![Page 1: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/1.jpg)
Chapter-2
CLONING OF CELLULASE GENES FROM
CELLULOLYTIC BACTERIA
![Page 2: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/2.jpg)
2.1 Introduction
The cellulase enzymes have attracted considerable attention in recent years due to their
great biotechnological and industrial applications. Conversion of food, industrial and agricultural
wastes in to valuable sugars is the potential use of cellulase enzymes (Bothast and Saha, 1997).
Cellulases are being studied because of their application in the hydrolysis of cellulose, the most
abundant biopolymer and potential source of utilizable sugars. These serve as raw materials in
the microbial production of a wide variety of chemicals, food and fuel. Cellulose is hydrolysed
by a multicomponent cellulase system of microorganisms to glucose.
The major enzymes involved in cellulose hydrolysis are endo and exo- glucanases which
act synergistically to convert crystalline cellulose into cellobiose which is then converted to
glucose by the action of β-glucosidase (Mandels, 1982). The structural genes encoding these
enzymes have been isolated and identified from cellulolytic bacteria and expression of the
cellulase genes in a cellulase free host microorganism has also been achieved (Penttila et al.,
1986).
Enzymatic hydrolysis of cellulosic wastes may give a relatively pure product with the
consumption of less energy during the process (Fennington et al., 1982). Substantial efforts have
been made by enzyme suppliers and industrial users to improve existing cellulase enzymes.
Consequently, thermophiles are being aggressively pursued to provide new enzymes that are
highly thermostable depending on the environment of the native organism. Since biomass is
abundant and reasonably inexpensive, the key to successful commercialization of the process
utilizing biomass is the development of efficient and economical conversion methods such as
enzyme hydrolysis. Cellulolytic enzymes are synthesized by a number of fungi and bacteria are
![Page 3: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/3.jpg)
the major natural agents responsible for cellulose degradation. The bioconversion of cellulosic
material into useful products has become one of the priority areas of research (Lederberg, 1992).
In recent years recombinant DNA technology has provided techniques for isolating,
characterizing and manipulating the genes of interest. It is expected that the use of recombinant
DNA technology applied to the cellulase system will facilitate a better understanding of the
catalytic and regulatory activity of the cellulase enzymes. This would also give insights into the
nature of the cooperative interactions between different enzymes that are involved in the
complete hydrolysis of cellulose, the development of expression systems for the utilization of
natural cellulose into usable products. Development of novel cellulolytic microorganisms by the
introduction of exogenous genes would enable other properties of the host organism to be
exploited more fully. Much of the recent success in isolating different endoglucanase genes can
be attributed to the use of the simple yet powerful Congo Red-carboxymethylcellulose overlay
technique for selecting recombinant clones that express endoglucanase activity (Teather and
Wood, 1982). By genetic manipulation of the genes and coordinate expression of enzymes it
shall be possible to transform a noncellulolytic organism to cellulose utilizing microorganisms.
The noncellulolytic organisms that are used for the expression of cellulase genes are
mainly S. cerevisiae, Z. mobilis and E. coli. They are all proved suitable for industrial
applications. The present effort is to express a functional cellulase system, in order to enable
non-cellulolytic bacteria to hydrolyse and utilize cellulosic biomass. There are good tools for the
genetic manipulation of them, but as cellulase systems are very complex and is not fully
understood, it is still not so easy to achieve this goal. Nevertheless a lot of work has been done
for cloning of cellulase genes and studying the cellulolytic strategy and it is still progressing.
![Page 4: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/4.jpg)
This chapter explains the cloning of cellulase gene from five different cellulolytic bacteria
isolated from insects gut into E. coli using a high copy number stable plasmid, pET20b(+).
![Page 5: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/5.jpg)
2.2 Materials and Methods
2.2.1 Bacterial strains and culture media
The isolated cellulolytic bacterial strains such as, P. mirabilis, P. aeruginosa,
K. pneumoniae, P. fluorescens and E. cloaceae were used for isolating cellulase gene. E.coli
harboring pET20b(+) (AmpR, T7 expression vector, size of plasmid 3.7 kb) was kindly provided
by Dr. S. Krishanaswamy, School of Biotechnology, Madurai Kamaraj University, Madurai.
E. coli cells harbouring (pET20b(+) plasmid grown on Luria agar with ampicillin (50μg/ml)
under static condition at 37oC and the plasmid was used for cloning of cellulase gene.
2.2.2 Genomic DNA isolation from cellulolytic bacteria
Genomic DNA of cellulolytic bacteria such as P. mirabilis, P. fluorescens,
P. aeruginosa, K. pneumoniae and E. cloacae was isolated as described by Sambrook and Russel
(2003). About 1.5ml of overnight culture of bacteria was centrifuged at 10,000 rpm for 5 min.
The pellet was taken after decanting the culture supernatant. The cells were resuspended and
lysed in 200 µl of lysis buffer by vigorous pipetting. Followed by 66µl of 5M NaCl was added to
remove most of the cell debris and proteins. The tubes were incubated at -20oC for 10min and
were centrifuged for 10min at 12000 rpm at 40C. The supernatant was carefully transferred to a
fresh sterile tube without disturbing the pellet (debris) using a micropipette and extracted once
with equal volume of phenol: chloroform (1:1 mixture). Subsequently the upper aqueous phase
was extracted once with chloroform: isoamyl alcohol (24:1) and once with ether. Final aqueous
phase containing the DNA was transferred to a sterile tube and the DNA was precipitated by
adding 4 volumes of ice cold 100% ethanol and incubating 1 hr in -200C incubator. DNA was
collected by centrifuging the content at 10,000 rpm, 10 min at 100C. The DNA pellet was
collected and washed once with 70% ethanol and air dried for 5min. Finally, the DNA pellet
![Page 6: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/6.jpg)
obtained was dissolved in 100μl TE buffer and quantified by UV spectrophotometrically
(Sambrook and Russel, 2003).
2.2.3 Plasmid DNA isolation from E. coli contain pET 20b (+) by mini preparation method
Single colony harbouring E.coli-pET20b (+) plasmid was cultured overnight with
ampicillin (100μg/ml) at 37oC in 3 ml LB. It was subcultured at the rate of 10 ml of overnight
culture/ liter and grown till 1 OD at 600 nm. Cells from 1.5ml of the culture were harvested by
centrifugation at 10,000 rpm for 5min at 40C. The supernatant has been decanted and the cells
were resuspended in 100µl of TEG buffer (pH8.0).After the cells were resuspended in 200μl of
NaOH/ SDS buffer was added and mixed well by gentle inversion till the cells lysed completely.
