com
PAGE 12
Karl Althage Arke Holstein Farm Rodney Barnes John Beerman Harlan Borman Donald Brandt Maurice Butler Champ Goodwood Farms Dardenne Dairy Center Foremost Dairy Farm DeLaval Agriculture Division Bradford Elsworth Lester Evans Robert Evans Marvin Frankenbach Glidine Acres Leonard Goodman Donald Hegeman Melvin Hoffman Knial Kissee Emmett Kelner
Hershell LetsingerFred Martin Nolan MeierLarry MeinekaMissouri Valley Farms Richard Morgan Mullins Dairy Ed Nierman Kenneth & Fritz Nierman Stanley Oetting Palmer Farms CorporationRademacher Brothers Marvin SchnakenbergGail SnowMarvin Sprick Steele & King FarmDoyle Stokes Allen SulgroveWhetstine Farms Inc.Wayne Whitehead Ron Young
Thanks to these dairy supporters who were the charter members of
the Missouri Dairy Association
PAGE 13
Larry Purdom (Alice)PresidentRoute2,Box245Purdy,MO65734417/442-3846cell:417/235-9650fax:417/442-7009District 7 Director
Larry Schmidt (Carolyn)Treasurer216HwyJJLaredo,MO64652660/286-2781cell:660/[email protected] 1 Director
Stacey McCallister(Ingrid)8458Hwy38MountainGrove,MO65711417/668-5504cell:417/[email protected]
David Melton(Becky)Route1,Box47-GMountainGrove,MO65711417/948-2631cell:417/259-0395fax:417/[email protected]
Ex-OfficioDr. Scott PoockUniversityofMissouriA331ClydesdaleHallColumbia,MO65211573/882-6359office660/882-3960homecell:573/808-3479fax:573/[email protected]
Lloyd Gunter (Jane)VicePresident1148StateHwyWWConway,MO65632417/589-6845cell:417/533-8009fax:417/[email protected] 8 Director
Ted Sheppard (Barbara)6600SheppardDairyRoadCabool,Missouri65689417/926-5887cell:417/[email protected] 6 Director
Jay Moreland (Brenda)21601E.227thStreetHarrisonville,MO64701816/884-3697cell:816/258-3353fax:816/[email protected] 3 Director
Craig Westfall4671HwyHHalfway,MO65663417/445-2220cell:417/770-3350District5Director
ExecutiveDirector/AssistantSecretaryDave Drennan(Karen)1954SumterRidgeCourtChesterfield,MO63017636/519-9300officecell:314/712-6565fax:636/[email protected]
Kevin Frankenbach(Sue)Secretary6207CountyRoad258Hannibal,MO63401573/221-6843cell:573/[email protected] 2 Director
Norris Sloan(Annette)Route1,Box92MountainGrove,Missouri65711417/948-2233cell:417/[email protected]
Tom Olerichs (Kathy)30288PacificSchoolRoadMora,MO65345660/668-4717cell:660/[email protected] 4Director
Arlen Schwinke (Kay)DirectorEmeritusRoute1,Box228Morrison,MO65061573/294-6203cell573/[email protected]
2015 Missouri Dairy Association Board of Directors
Sponsored by Missouri Dairy Association, the Commercial Agriculture Program and University of Missouri Extension
February 23-27, 2015 9:30a.m. Registrationandvisitexhibitors,Coffee,milkandpastriesavailable,sponsoredbySelectSiresMidAmerica
9:50a.m. Welcome
10:00 a.m. “AcceleratedFeedingofCalves”—Dr. Hugh Chester Jones, Univ.ofMinnesotasponsoredby
10:45a.m.“HowtoReduceCostlyCalfhoodDiseasethroughImmuneSupport”—Dr. Bob Gentry, DVM, TechnicalServicesVeterinarian,MultiminUSA
11:15a.m.“What’sNewinManureEquipmentandManagement”—Dr Teng Lim,UniversityofMissouri
11:40 a.m. “MDAUpdateandSponsorRecognition”—Dave Drennan, Missouri Dairy Association
Lunch(*BringalongasampleofyourTMRandUniversityofMissouriwillevaluate) 1:15p.m.“WhatMissouriCowVideostellusaboutImprovingCowComfort”—Dr. Scott Poock, UniversityofMissouri
1:45p.m. “ProducerResponsesintheMissouriDairyRevitalizationSurvey”—Joe Horner,UniversityofMissouri
2:00p.m. “KeystoTransitionCowSuccess”—Reagan Bluel,UniversityofMissouri
2:30 a.m. “UseofGrazingvsConfinementforGrowingPost-WeaningHeifers”—Dr. Hugh Chester Jones, Univ.ofMinnesota
3:15p.m. Adjourn
Registrationfeeis$20.00payableateachlocation. Lunchreservationsareneeded.
CalltheExtensionofficelistedbelowTODAYforlunchreservations.