Then 150μl of 3M sodium acetate (pH 4.6) was added and gently mixed by inversion. The tubes
were incubated in ice for 30 min and were centrifuged for 10min at 12,000 rpm at 4oC. The
supernatant was carefully transferred to a fresh sterile tube without disturbing the pelletted debris
precipitate using a micropipette. Then, 720μl of isopropanol was added to the supernatant and
mixed gently, kept at room temperature for 10 min and centrifuged at 12,000 rpm for 10 min at
10oC. The pellet (DNA) was collected and washed once with 70% ethanol and air dried for 5min.
Finally, the pellet obtained was dissolved in 100μl TE buffer and stored at 4oC. The DNA was
further purified by extraction with phenol: chloroform (1:1) once and once with chloroform:
isoamyl alcohol (24:1) and finally reprecipitaed with ethanol. The DNA sample was checked on
an agarose gel and quantified using UV absorbance spectrophotometry at 260 nm (Sambrook and
Russel, 2003).
![Page 7: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/7.jpg)
2.2.4 Restriction digestion of genomic DNA of cellulolytic bacteria
2 μg of purified chromosomal DNA of cellulolytic bacteria was digested with BamHI
enzyme for 1 hr at 370C and the reaction was stopped by heating to 65oC for 10 min and purified
by extraction through phenol choloroform and reprecipitated by ethanol.
2.2.5 Restriction digestion of plasmid pET20b(+)
The purified 2 μg of plasmid pET20b(+) DNA was digested with 10 units of BamHI
enzyme for 1 hr at 370C and the reaction was stopped by heating to 65oC for 10 min and by
extraction through phenol choloroform and reprecipitated by ethanol (Sambrook and Russel,
2003).
2.2.6 Ligation of restricted chromosomal and plasmid DNA
The BamHI digested genomic as well as plasmid DNA were purified further and ethanol
precipitated, resuspended in TE buffer and used for ligation. Both genomic and plasmid DNAs
were mixed and ligated using T4 DNA ligase (Fermentase, Germany) at 16oC for 16 hr
(Sambrook and Russel, 2003).
2.2.7 Preparation of competent cells
Single colony of E. coli strain DH5α was inoculated into 3ml of Luria broth and
incubated for overnight in a rotatory shaker platform at a speed of 160 to 200 rpm. 0.5ml of the
overnight culture was subcultured in 50ml of fresh Luria broth. The culture was grown to an
O.D. of 0.6 at 600nm. The culture was chilled in ice for 30min and centrifuged at 6000rpm for 5
min at 4oC. The cell pellet was gently resuspended in equal volume of 0.1M ice-cold calcium
chloride (CaCl2) solution and was incubated in ice for 20-30 min. Then the cells were
centrifuged at 6000 rpm for 5 min at 4oC and the supernatant was discarded and the cell pellet
![Page 8: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/8.jpg)
was taken and resuspended in 1/10th volume of original culture in 0.1M CaCl2 (ice-cold) and was
incubated in ice for 30 min (Sambrook and Russel, 2003).
2.2.8 Transformation of E. coli competent cells with ligated mix
100μl of competent cell suspension was taken in a sterile and chilled eppendorf tube. To
the competent cell suspension 10 μl of ligated mix was added and mixed well. The tube was
incubated in ice for 30 min. The cells were given a heat shocked at 42oC for 2min and were again
incubated on ice for 3min. 0.9ml of freshly prepared LB was added and incubated at 37oC with
gentle shaking. Then an aliquot of the expressed culture was plated on to a selective medium
containing ampicillin (100 μg/ml), IPTG (0.1mM/ml), 0.6% CMC and incubated at 37oC
incubator for 16 hr and the transformants were scored (Sambrook and Russel, 2003). The
recombinant colonies were subcultured on ampicillin plates for further screening.
2.2.9 Screening and selection of transformants by congo-red method
Congo red overlay technique (Teather and Wood, 1982) was used for screening and
selection of recombinant E. coli clones that have cellulase gene coding sequence. The positive
clones were selected by measuring their cellulase activity by cellulose hydrolysis assay. The
assay was performed in 25ml flask with 1x1 cm filter paper suspended in 5ml of 50mM sodium
acetate buffer (pH-4.8), to which the crude cellulase enzyme preparation (culture supernatant)
solution was added. The mixture was incubated at 450C for overnight in a shaking water bath
adjusted to 150 rpm. After incubation reducing sugar content in the supernatant was analysed by
dinitrosalicylic acid method (Ghose, 1987).
2.2.10 Restriction analysis of cellulase gene clones
Plasmids DNA from positive clones were isolated by alkaline lysis method (Sambrook
and Russel, 2003). The isolated plasmid was purified and restricted with BamHI enzyme. The
![Page 9: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/9.jpg)
BamHI digested cellulase gene clones were analysed on 0.7% agarose gel along with BamHI
digested plasmid pET20b(+) and a molecular weight marker DNA. The size of the cellulase gene
insert was studied.
2.2.11 DNA sequencing
DNA sequencing was done through commercial DNA sequencing services (MWG,
Bangalore) as follows; the cycle sequencing reaction was performed using BigDye terminator
V3.1 cycle sequencing Kit containing AmpliTac DNA polymerase (from Applied Biosystems).
The sequencing reaction - mix was prepared by adding 1μl of BigDye v3.1, 2μl of 5x sequencing
buffer and 1μl of 50% DMSO. To 4µl of sequencing reaction mix was added 4 Pico moles of
primer (2μl) and sufficient amount of plasmid. The constituted reaction was denatured at 95°C
for 5 min. Cycling began with denaturing at 95°C for 30 sec, annealing at 52°C for 30 seconds
and extension for 4 min at 60°C and cycle repeated for a total 30 cycles in a MWG thermocycler.
The reaction was then purified on sepheadex plate (Edge Biosystems) by centrifugation to
remove unbound labelled and unlabelled nucleotides and salts. The purified reaction was loaded
on to 96 capillary ABI 3700 DNA analyzer and electrophoresis was carried out for 4 hr and the
sequence was read through automated DNA sequencing system.
![Page 10: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/10.jpg)
2.3 Results
2.3.1 Cloning of cellulase gene in pET 20b(+)
The genomic DNA of E. cloacae, P. mirabilis, P. fluorescens, P. aeruginosa and
K.. pneumoniae were isolated by standard method (Sambrook and Russel, 2003). Plasmid pET
20b (+) was isolated by alkaline denaturation method. Both genomic DNA and pET20b (+)
plasmids were restricted with BamHI enzyme. The restricted fragments were ligated with
T4DNA ligase and the ligated DNA was confirmed by gel electrophoresis. The ligated DNA was
transformed into E. coli strain DH5α competent cells by CaCl2 method competent cell
transformation. The transformation efficiency was found as 103 transformants/ μg plasmid DNA.
2.3.2 Screening and selection of transformants
The transformants were selected on selective agar plates containing ampicillin (100
µg/ml) and CMC (0.6% w/v). The transformants forming clear zone around the colony during
Congored overlay method were further selected (Figs. 15 to 19). Efficient cellulase expressing
clones were further selected by cellulose hydrolysis method. The total cellulase enzyme activity
of selected clone is tabulated (Table 7 and Fig. 20). The number of cellulolytic clones in each
cloning experiments varied with bacteria. The number of cellulolytic clones obtained from
E. cloacae, P. mirabilis, P. fluorescens, P. aeruginosa and K. pneumoniae were 123, 101, 93, 67
and 53 respectively.
2.3.3 Restriction analysis
The plasmid DNA of transformants showing higher cellulolytic activity were isolated and
restricted with BamHI enzyme. The sizes of the insert DNA in each cellulolytic clone in the
genomic DNA library were determined by restriction analysis. The size of the insert were as
follows: pET-cel-Ec cellulase gene insert from E. cloacae (2.25kb) (Fig. 21), pET-cel-Pa
cellulase gene insert from P. aeruginosa (3 kb) (Fig. 22), pET-cel-Pf cellulase gene insert from
![Page 11: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/11.jpg)
P. fluorescens (2.7 kb) (Fig. 23), pET-cel-Kp cellulase gene insert from K. pneumoniae (1.3 kb)
(Fig. 24) and pET-cel-Pm cellulase gene insert from P. mirabilis (1.3kb) (Fig. 25). The gene
cloning strategy used for cloning cellulase gene is explained in figure (26). The positive
cellulolytic clones selected from the cellulolytic bacteria were named based on their bacterial
origin. Accordingly recombinant pET20b(+) plasmid with the cellulase gene inserts from
E. cloacae was named as pET-cel-Ec, P. mirabilis was named as pET-cel-Pm, P. fluorescens was
named as pET-cel-Pf, P. aeruginosa was named as pET-cel-Pa and K. pneumoniae was named
as pET-cel-Kp.
2.3.4 Sequencing of cellulase gene
The cellulase gene clones such as pET-cel-Ec, pET-cel-Pa, pET-cel-Pm, pET-cel-Pf and
pET-cel-Kp were sequenced by automated sequencing and the sequences were analysed through
BLAST software. The cellulase gene sequences from the above five cellulolytic bacteria were
deposited in NCBI database. The accession numbers of the cellulase gene sequences are as
follows pET-cel-Ec is GQ368735, pET-cel-pf is HM235919, pET-cel-Kp is HM235918, pET-
cel-Pa is GQ872426 and pET-cel-Pm is HM235922. The cellulase gene cloned from
Enterobacter cloacae has a coding sequence of 1083 nucleotide, gene from P. mirabilis has a
coding sequence of 1196 nucleotide, gene from P. fluorescens has a coding sequence of 1104
nucleotide, gene from P. aeruginosa has a coding sequence of 2883 nucleotide and gene from K.
pneumoniae has a coding sequence of 1196 nucleotide. The nucleotide and amino acid sequences
of insert DNAs of the above five clones are given (Figs. 27 to 46).
![Page 12: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/12.jpg)