Locations: Meal Reservations Monday,February 23,PorkPalace,StateFairGrounds,Sedalia ExtensionOffice,660/827-0591 Tuesday,February 24,SpringfieldLivestockMarketingCenteroffI-44 ReaganBluelat417/847-3161 Wednesday,February 25,MSUStateFruitResearchCenter,MountainGrove TedProbertat417/741-6134
Thurs.,February 26,CapeGirardeauCountyExtensionOffice,Jackson ExtensionOffice,684W.JacksonTrail 573/243-3581 Friday,February 27,Hagie’sNineteen,618NorthWashington,Union KenBolteat636/583-5141
PAGE 14
“While one stable fl y does not cause signifi cant damage, 50–100 of these blood-sucking pests occurring together with 500 horn fl ies can cause a substantial daily loss of blood. This common livestock pest situation can result in a loss of 10–20% in milk production.” - Kaufman, P. E. and Weeks, E. N. I. “Stable Fly (Dog Fly) Control”. The Entomology and Nematology Department, Florida
Cooperative Extension Service, Institute of Food and Agricultural Sciences, University of Florida. First published: December 1997. Revised: August 2012.
“Stable fl ies feed from one to three times per day depending on the climatic conditions” - Anthony, Craig, “Confi ned Livestock Feeding Facilities: Control of Stable Flies and House Flies”.Extension Extra, South Dakota State Cooperative Extension Service, College Of Agriculture & Biological Sciences, South Dakota State University. April, 2005.
Always read and follow label instructions. Bite Free is a trademark of Farnam Companies, Inc. ClariFly and ClariFly Larvicide with design are registered trademarks of Wellmark International. ©2013 Wellmark International.
{ CAUSING }
It’s been proven, nuisance fl ies disrupt cattle comfort and spread disease, which can affect production. It has also been proven that ClariFly®
Larvicide can help stop fl ies before they become breeding, biting adults. When you add ClariFly®
Larvicide to feed, it passes through cattle to affect
larval development in the manure where fl ies lay their eggs. Use ClariFly® Larvicide as part of an IPMprogram that includes manure sanitation along with Bite Free™ Stable Fly Traps to help manage fl ies on your dairy operation. Learn more at centralfl ycontrol.com or call 800.347.8272.
PAGE 16
Being a part of Brownfield Ag News means being part of the greatest team of farm broadcasters in the world. The amount of respect, honesty, and esteem this group has for each other is unparalleled in the business. No bunk. Partly, it’s because they’re such a diverse group of ag professionals who are truly comfortable learning from each other and then building upon each others strengths. But when they bring their varied backgrounds and areas of expertise together, working seamlessly as a whole, that’s when the real magic happens. They say a good interviewer has to be a great listener. So listen… quietly… and you’ll hear… the voice of American farming.
Tune in to your local Brownfield radio station and visit us at brownfieldagnews.com
The best listeners in the business.
Cyndi Young Ken Anderson Tom Steever Emery Kleven
Dave Russell John Perkins Nicole Heslip Rob Buttery
Bob Meyer Meghan Grebner Jerry Passer Julie Harker
PAGE 17
Do you want your cowsOn this side of the fence? Or this side?
We can help. contact your local Missouri Department of conservation office, USDa natural Resources conservation Service office or Soil and Water conservation District office.
Photo taken at the end of July 2012 in Shannon County.On the left is a hayfield of native warm season grasses established in 2009; on the right is fescue.
Native grasses• produce quality summer forage• are drought tolerant• provide for wildlife needs
PAGE 18
ANNUAL MEMBERSHIP MEETINGThis is the official notice to all members of the Missouri Holstein Association that the annual membership meeting will be held Saturday, January 24, 2015, at The Ramada Oasis Hotel & Convention Center, Springfield, MO, beginning at 10:00 AM, with President Eric Ling presiding.
2015 DISTRICT OFFICERSNortheast Central: James Penn, president; Alfred Brandt, vp; Judy Borman, sec./treas.; Eric Adkins, director.Northwest: Dallas Cornelius, president; Dan Hegeman, vice-president; Debby Cornelius, sec./treas.; Kirby Hanson, director.Southwest: Nelson Hostetler, president; Janice Perry, vice-pres.; Shannon Kleiboeker, sec./treas.; Larry Wright, director.South Central: Tommy Schrivner, president; Justin Nelson, vice-president; Michelle Eilenstine, sec./treas.; Becky Durst, director.Southeast: John Schoen, president; Melinda (Schoen) Morrison, v.p.; Cliff Strieker, sec./treas.; Marvin Schoen, director.West Central: Jay Moreland, president; Matt Moreland, vice-president; Marilyn Moreland, sec./treas.; Ed Steele, director.
2015 STATE COMMITTEESJuniors: Shannon Kleiboecker, chm; Janice Perry, Brad & Gail Groves, Susan BrooksSale: Jason Ewing, chm; Nelson Hostetler, Mike Wilson, Brad Groves, Larry & Jodi Wright, Tim Ewing, Michelle EilenstineShow & Futurity: Becky Durst, chm; John Denbigh, Eric Adkins, Janice Ling, Mike Hackman, Eric LingFinance: Harlan Borman, chm; James Penn, Larry Wright, Jay MorelandAwards Committee: Roy Parsons, chmn; Dallas Cornelius, John Underwood, Cliff Streiker, Marianna ThompsonNominating: Alfred Brandt, chmn; Tommy Scrivner, Robert Perry Resolutions: Ed Wittorf, chm. Ed Steele, Barry Steevens
2014 Progressive Breeders Registry Awards Years Qualified % Homebred BAA Milk Fat Protein Groves-View Dairy 5 88.8 108.7 31,375 1283 973Toecky Farm 1 100.0 105.1 26,902 987 813
2014 Progressive Genetics Awards Years Qualified Average CTPI
Cla-Cor Farm LLC 2 1795Groves-View Dairy 13 1761Wilson Martin 4 1839James L. & Novalee Coats 8 1733
2014 Sho-Me Holstein Futurity ~ 3-Yr Olds1st Place Robthom Reed Excellency GP 83 Janice Ling & Mariana Thompson, Springfield 2nd Place Robthom Crank Excellency VG 86 Janice Ling, Springfield3rd Place Gatton Destry Desire-Red GP 84 Jessica Gatton-Dixon, Conway4th Place, 2nd Production Toecky Gabor Shampoo VG 85 Candy Durst, Springfield5th Place, 1st Production Toecky Gabor Jezebel VG 87 Tom Durst, Huggins6th Place Wrightvale-JL Drchn Gina-ET VG 85 Larry & Jodi Wright, Verona7th Place, F&L Award Robthom Voila Excellency VG 88 Monica Ling, Springfield8th Place, 3rd Production Robthom Asino Excellency Janice Ling, Springfield9th Place Robthom Rejoice Blizzard Janice Ling, Springfield
OFFICIAL NOTICEAnnual Membership MeetingMissouri Holstein Association
January 23 – 24, 2015Ramada Oasis Hotel & Conv.
Center, Springfield, MO
National Holstein Convention June 23- 26, 2015 – St. Charles, Illinois
Delegates Brad Groves & Kate Geppert
PAGE 19
2014 ALL-MISSOURI and JUNIOR ALL-MISSOURI AWARDSSpring Heifer Calf Senior 2 Year-Old Cow
AM Ms Golden-Dream Charlie Crystal Chamberlin AM Toecky Ginetta Braxton Becky Durst RAM Toecky Braxton Galinka Becky Durst RAM Groves-Vu A’s Dorinda-ET B,T,K,B GrovesJAM Ms Angelina Angeli-ET Monique Turner JAM McClellan Jet Royal Black A, K, H McClellanRJAM McClellan Brett Audi Audrey McClellan RJAM Groves-Vu A’s Dorinda-ET B,T,K,B Groves
Winter Heifer Calf Junior 3 Year-Old CowAM Golden-Dream Abe Speck Desirae Hickernell AM JL-Kel-land Super Speckles K, E, L WantlandRAM Starmark HP Regret-Red-ET Bailey Groves RAM Ms Golden-Dream At Holiday Dalton SmithJAM Golden-Dream Abe Speck Desirae Hickernell JAM JL-Kel-land Super Speckles K, E, L WantlandRJAM McClellan Racin Prancer A, K, H McClellan RJAM Ms Golden-Dream At Holiday Dalton Smith
Fall Heifer Calf Senior 3 Year-Old CowAM Ram-Elle Masterpiece Pansy Loren & Michelle Eilenstine AM U-Mo Ashlar Antoinette University of MissouriRAM Toecky Sanchez Destiny Becky Durst RAM HBD Jons Braxton Inka-ET B, L, T WhiteheadJAM Golden-Dream Abe Ribbonet Dalton Smith JAM HBD Jons Braxton Inka-ET B, L, T WhiteheadRJAM Alda-Acres Ory Cappy Alicia Ley RJAM
Summer Yearling Heifer 4 Year-Old CowAM U-Mo Sanchez Sassy University of Missouri AM U-Mo Sanchez Ariel University of MissouriRAM Radine Armani Design Borman Farms RAM U-Wing Destry Tatum Jason EwingJAM Grison Wildman Wanka Kathrin Buff JAM Klassens Pronto Mandy Lauren WhiteheadRJAM RJAM
Spring Yearling Heifer 5 Year-Old CowAM Golden-Dream Abe Jasmin DaltonSmith AM BW-EG Trent Dena Crystal ChamberlinRAM U-Mo Gold Chip Neena University of Missouri RAM Robthom Lola Lou Janice Ling JAM Golden-Dream Abe Jasmin DaltonSmith JAMRJAM Radine Colt-P Annie Sophie Geppert RJAM
Winter Yearling Heifer Aged CowAM Golden-Dream Blis Madelyn Dalton Smith AM Radine Damion Margie-ET University of MissouriRAM Jebo Braxton Blissful Sophie Geppert RAM Robthom Raphe Moscow Janice LingJAM Golden-Dream Blis Madelyn Dalton Smith JAM Roslems Gibson Marcy-ET Patrick HilgenbergRJAM Jebo Braxton Blissful Sophie Geppert RJAM Wrightvale Talent Amy-Red Lora Wright
Fall Yearling Heifer 150,000 pound CowAM U-Mo Atwood Karista University of MissouriRAM Toecky Hero Justine Tom DurstJAM M-M-T Ley Gabor Tilly Thomas LeyRJAM C of O Gold Chip 1373 Blake Wright Produce-Of-Dam
AM Angel & Antoinette University of MissouriJunior Best 3 Females RAM Lola & Crimson Janice Ling
AM University of Missouri JAM Prancer & Dancer A, K, H McClellanRAM Toecky Farms Daughter-DamJAM McClellan AM Rosebud & Royal A, K, H McClellanRJAM RAM Gypsy & Claire Crystal Chamberlin
JAM Rosebud & Royal A, K, H McClellanDry Aged Cow
AM McClellan LS Rosebud-Red A, K, H McClellanJAM McClellan LS Rosebud-Red A, K, H McClellan Best 3 Females
AM University of MissouriRAM Robthom Farms
Dry 3 & 4 Year-Old Cow JAM A, K, H McClellanAM ToeckyTimex Becky DurstRAM Shaverside G Atwood Airy Dalton Smith Breeders HerdJAM Shaverside G Atwood Airy Dalton Smith AM University of Missouri
RAM Robthom FarmsJunior 2 Year-Old Cow JAM
AM Golden-Dream Joe Jordy Dalton Smith RJAMRAM U-Mo Braxton Peni University of MissouriJAM Golden-Dream Joe Jordy Dalton SmithRJAM Regancrest GV Britany-ET B, T, K, G, B Groves
PAGE 20
2013 Cow of the Year: Groves-Vu Toystory Rona, Groves-View DairyPaul Selken Memorial Herdmanship Award 2014 (State Fair): University of Missouri