Fig. 15 Screening of recombinant clones from Enterobacter cloacae on cellulose supplemented
agar
Fig. 16 Screening of recombinant clones from Proteus mirabilis on cellulose supplemented agar
![Page 13: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/13.jpg)
Fig. 17 Screening of recombinant clones from Pseudomonas fluorescens on cellulose
supplemented agar
Fig. 18 Screening of recombinant clones from Pseudomonas aeruginosa on cellulose
supplemented agar
![Page 14: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/14.jpg)
Fig. 19 Screening of recombinant clones from Klebsiella pneumoniae on cellulose supplemented
agar
![Page 15: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/15.jpg)
Table 7 Total cellulase activity of cellulase gene clones
TransformantsFilter paper
activity (FPU/ml)Endoglucanase
activity (CMC/ml)Cellobiase (CB/ml)
pET-cel- Ec 0.171±0.09 8.68±0.02 2.7±0.05
pET-cel-Pf 0.146±0.01 5.77±-0.03 2±0.012
pET-cel-Pa 0.171±0.02 3.49±0.01 1.4±0.02
pET-cel-Kp 0.091±0.03 3.3±0.04 1.34±0.01
pET-cel-Pm 0.159±0.05 2.53±0.06 1.01±0.03
E. coli (pET20b(+)) 0 0 0
Fig. 20 Exoglucanase, endoglucanase and cellobiase activity of cellulase gene clones
0
1
2
3
4
5
6
7
8
9
10
pET-
cel-
Ec
pET-
cel-
Pf
pET-
cel-
Pa
pET-
cel-
Kp
pET-
cel-
Pm
E. c
oli
(pE
T20b
(+)
Cellulase gene clones
Tot
al c
ellu
lase
en
zym
e ac
tivi
ty
Filter paper activity (FPU/ml)
Endoglucanase activity (CMC/ml)
Cellobiase (CB/ml)
![Page 16: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/16.jpg)
Fig. 21 Restriction analysis of cellulase gene cloned from Enterobacter cloacae
Lanes:
1. BamH1 digested pET-cel-Ec clone
2. Molecular weight marker (1Kb ladder)
3. BamH1 digested pET20b(+) plasmid vector
![Page 17: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/17.jpg)
Fig. 22 Restriction analysis of cellulase gene cloned from Pseudomonas aeruginosa
Lanes:
1. BamH1 digested pET-cel-Pa clone
2. Molecular weight marker(1Kb ladder)
3. BamH1 digested pET20b(+) plasmid vector
![Page 18: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/18.jpg)
Fig. 23 Restriction analysis of cellulase gene cloned from Pseudomonas fluorescens
Lanes:
1. BamH1 digested pET-cel-Pf clone
2. Molecular weight marker(1Kb ladder)
3. BamH1 digested pET20b(+) plasmid vector
![Page 19: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/19.jpg)
Fig. 24 Restriction analysis of cellulase gene cloned from Klebsiella pneumonia
Lanes: 1. Molecular weight marker(1Kb ladder)
2. BamH1 digested pET20b(+) plasmid vector
3. BamH1 digested pET-cel-Kp clone
![Page 20: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/20.jpg)
Fig. 25 Restriction analysis of cellulase gene cloned from Proteus mirabilis
Lanes:
1. BamH1 digested
pET-cel-Pm clone
2. Molecular weight
marker(1Kb ladder)
3. BamH1 digested
pET20b(+) plasmid
vector
Fig. 26 General strategy
used for cloning of
cellulase gene from
![Page 21: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/21.jpg)
cellulolytic bacteria
![Page 22: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/22.jpg)
![Page 23: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/23.jpg)
Fig. 27 Nucleotide sequence of insert DNA in pET cel Ec (GQ368735) cloned from
Enterobacter cloacae strain JV
GGATCCTTATTCTGCACGGGCGATTACAGGGCAGCGAGCGTGAAACCTCGATTGGTCTGACGAAAGA
TAAGCAGGGCGACAGCAAAGTGCGCATCGACGGCACTGACGGGCACAAAGTCGCTGAGCTGGCTTTA
TTGATGCCGATGCAACTGATTACGCCTGAGGGATTTACATTACTCAACGGCGGCCCCAAATACAGAAG
AGCATTCCTTGATTGGGGATGTTTTCACAACGAAGCGGGTTTCTTTAACGCCTGGAGCAATCTCAAGCG
ACTGCTCAAACAGCGCAATGCCGCGCTGCGACAGGTCACCCGTTACGCTCAGGTGCGCCCGTGGGATA
TGGAACTGGTCCCCCTTGCGGAGCAAATTAGCCGCTGGCGCGCCGAATACAGCGCAGGTATTGCTGAA
GATATGGCGGATACCTGCAAACAATTTCTACCCGAGTTTTCTCTCACCTTCTCCTTCCAGCGTGGCTGG