National Junior Holstein Convention Awards 2014 Junior Dairy Bowl Team 2014: Lora and Blake Wright, Verona, Taylor and Kiera Groves, Billings, Coaches, Brad and Gail Groves, Billings National Folding Display Contest 2014: Grant Groves, Billings; Audrey McClellan, Willow Springs; Katelyn McClellan, Willow Springs National Junior Jeopardy Contest 2014-Intermediate: Charlie Brooks, Mtn. Grove and Audrey McClellan, Willow Springs National Banner Contest 2014: 3rd Place, Kiera and Taylor Groves, Billings and Lora and Blake Wright, Vernona National Digital Scrapbook Contest 2014: 3rd Place - Lora Wright, Verona Prepared Public Speaking 2014: Intermediate Division: Lora Wright, Verona – Farmed and Dangerous; Audrey McClellan, Willow Springs – Milk, Got it? Penny Wars: Iowa 1st Place National Young Distinguished Junior Member Award: Lora Wright, Verona
Missouri State Junior Awards 2014 Spring Classic Scholarship 2014: Missouri Holstein Princess 2014: Missouri Holstein Little Miss 2014: Distinguished Junior 2013-Jr Division: Blake Wright, Verona Distinguished Junior 2013-Sr Division: Kay Bacon Memorial Award (13th): Bailey Groves, Billings, Star-Mark HP Regret-Red-ET, Junior Champion 4-H/FFA State Fair Mark Highfill Memorial Award (10th): Lauren Whitehead, Conway, HBD-Jons Braxton Inka-ET, Grand Champion 4-H/FFA State Fair
2014 Membership Report2014 2013 2012 2011 2010
Northeast District 34 34 41 35 45Northwest District 4 6 7 8 12South Central District 33 31 39 39 43Southeast District 8 7 7 7 6Southwest District 77 75 89 96 93West Central District 18 21 23 23 26
TOTAL 174 174 206 208 225
2014 Missouri Holstein BudgetINCOME EXPENSES
Membership $7,500 Management & Jr. Advisor $7,800Interest 700 Travel & Office 2,200State Convention Sale 5,000 Accounting 220Futurity 2,800 Mid-States Subscriptions 800Field Day 250 Scholarships, awards, gifts 1,500Spring Show 2,300 Futurity 1,800State Convention Fun Auction 500 Printing and Postage 1,000Web Page Advertising 250 Spring Show 2,500National Convention Registry 3,000 State Convention Sale Expenses 5,000Convention Auction 500 Website 500Junior Activities 5,500 District dues 380
Total $28,300 Jr Advisor and Activities 4,200Financial Review 5,000Judging Team Support 5,000
Total $37,900
PAGE 21
Missouri Holstein Association-98th Annual Membership MeetingSaturday, January 25, 2014, 10:00 a.m.,Springfield, MO
President Eric Ling called the meeting to order at 10:15 a.m. Approximately 34 members and guests were present. Tommy Scrivner moved that the minutes be approved, Jodi Wright 2nd , motion passed.State Representative Casey Guernsey, a member of the State Ag Committee, addressed the members about the House Bill #1326 that the State of Missouri is trying to get passed in the legislature. It would set margin insurance at $7.50 for dairy producers.The financial report was handed out for members to review. Janice Ling moved the financial report be approved, Larry Wright 2nd, motion passed.District, State, and National ReportsNorthwest: No report. West Central: Jay Moreland said the district show was held with the Cass County Fair in Pleasant Hill, plan to do the same for this year. Southwest: Jodi Wright said they had their district show in conjunction with Ozark Empire Fair. The Futurity was held at College of the Ozarks. Their district meeting was held in December. South Central: Tommy Scrivner said their district held their 25th Anniversary show on June 15th during the Tri-County Fair. This year the show date is June 14th and will be held with the fair again. Northeast Central: Eric Adkins said they held their district show during Spring Show and will again this year. They had their district meeting last week. Southeast: Cliff Strieker said they will have their district meeting when Tim Ewing will be in the area.State Fair: No report.Holstein USA: Tim Ewing said that beginning January 1st, that Holstein USA will be doing registration applications and classifications for the Red and White Dairy Cattle Association. There are no 40 year Holstein members from Missouri this year, however, there are four 50 year members who will be honored at the National Convention. They include Harlan and Judy Borman, Noel R and Lloyd L Boyd, Larry G Purdom, and the College of the Ozarks. 2013 Progressive Genetics Awards went to Cla-Cor Farm LLC, Groves-View Dairy, Wilson Martin, and Purina Animal Nutrition Center. 2013 Progressive Breeders Registry Awards went to the College of the Ozarks and Groves-View Dairy. University Extension: Ted Probert said they held a Dairy Grazing Conference and a Dairy Margins Workshop. There was no Southwest Center Field Day in 2013 but one is scheduled for September 12, 2014. At the Center they are currently doing reproductive research and fescue research. A Pasture Based Dairy Course is currently going on. Activities planned for this year include Dairy Profit Seminars, Cow Camp, and Dairy Judging Camp. The 4-H judging team will be traveling to Europe for an invitational contest in June.Dairy Shrine: Ray Schooley said there are currently over 20,000 members of the Dairy Shrine. They give $50,000 in scholarships each year. He invited those who wish to become members to send in applications.COMMITTEE REPORTS:Show: Larry Wright reported that they will leave the point system the same as last year. State Fair 20 points, Spring Show 15 points, District Show 10 points, bonus points for National shows top half of the class 8 points, bottom half 4 points. Only 1 show will count for bonus points for an animal. Michelle will calculate points for All Missouri. Winners will be announced when points have been tabulated, approximately Thanksgiving after Louisville. Awards will be presented at State Convention in January. There will be a photographer scheduled for state fair for professional pictures. Southern Spring National is set for April 8-12th. It is recommended by the committee to use the Holstein Association’s Judges List for judges for Spring Show and State Fair.Spring Show: John Denbigh said the show date is set for Saturday, March 22, 2014. Cattle may begin arriving after 6:00 p.m. on Thursday, March 20th. The fees will remain the same as last year, entry is $25, late entry is $35, class sponsor is $50. There will be no calf sale. The show will begin at 10:00 am. The University will have straw for sale at $3.00 a bale. Northeast Central District will pay $200 toward the judge. It was brought up by Jodi Wright that the Northeast Central District contribute more financially toward the show since it is their district show and the state loses money on the show. It will be discussed at the district meeting in 2014. Sale: Jason Ewing said the sale was very successful. He thanked Select Sires Mid-America for their sponsorship for the sale meal. The sale averaged $2601 on all lots and grossed over $33,000. He thanked Gary Estes for auctioneering and all of the sale committee for their hard work. Larry Wright said they want more consignments for next year and will look to have more state members support. It is critical in order for the sale to be successful for the state. Professional pictures of consignments are important to a high quality catalog and will be required again next year. Tim Ewing is currently taking consignments for the Clinton County Sale.Futurity: Becky Durst gave a report on the winners of the 2013 futurity held October 12, 2013 at the College of the Ozarks, Point Lookout, MO. The entries for the 2016 futurity are due February 1. The College of the Ozarks has invited us back for 2014. Jodi Wright moved that Becky work with the Executive Committee to finalize details for the 2014 futurity, Larry Wright 2nd, motion passed unanimously. Michelle asked the membership if they wanted to change the awards to be something different than chairs. It was the consensus to keep the chairs as awards.Awards: Ray Schooley gave the report stating they have made changes to the 2013 recommendations based on the request of the board. They include that the Distinguished Service Award recognize a living or deceased member. The Master Breeder Award recognize a living member, family, partnership, or corporation and that no more than one award be given each year. The Retired Breeder Award recognize a retired living or deceased member and that no more than two awards be given each year. The committee strongly recommends the Board take action to nominate deserving members for the awards offered by the Missouri Dairy Hall of Honors, the National Dairy Shrine, and the Holstein Association USA. They also recommend that members give consideration to deserving members for the Distinguished Service Award, the Master Breeder Award, and the Retired Breeder Award in addition to the national awards mentioned above. Members deserve recognition and they must be nominated in order to be considered. Ray move to accept the recommendations made, Jodi Wright 2nd, motion passed unanimously.Finance: Roy Parsons went over the financials from 2013,the new budget will be close to break even. It is requested that the finance committee receive the financial statements earlier in order to have more time to work on the budget before the annual meeting. The committee has discussed looking at other options to try to make better use of our funds, it is recommended that we keep it the same and not make changes at this time.Lloyd Gunter from the Missouri Dairy Association spoke to the members. He welcomed us on behalf of MDA and thanked us for coming. The Farm Bill is currently on the House floor in Washington without the Dairy Stabilization attached to it, however, margin insurance is included in the bill. MDA is currently working with Missouri House Bill #1326 which puts margin insurance at $7.50. If passed, the state will cover the difference in margin up to $7.50 not covered by the federal. There is also an educational part attached to benefit ag students. This bill looks promising but our help is needed to contact representatives to vote yes. MDA is wanting to increase membership, you can sign up with dues paid as a milk check deduction.
PAGE 22