GAGAAAGAGACGGATTATGCCGAAGTGCTGGAGAGAAGCTTCGAACGCGATCGCATGCTGACCTATA
CCGCGCACGGCCCACACAAAGCGGACTTCCGCATTCTCACCCGTGAAAGCGGGCGGCGCTGTCTGTAT
CTGATAGATGATTTTGCCTCGGAACTCGACGACGCACGGCGCGGACTGCTTGCCAGCCGCTTAAAAGC
CACGCAGTCGCAGGTTTTCGTCAGCGCCATTAGCGCTGAACACGTTCTGGACATGTCGGACAAAAATT
CGAAGATGTTCACCGTGGAAAAGGGTAAAATAACGGATTAACCCAAGAATAAATGAGCGTTCGTGCC
GACGGCGCACCGGTCGAAGATACCTTGTCGCGCGGACAGCTCAAACTCCTGATGTGCGCGCTGCGTTT
GGCGCAGGGGGAGTAGAAACGTTGATGGTCGCACTGGTCCTGGCGGCAGCGAATGCGCGTGCGGCCT
GTAGCTGGCCCGCGTGGGAGCAGTTTAAACAGGACTACATCAGCGATGGCGGGCGCGTGATTGATCCC
AGTGACGCGCGGAAAATCAGCACTTCGGAAGGGCAAAGCTATGCGCTGTTCTTTGCCCTGGCCGCCAA
CGATCGCAAAGCGTTCGATTTACTGCTGACCTGGACGAGCGACAATCTCGCCCAGGGCTCCCTGAGTC
AGCATCTGCCTGCCTGGTTGTGGGGGAAAAAGGATGCGGATACCTGGGCGGTGATCGACAAAAACTCT
GCGTCTGATGCGGATATCTGGATTGCCTGGTCGTTGCTGGAAGCGGGGCGTTTGTGGAAAGCGCCGCA
ATACACCGCCACCGGCAAAGCACTGCTAAAACGCATCGCCAGCGAAGAAGTGATCAAAGTGCCGGGT
TTAGGGCTGATGCTCCTGCCCGGCAACGTCGGTTTTACCGAGGAGAAAGCCTGGCGCTTTAACCCCAG
CTATCTCCCGCCGCAGCTGGCGAACTATTTCACCCGCTTTGGCGCGCCGTGGACCACGCTTCGCGAGAC
GAATCTGCGTTTACTGCTGGAAACCGCGCCAAAAGGATTTGCGCCCAACTGGGTGCAGTATCAGCAAA
AAAAAGGCTGGCAATTGCAGCCAGAAAAAACCTTTATCGGCAGTTACGACGCGATTCGCGTGTATCTC
TGGACGGGCATGATGCACGACCGCGATCCGCAAAAAGCCCGACTGCTGGCACGTTTTAAACCGATGGC
GACGCTCACAACAAAAAATGGCGTCCCGCCGGAGAAGGTCGATGTCGCAAGCGGTAAACCCACAGGC
GATGGCCCGGTCGGTTTCTCCGCCTCGCTGCTGCCTTTTTTACAGGACCGTGATGCACAAGCGGTGCAA
CGCCAGCGCGTCGCCGACCATTTTCCCGGCAATGACGCCTATTACAGCTACGTGCTGACCCTGTTCGGA
CAAGGATGGGATCAGCATCGTTTTCGCTTCACCGCAAAGGGTGAATTACACCCTGACTGGGGCCAGGA
ATGCGCAAGTTCTCATTAAACGTGCTGGATGTGTTGAATGCGCTGAAATGCGAGAACGTTCGCATTCT
GCTGACCGATTCTGTTTCAAGCGTGCAGATTGAAGATGCGGCTAGCCAAAGTGCAGCCTACGTCGTCA
TGCCAATGCGCCTCTAGTGGAAAATATCGGGCTATCTTACTTGCCATTTTCAACCTGGGCTGTGCTCGC
CCCTGTCACGTACTCCGTGTACGCTCCAGGGTCTGCGCGCAGTCCGCGTTGAAACTGGCTGCGCCGATT
ACGCCCTGGATCTCTGGATCAATGTACTGATATATGTCACTGACGCGCCTTCTCATCAAGGATCC
Insert Size 2,309bp
Coding region 1,083bp
Promoter
Cellulase gene coding region
![Page 24: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/24.jpg)
Fig. 28 Restriction map of cellulase gene containing DNA cloned from Enterobacter cloacae strain JV
![Page 25: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/25.jpg)
Fig. 29 Deduced amino acid sequence of cellulase gene cloned from Enterobacter cloacae strain JV
MVALVLAAANARAACSWPAWEQFKQDYISDGGRVIDPSDARKISTSEGQSYALFFALAANDRKAFDLLLT
WTSDNLAQGSLSQHLPAWLWGKKDADTWAVIDKNSASDADIWIAWSLLEAGRLWKAPQYTATGKALLK
RIASEEVIKVPGLGLMLLPGNVGFTEEKAWRFNPSYLPPQLANYFTRFGAPWTTLRETNLRLLLETAPKGFA
PNWVQYQQKKGWQLQPEKTFIGSYDAIRVYLWTGMMHDRDPQKARLLARFKPMATLTTKNGVPPEKVD
VASGKPTGDGPVGFSASLLPFLQDRDAQAVQRQRVADHFPGNDAYYSYVLTLFGQGWDQHRFRFTAKGE
LHPDWGQECASSH
![Page 26: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/26.jpg)
Fig. 30 Restriction map of plasmid pET cel Ec having cellulase gene containing DNA cloned from Enterobacter cloacae strain JV
![Page 27: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/27.jpg)
Fig. 31 Nucleotide sequence of insert DNA in pET cel Pf (HM235919) cloned from Pseudomonas fluorescence strain JV
GGATCCCGGCCAGACGGTCTACGGGACCGACTTCATTGCCGATAAGGTGGATTATCTGGACACCAAG
GCACCAGGCGGGTCAAATCAGGAATAAGGGCACATTGCCCCGGCGTGAGTCGGGGCAATCCCGCAAG
GAGGGTATGATTAACCGCAGCGTGCTGAAAATTCCGGCGCTGGTGACCCCGCTGGTGCAGGCGCTGGT
GCTGGTGGGCGGCACCCTGGGCGTGGCGCAGGCGGAAGTGGGCAACCCGCGCGTGAACCAGCTGGGC
TATATTCCGAACGGCGATCGCATTGCGGTGTATAAAGCGAGCAACAACAGCGCGCAGACCTGGCAGCT
GACCCATAACGGCAGCCTGATTGCGAGCGGCCAGACCATTCCGAAAGGCAGCGATGCGAGCAGCGGC
GATAACATTCATCATATTGATCTGAGCAGCGTGACCGCGACCGGCAGCGGCTTTACCCTGACCGTGGG
CGGCGATAGCAGCTATCCGTTTAGCATTAGCAGCACCACCTTTAACGCGGCGTTTTATGATGCGCTGA
AATATTTTTATCATAACCGCAGCGGCATTGCGATTGAAACCCCGTATACCGGCGGCGGCCGCGGCAGC
TATGCGAGCCATAGCCGCTGGAGCCGCCCGGCGGGCCATCTGAACCAGGGCGCGAACAAAGGCGATA
TGAACGTGCCGTGCTGGAGCGGCACCTGCAACTATAGCCTGAACGTGACCAAAGGCTGGTATGATGCG
GGCGATCATGGCAAATATGTGGTGAACGGCGGCATTAGCGTGTGGACCCTGCTGAACCTGTATGAACG
CGCGCAGCATATTACCGGCAACCTGGCGGCGGTGGCGGATGGCAGCATGAACATTCCGGAAAGCGGC
AACGGCGTGGCGGATATTCTGGATGAAGCGCGCTGGCAGATGGAATTTATGCTGGCGATGCAGGTGCC
GCAGGGCCAGGCGAAAGCGGGCATGGCGCATCATAAAATTCATGATGTGGGCTGGACCGGCCTGCCG
CTGGCGCCGCATGAAGATCCGCAGCAGCGCGCGCTGGTGCCGCCGAGCACCGCGGCGACCCTGAACC
TGGCGGCGACCGCGGCGCAGGCGGCGCGCATTTGGAAAGATATTGATGCGGGCTTTGCGGCGCTGTGC
CTGACCGCGGCGGAACGCGCGTGGAACGCGGCGCAGGCGAACCCGAACGATATTTATAGCGGCAACT
ATGATAACGGCGGCGGCGGCTATGGCGATCGCTTTGTGGCGGATGAATTTTATTGGGCGGCGGCGGAA
CTGTATATTACCACCGGCGATAGCCGCTATCTGCCGACCATTAACAACTATACCCTGGAACGCACCGA
TTTTGGCTGGCCGGATACCGAACTGCTGGGCGTGATGAGCCTGGCGGTGGTGCCGGCGACCCATACCA
ACAGCCTGCGCATTGCGGCGCGCAACCATATTCAGACCATTGCGAGCACCCATCTGACCACCCAGAGC
GCGAGCGGCTATCCGGCGCCGCTGAGCAGCCTGGAATATTATTGGGGCAGCAACAGCGTGATTGCGA
ACAAACTGGTGCTGATGGGCCTGGCGTATGATTTTAGCGGCAACCAGAACTTTGCGCTGGGCGTGAGC
AAAGGCATTAACTATCTGTTTGGCATTAACGTGCTGCCGACCAGCTTTATTACCGGCCTGGGCACCAAC
ACCGTGGCGCAGCCGCATCATCGCTTTTGGGCGGGCGCGCTGAACAGCAACTATCCGTGGGCGCCGCC
GGGCGCGCTGAGCGGCGGCCCGAACGCGGGCCTGGAAGATAGCTTTAGCGCGAGCCGCCTGAGCGGC
TGCACCAGCCGCCCGGCGACCTGCTGGCTGGATAGCATTGATGCGTGGAGCACCAACGAAATTACCAT
TAACTGGAACGCGCCGCTGGCGTGGGTGCTGGGCTTTTATAACGATTTTGCGGCGACCCAGGGCGGCA
GCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCGTGCCGGTGAGCAGCAGCAGCAGCAGCAGCATTAT
TCCGAGCAGCAGCAGCAGCAGCATTCAGCCGAGCAGCAGCAGCAGCAGCATGCCGAGCAGCAGCAGC
AGCAGCAGCAGCGTGGTGGCGAGCAGCAGCAGCAGCGTGAGCGGCGGCCTGCGCTGCAACTGGTATG
GCACCCTGTATCCGCTGTGCGTGACCACCCAGAGCGGCTGGGGCTGGGAAAACAGCCAGAGCTGCATT
AGCGCGAGCACCTGCAGCGCGCAGCCGGCGCCGTATGGCATTGTGGGCGCGGCGAGCAGCAGCAGCC
AGGCGGCGAACCGCAGCCCGACCCTGCAGCTGAGCGCGAACGCGACCGGCTTTGAAGGCGGCAGCAT
GGTGTGCTGCACCCTGCATATTAACGGCGCGGCGAGCGATCCGGATGGCGATAACCTGACCTATAGCT
![Page 28: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/28.jpg)
GGCAGGTGATTAGCGGCAACACCGTGGTGGCGAGCGGCAGCAGCAGCAGCGCGAGCATTCATGTGAG
CAACCAGCGCGGCTATGAAGTGAGCATGACCGTGAGCGATGGCCGCGGCGGCGTGGCGACCGAAACC
ACCTTTGTGAGCGTGTATTTTAGCGATTATTTTCCGGGCAGCAGCAGCAGCGCGAGCAACATTAACAG
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCGCGATTGTGAGCAGCAGCAGCAGCGTGGTGAGC
AGCAGCAGCAGCAGCGCGGCGAGCGGCGGCAACTGCCAGTATGTGGTGACCAACCAGTGGAACAACG
GCTTTACCGCGGTGATTCGCGTGCGCAACAACGGCAGCAGCGCGATTAACCGCTGGAGCGTGAACTGG
AGCTATAGCGATGGCAGCCGCATTACCAACAGCTGGAACGCGAACGTGACCGGCAACAACCCGTATG
CGGCGAGCGCGCTGGGCTGGAACGCGAACATTCAGCCGGGCCAGACCGCGGAATTTGGCTTTCAGGG
CACCAAAGGCGCGGGCAGCCGCCAGGTGCCGGCGGTGACCGGCAGCGTGTAAGTTTTCCGCCGAGGA
TGCCGAAACCATCGCAAGCCGCACCGTCATGCGTGCGCCCCGCGAAACCTTCCAGTCCGTCGGCTCGA
TGGTCCAGCAAGCTACGGCCAAGATCGAGCGCGACAGCGTGCAACTGGCTCCCCCTGCCCTGCCCGCG
CCATCGGCCGCCGTGGAGCGTTCGCGTCGTCTCGAACAGGAGGCGGCAGGTTTGGGGATCC
Insert Size 3,235bp
Coding region 2,883bp
Promoter
Cellulase gene coding sequence
![Page 29: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/29.jpg)
Fig. 32 Restriction map of cellulase gene containing DNA cloned from Pseudomonas fluorescence strain JV
![Page 30: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/30.jpg)
Fig. 33 Deduced amino acid sequence of cellulase gene cloned from Pseudomonas fluorescence
MINRSVLKIPALVTPLVQALVLVGGTLGVAQAEVGNPRVNQLGYIPNGDRIAVYKASNNSAQTWQLTHNG
SLIASGQTIPKGSDASSGDNIHHIDLSSVTATGSGFTLTVGGDSSYPFSISSTTFNAAFYDALKYFYHNRSGIAI
ETPYTGGGRGSYASHSRWSRPAGHLNQGANKGDMNVPCWSGTCNYSLNVTKGWYDAGDHGKYVVNGG
ISVWTLLNLYERAQHITGNLAAVADGSMNIPESGNGVADILDEARWQMEFMLAMQVPQGQAKAGMAHH
KIHDVGWTGLPLAPHEDPQQRALVPPSTAATLNLAATAAQAARIWKDIDAGFAALCLTAAERAWNAAQA
NPNDIYSGNYDNGGGGYGDRFVADEFYWAAAELYITTGDSRYLPTINNYTLERTDFGWPDTELLGVMSLA
VVPATHTNSLRIAARNHIQTIASTHLTTQSASGYPAPLSSLEYYWGSNSVIANKLVLMGLAYDFSGNQNFAL
GVSKGINYLFGINVLPTSFITGLGTNTVAQPHHRFWAGALNSNYPWAPPGALSGGPNAGLEDSFSASRLSGC