OLD BUSINESS:History Book: John Underwood said the books are still for sale. There are ads being placed in the Mid-States for corrections, older pictures have been found since the book was printed. A few more corrections will be made in the near future.Association Audit: Eric Ling talked about the status of the audit. Michelle gave a current report. It was voted on by the Board that we could not afford an audit so we opted to do a financial review. The initial draft of the review has been finished. There are no discrepancies found by the accounting firm. The price estimate at the beginning was $2000-3000. It has been a much more time consuming project than anticipated and the current time put in is close to $7000. The Executive Board will meet with the accountants to discuss the billing. The final report should be available soon.National Convention Sale Receivables: Eric said that the money owed to the Association from the National Convention Sale has been collected and deposited in July of 2013. A letter from an attorney was sent in which Dallas Burton paid the full amount due.State Association mergers: Michelle reported that no response was received from Arkansas to meet with Missouri. It was heard that Arkansas has decided to join Oklahoma instead. There are some Arkansas members who have chosen to join Missouri instead.State Travel to District meetings: Michelle proposed the pros and cons of state representatives not attending District meetings. It has become more difficult to collect dues, schedule Breeder Pages, inform members of junior and adult association activities, and it is more difficult for Holstein Rep Tim Ewing to schedule and attend meetings. There seems to be less members attending meetings this year and some districts did not have a meeting. It costs the state an average of $600 to have the secretary and junior advisor attend. Jodi Wright moved that we reinstate paying the expense of state travel to district meetings, Brad Groves 2nd, motion passes. Cliff Strieker spoke that it is not necessary for travel to the Southeast District as there are so few members.NEW BUSINESS:Central File Storage: Jodi Wright said that it would be a good idea to be able to store the association information in a central file location. There are many different options and costs available. She recommended this be referred to the Board for further discussion.Field Day: Larry Wright offered to host Field Day at his farm in Verona, MO in 2014. There were no other offers.Mid-States: Michelle brought up some of the issues that have happened with the magazine. The association has not received copies of the print versions since 2012. There seems to be an unwillingness of the sharing of information from the Mid-States, especially pictures. The pricing structure does not encourage advertisers, other print publications offer price breaks for large ads and multiple issue ads. The Mid-States is not being competitive with other publications. Sue Ann Steele says the magazine is not in a good financial state as other states have not been paying for their part. The ad prices have not changed in 19 years. It was offered that we could put together a committee to help if necessary. Sue Ann said she would look into the situation further and let us know. 4-H Judging Team: Ted Probert talked about the judging team raising money to go to Europe for an invitational judging contest. Team members are Steven Nelson, Tucker Peterson, Bailee Whitehead, and Brittney Groves. Donations can be made to the Missouri 4-H Foundation and can be given to Ted or any team member. Mike Wilson talked about the experience of the Europe trip. It is planned for June 18th through July 2nd. Larry Wright moved we give the team $5000, Jason Ewing 2nd, motion passed.By-Laws: Alfred Brandt said the By-Law committee has come up with some proposed changes to the by-laws. He read those proposals and then recommended we wait until the next annual meeting to vote on them. Jason Ewing moved we vote on changes at the next annual meeting, Larry Wright 2nd, motion passed unanimously.Resolutions: Jay Moreland read the 2013 Resolutions. Jay moved they be accepted, Jodi Wright 2nd, motion passed unanimously.Nominating Committee: Tommy Scrivner gave the committee recommendation that the officer slate remain the same, President, Eric Ling; Vice-President, Jay Moreland; Secretary-Treasurer, Michelle Eilenstine; and Director at Large, Brad Groves. Tommy moved the officers remain the same, Sue Ann Steele 2nd, motion passed unanimously.Junior Committee report: Breezy Gardner gave the junior report. She is the 2014 Junior President. $3400 was raised with the raffle calf and they plan to do another one this year. They are currently looking for a calf to be donated. The juniors will keep the Junior All Missouri points the same, Futurity money will continue to be paid to juniors, and the junior advisor stipend will remain the same at $500. New officers were elected in their meeting. They are collecting pennies for the Penny Wars for National Convention. Several junior members are planning on attending and competing at National Convention.ANNOUNCEMENTS:Futurity entries are due February 1. The Region 7 Holstein Association meetings will be available online this year. Members are encouraged to sign up for the Breeder Page on the website. Janice Ling mentioned the low participation in voting for the Cow of the Year Award. Members need to be more proactive in sending in their ballots and participating. Jason Ewing moved the meeting be adjourned, Robert Perry 2nd, motion passed unanimously.