TSRPATCWLDSIDAWSTNEITINWNAPLAWVLGFYNDFAATQGGSSSSSSSSSSSVPVSSSSSSSIIPSSSSSSI
QPSSSSSSMPSSSSSSSSVVASSSSSVSGGLRCNWYGTLYPLCVTTQSGWGWENSQSCISASTCSAQPAPYGI
VGAASSSSQAANRSPTLQLSANATGFEGGSMVCCTLHINGAASDPDGDNLTYSWQVISGNTVVASGSSSSA
SIHVSNQRGYEVSMTVSDGRGGVATETTFVSVYFSDYFPGSSSSASNINSSSSSSSSSSSSAIVSSSSSVVSSSS
SSAASGGNCQYVVTNQWNNGFTAVIRVRNNGSSAINRWSVNWSYSDGSRITNSWNANVTGNNPYAASAL
GWNANIQPGQTAEFGFQGTKGAGSRQVPAVTGSV
![Page 31: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/31.jpg)
Fig. 34 Restriction map of plasmid pET cel Pf having cellulase gene containing DNA cloned from Pseudomonas fluorescence strain JV
![Page 32: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/32.jpg)
Fig. 35 Nucleotide sequence of insert DNA in pET cel Kp (HM235918) cloned from Klebsiella pneumoniae strain JV
GGATCCTGAAGGGACATGCTGCTGTCGCGCGGAAACAACTACACGCGGCTGGCCACTGCCCCCCTAT
AACATTCCTTCTTTAAAAAATCCGGCCGGCGCCGGAGGCTTTCGCACGCCTGTTGGCCGGCTACTACGT
ATATATAAGCTCTGTATGGGATCCCGACTCGGATCTGTGGATAGCCTGGGCGCTGCTGGATGAAAGTA
CTTTGTGGCGCGGTGCTCTCCGCGCTACTGCTGGCGGCGGGTCCGGTGAGCGCCGCCTGCCAGTGGCC
CGCCTGGGAGCAGTTCAAAAAAGCGTACGTCAGCCCTGAGGGACGGGTGATTGACCCCAGCGATGCG
CGCAAAATCTCCACCTCGGAAGGACAGAGCTATGGCCTGTTTTTCGCCCTGGCCGCCAACGATCGCGC
AGGGTTCGACAAACTGCTTACCTGGACGCAGAACAACCTGGCGGAAGGCGACCTGCGGCAGCATCTG
CCGGGCTGGCTGTGGGGCAAAAAGGACGATGAGCAGTGGACGTTGCTGGACAGCAACTCGGCCTCCG
ACTCGGATCTGTGGATAGCCTGGGCGCTGCTGGAGGCGGGGCGCCTGTGGCAGCAGCCGCAGTACACC
GAGACCGGAAAAGCGCTGCTGGCGCGGATTGTCGAGGAAGAGACGTGGCGGTACCCGGCCTTGGCAC
GATGCTGCTGCCGGGAAAAGTCGGTTTTGCCGATGACAGCGGCTGGCGGTTTAACCCCAGCTATCTTC
CGCCGCAGCTGGCCACCTACTTTGTGCGTTTTGGCGCGCCGTGGCCTGCCCTGCGCGACAGCAACCTGC
GCCTGCTGCTGGAGACCGCGCCGAAAGGCTTTACCCCGGACTGGGTGCGCTATGAGAAAGGGAAGGG
CTGGCAGCTGAAAACCGAAAAGCCGCTGATCGGCAGCTATGACGCGATTCGCGTCTATCTGTGGGTGG
GCATGCTCCATGATGGCGATAAGCAGAAAGCGCGCCTGCTGCAACGCTTCGCGCCGATGGCGGCGCA
GACCACGGAGCAGGGGGTGCCGCCGGAGAAAGTGAATATCGCCACCGGCAAAACCAGCGGCCAGGG
GCCCGTGGGCTTCTCCGCGGTGATGCTACCGTTTTTACAGGACGACGAGGCCCGGTCAGTGCAACGCC
AGCGCGTCGCCGATAACTATCCCGGCGCGGATGCCTACTACAGTGCAGTTCTGACGCTGTTCGGCCAG
GGTTGGGATCAACACCGTTTTCGTTTCACTGCGGGTGGCGAATTACAACCTGACTGGAACCAGGAATG
CGCAAGCTCTCACTAAGCGTCTATCTGTGGGTGGGCATGCTCCATGATGGCGAGGATCCATTTGCCTAT
TAAAACGGGATCC
Insert Size 1,339bp
Coding region 1,172bp
Promoter
Cellulase gene coding sequence
![Page 33: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/33.jpg)
Fig. 36 Restriction map of cellulase gene containing DNA cloned from Klebsiella pneumoniae strain JV
![Page 34: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/34.jpg)
Fig. 37 Deduced amino acid sequence of cellulase gene cloned from Klebsiella pneumoniae strain JV
MGSRLGSVDSLGAAGKYFVARCSPRYCWRRVRAPPASGPPGSSSKKRTSALRDGLTPAMRAKSPPRKDRA
MACFSPWPPTIAQGSTNCLPGRRTTWRKATCGSICRAGCGAKRTMSSGRCWTATRPPTRICGPGRCWRRG
ACGSSRSTPRPEKRCWRGLSRKRRWRYPALARCCCREKSVLPMTAAGGLTPAIFRRSWPPTLCVLARRGLP
CATATCACCWRPRRKALPRTGCAMRKGRAGSKPKSRSAAMTRFASICGWACSMMAISRKRACCNASRR
WRRRPRSRGCRRRKISPPAKPAARGPWASPRCYRFYRTTRPGQCNASASPITIPARMPTTVQFRCSARVGIN
TVFVSLRVANYNLTGTRNAQALTKRLSVGGHAPWRGSI
![Page 35: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/35.jpg)
Fig. 38 Restriction map of plasmid pET cel Kp cellulase gene containing DNA cloned from Klebsiella pneumoniae strain JV
![Page 36: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/36.jpg)
Fig. 39 Nucleotide sequence of insert DNA in pET cel Pa (GQ872426) cloned from Pseudomonas aeruginosa strain JV
GGATCCTCCCTTATAAATATTATTTGTCCTGCTGGGCGGTATTCGCTGGTTGTTTTCAGCATATTAATAA
TAAAACCGCCTCCTCCTCGATGACGCCGTTTTCAACCAGAGGGATCGGCCTTTGAGCGAGCCATTATCA
ATATAAAAATGTGGTGACGAGGGAGACAGTGAGTTTGGTTTTGAGCGGGCTTGACGGAGTCTTTGCCCT
GTTCAGAAGCGGCGACCGCTATGTTGTTGCGGTCATTTCACGTCTGTTGTAAAGCCAAGTTTATTCTTTA
GCAACTTGTGCCTTGGCAGTCACCATAATAATTGAGGATTGAATAATGGGACATGTTACATCTCCCTCT