Respectfully submitted,Michelle Eilenstine
PAGE 23
2013 RESOLUTIONS MISSOURI HOLSTEIN ASSOCIATIONAnnual Meeting, Saturday, January 25, 2014, Springfield, MO
The committee met and recommends the following resolutions for your consideration at the 98th annual convention of the Missouri Holstein Association.
Be it resolved: The Missouri Holstein Association expresses its sincere appreciation to the MDA and Dave Drennan for their work and organization of the 2014 Heart of America Dairy Expo.
Be it resolved: That Sue Ann Steele, Mid States News editor; Kate Geppert, managing editor, and Jodi Wright and Michelle Eilenstine, secretary treasurers be commended for their hard work and diligent efforts.
Be it resolved: That the Missouri Holstein Association expresses thanks to the Rick Scheer family for hosting the 2013 Field Day. Whereas the Missouri Holstein Association is sincerely interested and considers itself a vital part of the dairy industry in the State of Missouri, be it resolved that the members individually and the corporate associations pledge support and offer its leadership to the following:
1. Mark Witherspoon and Mid-South Dairy Records.2. Dave Drennan and the Missouri Dairy Association.3. Missouri State Department of Agriculture, under the direction of past director Jon Hagler and new director Richard
Fordyce and their staff, including the animal health department, the director of the Missouri State Fair and especially Kate Geppert, dairy superintendent.
4. The University of Missouri, College of Agriculture, Food and Natural Resources: The Commercial Ag Program, and the entire dairy extension specialist team. The Midwest Dairy Association and the National Dairy Board with special commendation to Ron Gruisimier and Stacy Dohle.
5. The 4-H and FFA youth organizations through their educational and leadership building experiences.6. Be it further resolved that our Association continue to underwrite, support, and encourage participation in the district
shows, fall sale, futurity and spring show. 7. A special thanks to Robthom farm for hosting Cow Camp for the juniors, understanding that the future of our
organization, breed and industry is dependent upon interest, training, and leadership development of our youth. 8. Be it resolved that our association continue to support and encourage the Missouri Junior Association for the
excellent job they are doing. Congratulations to the juniors who competed at the 2013 National Convention: Dairy Bowl: Lora and Blake Wright and Taylor and Kiera Groves, and coaches Brad and Gail Groves. Folding Display Contest: Katelyn McClellan, Dalton Smith, Samantha Calton, Audrey McClellan, Bailee and Lauren Whitehead. Junior Jeopardy: Charlie Brooks and Katelyn McClellan. Senior Jeopardy: Bailee Whitehead and Audrey McClellan. Banner: Bailee Groves and Breezy Gardner. Digital Scrapbook: Lora Wright. Public Speaking: Lora Wright, Taylor Groves, and Audrey McClellan. Special thanks are given to Bailee Whitehead for serving as our Holstein Princess and Lauren Whitehead as Holstein Miss. The state of Missouri won the Penny War competition for the second year. We would like to congratulate the Missouri 4-H Judging Team of Bailee Whitehead, Steven Nelson, Tucker Peterson, and Brittney Groves on their success at World Dairy Expo.
9. Be it resolved: A special thanks to Robert and Janice Perry, Sylvia McClellan, and Shannon Kleiboeker on their outstanding job as junior committee leaders, and all those who helped them.
10. Be it resolved: A special thanks to Becky Durst for chairing the Futurity and the College of the Ozarks for hosting the 2013 Futurity.
11. Be it resolved: The Missouri Holstein Association expresses special thanks to this years officers, for their many hours of work and dedication to the cause of Registered Holsteins in the State of Missouri: Eric Ling, president; Jay Moreland , vice president; Brad Groves, director at large; Jodi Wright and Michelle Eilenstine, secretary managers.
12. Be it resolved: The Missouri Holstein Association commends Sara Parker Pauley, Director of the MissouriDepartment of Natural Resources, for her cooperation and common sense approach to dairy farming and the environment in the State of Missouri.
13. Be it resolved: The Missouri Holstein Association expresses its sincere sympathy to all the families who have lost loved ones during the past years.
14. Be it resolved that in recognition that the education of present and future generations of producers is vital to the growth and well being of the dairy industry in Missouri. The Missouri Holstein Association strongly urges the University of Missouri administration to fund and staff the positions being vacated.
15. Be it resolved: Missouri Holstein Association congratulates all of this year’s inductees into the Missouri Dairy Hall of Honors.
16. Be it resolved: Missouri Holstein Association congratulates Groves-Vu Farm for receiving the 2012 Cow of the Year Award with Groves-Vu Blitz Lassie.
17. Be it resolved: Missouri Holstein Association thanks Rex Ricketts for his 42 years of dedication to the Missouri dairy industry.
Respectfully submitted: Jay Moreland, chairman; Ed Steele, Ed Wittorff
PAGE 24
Missouri Holstein Districts
The Missouri Holstein Convention Host District Schedule 2015 – West Central 2016 – Northwest 2017 – South Central
2018 – Southeast 2019 – Northeast 2020 – Southwest
Convention Notes:
PAGE 25
PAGE 26
Great content… Great coverage… and it’s FREE!
Progressive Dairyman, reaching 26,300+ readers across the U.S. every month,is THE source for the latest information in the dairy industry.
With an experienced editorial team and well-respected industry contributors, you’ll fi nd each issue to be full of practical and relevant content for your operation.
Sign up to receive your free print subscription and stay current between issuesby visiting our website, www.progressivedairy.com.
Sign up today! call us at (208) 324-7513 or (800) 320-1424
www.progressivedairy.com/subscribe
Cool it Take the heat off of your herd.
PG. 42
Plus
Is inbreeding still an issue?
Learn how to avoid parentage pitfalls. PG. 61
Hidden hot spots Discover the unseen areas of heat stress on your dairy.
PG. 40
Get heifers bred Find out which timed-A.I. protocol results in the highest
conception rate. PG. 66
Build better cows Unlock the secrets to genetic progress. PG. 65
Serving Dairymen Nationwide | July 19, 2014 | Vol. 28 No. 12
S in
oooooooool itoooooooool ititkkeee tthhe heat off of your herd. kkekeee tthhthhthhe heatat ofoffoffff ofofo yyour herdrdrd.
424222
Plus
Is inbreeding still an issue?
Learn how to avoid parentage pitfalls. PG. 61
Hidden hot spotsDiscover the unseen areas of heat stress on your dairy.
PG. 40
Get heifers bredFind out which timed-A.I. protocol results in the highest
conception rate. PG. 66
Build better cows Unlock the secrets to genetic progress. PG. 65
g Dairymen Nationwide | July 19, 2014 | Vol. 28 No. 12
D i m Nati ide | J l 19 2014 | V l 28 N 12
Not a drop wasted Manage, balance and enhance waste milk. PGs. 46-50
Plus
Looking for a golden employee An HR manager, full-time or even just part-time, could have multiple benefi ts for your dairy. PG. 26
Feed for the breed Learn fi ve truths to keep in mind when raising Jersey calves. PG. 54
Promoting local Meet a group of New England dairy producers who adopted a fair-trade concept to rally their communities behind dairy farming. PG. 35
Colostrum: More than just for calvesFind out about the growing need for colostrum for non-animal-feed uses. PG. 40
An apple a day keeps the vet away? Manage a cow’s immunity through nutrition. PG. 67
Serving Dairymen Nationwide | August 25, 2014 | Vol. 28 No. 14S i D i N ti id | A t 25 2014 | V l 28 N 14
PAGE 27
Grand Ballroom
Fiji Coco Maui
PAGE 28
Oasis Convention Center
Additional Meeting Rooms are located near the lobby in the hotel:
Arabian - Ramada 2nd floorSahara A & B - Ramada 2nd floorSonoran - Ramada 1st floor
Bal
lroo
m lo
bby
Bora BoraBoardroom
Operating Loans
TermLoans
Real EstateLoans
CropInsurance
www.myfcsfinancial.com
We put the right toolsat your fingertips.
www.myfcsfinancial.com1.800.444.3276
find an fcs financial office near you:
We know it takes the right tools to run a successful farm. most of us grew up on farms or in rural communities, and many of us still live there today. These experiences give us a real understanding of agriculture and what it takes to build a farm. our passion for rural missouri drives us but our experience and knowledge sets us apart from other lenders.
Growing Relationships. creating opportunities. is a trademark of fcs financial, aca.Equal opportunity Provider
acompetitive rates with longer terms
aflexible payment schedules to match your cash flow
aExperienced staff to make your financing process simple
afinance options to meet your specific needs