AAACGCTATCCTGCCTCTTTTAAGCGGGCAGGTAGTATTCTTGGCGTGAGTATTGCGCTTGCTGCATTTT
CCAATGTGGCAGCAGCGGGTTGTGAGTATGTGGTTACCAATAGCTGGGGGTCGGGATTTACCGCAGCAA
TTCGTATTACTAACTCAACATCTTCTGTAATCAATGGTTGGAACGTCAGCTGGCAATATAACAGCAACC
GTGTTACCAACTTATGGAATCCCAACCTTTCCGGTAGCAATCCCTATACGGCGTCCAACCTGAGTTGGA
ATGGCACTATTCAACCTGGGCAAACGGTAGAGTTTGGTTTCCAGGGGGTTACCAATAGCGGCACTGTCG
AGAGTCCAACAGTGAATGGTGCTGCATGTACTGGCGGAACCAGTTCTTCGGTGAGTTCTTCCAGTGTTG
TGAGTTCAAGCTCGTCATCGCGTAGCAGTGTGTCTTCAAGCTCTGTTGTGTCCTCAAGCTCCAGCGTAGT
GAGUTCATCGTCTTCCTCTGTGGTCAGCGGCGGCGGCCAGTGTAATTGGTATGGAACCCTGTATCCGTT
GTGTGTGAGCACAACCTCTGGTTGGGGTTACGAAAACAACAGAAGCTGTATCTCTCCATCAACCTGTTC
GGCCCAGCCGGCGCCTTATGGGATTGTCGGGGGCTCGAGCTCGCCCAGCTCAATTTCCAGTTCAAGCGT
CCGCTCCAGCAGCTCGTCTTCTGTAGTACCGCCTAGCAGTAGCTCATCTTCCAGTGTTCCATCAAGCAGC
TGTTCCAGTGTTAGCTCCAGCTCGGTTGTCTCTTCCAGTTCATCTTCTGTGAGTGTGCCCGGAACCGGTG
TGTTCCGTGTTAATACTAAGGGTAACCTGACGAAAGACGGTCAACTGCTGCCTGCGCGTTGCGGGAACT
GGTTTGGTTTGGAGGGGCGTCATGAGCCATCAAATGATGCCGATAACCCCAGCGGTGCGCCAATGGAGT
TGTATGCGGGTAACATGTGGTGGGTGAATAACAGCCAAGGTTCCGGTCGCACCATTCAGCAGACTATGA
CTGAGTTGAAGCAGCAGGGTATTACTATGTTGCGTCTGCCAATTGCACCGCAAACCCTGGATGCAAATG
ACCCGCAAGGTCGCAGTCCAAACCTCAAAAACCATCAATCCATTCGTCAATCCAACGCGCGTCAAGCAT
TGGAGGATTTCATCAAACTGGCTGATCAAAATGACATCCAGATCTTTATTGATATCCACTCCTGCTCTAA
TTACGTTGGTTGGCGGGCCGGTCGTTTGGATGCCCGTCCGCCCTATGTGGATGCGAATCGCGTTGGTTAC
GACTTCACTCGTGAAGAGTATTCCTGTTCUGCTACCAATAACCCCAGTTCTGTTACCAGGTTCCATGCTT
ACGATAAGCAGAAGTGGTTGGCAAACCTGCGTGAAATCGCCGGACTATCCGCCAAGCTGGGGGTAAGT
AACCTGATTGGTATTGATGTCTTCAATGAGCCTTATGATTACACTTGGGCAGAATGGCAGGGTATGGTT
GAAGAGGCCTATCAGGCGATCAATGAAGTTAACCCCAATATGCTTATTATCGTTGAAGGTATTTCCGCC
AATGCTAATACGCAAGATGGAACACCTGACACATCCGTACCTGTGCCACACGGTAGCACCGACTTGAAT
CCAAACTGGGGTGAAAACCTCTACGAAGCGGGTGCTAACCCACCCAACATTCCCAAGGATCGCCTGTTG
TTCTCTCCACACACTTATGGTCCGTCCGTGTTTGTTCAAAGACAATTCATGGAACCGGCGCAGACAGAG
TGTGCAGGGCTGGAAGGTGATGAAGCAGCTCAGGCCAGGTGCGGTATTGTGATTAATCCGACCGTGCTT
GAGCAAGGTTGGGAAGAGCACTTTGGCTATCTGCGTGAATTGGGTTACGGTATTTTGATTGGTGAATTT
GGCGGTAATATGGATTGGCCTGGTGCCAAGTCGAGCCAGGCTGACCGTAATGCCTGGAGCCATATCACC
ACCAACGTTGACCAGCAATGGCAACAGGCGGCGGCAAGCTATTTCAAGAGGAAAGGGATAAATGCTTG
CTACTGGTCGATGAACCCTGAATCAGCAGATACCATGGGTTGGTATTTAACTCCCTGGGATTCAGTGAC
TGCCAACGATATGTGGGGTCAGTGGACAGGTTTCGATCCTCGTAAAACCCAGCTGTTGCACAATATGTG
GGGTTTGTAATTTACCCGCGATTGTGACTTAGCATAAAAAAACCGGGGCTTTTCAGGCCCCGGTTTTTTT
ATGGTTTTGGGTAGCGATATTTATTTCAGATGGCCAAGGTTTTTTTGCACGATTTGCAGGATAGGTTTAA
ACACCTTGGGTGAACCACAGACGACATGGCCAGTATCCAAAAAGGATCC
Insert Size 2,247bp
Coding region 2,749bp
![Page 37: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/37.jpg)
Promoter
Cellulase gene coding sequence
Fig. 40 Restriction map of cellulase gene containing DNA cloned from Pseudomonas aeruginosa strain JV
![Page 38: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/38.jpg)
Fig. 41 Deduced amino acid sequence of cellulase gene cloned from Pseudomonas aeruginosa strain JV
MGHVTSPSKRYPASFKRAGSILGVSIALAAFSNVAAAGCEYVVTNSWGSGFTAAIRITNSTSSVINGWNVS
WQYNSNRVTNLWNPNLSGSNPYTASNLSWNGTIQPGQTVEFGFQGVTNSGTVESPTVNGAACTGGTSSSV
SSSSVVSSSSSSRSSVSSSSVVSSSSSVVSSSSSSVVSGGGQCNWYGTLYPLCVSTTSGWGYENNRSCISPSTC
SAQPAPYGIVGGSSSPSSISSSSVRSSSSSSVVPPSSSSSSSVPSSSCSSVSSSSVVSSSSSSVSVPGTGVFRVNTK
GNLTKDGQLLPARCGNWFGLEGRHEPSNDADNPSGAPMELYAGNMWWVNNSQGSGRTIQQTMTELKQQ
GITMLRLI
![Page 39: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/39.jpg)
Fig. 42 Restriction map of plasmid pET cel Pa having cellulase gene containing DNA cloned from Pseudomonas aeruginosa strain JV
![Page 40: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/40.jpg)
Fig. 43 Nucleotide sequence of insert DNA in pET cel Pm (HM235922) cloned from Proteus mirabilis strain JV
GGATCCCTGGACGGCAATGTCGCTGTATCGTGAGTTTATACCCTGATGGTCATCTTGCTGATTATAACT
TAACGAGCGCATATTAATAATAAAACCGCCTCCTCCTCGATGACGCCGTTTTCAACCAGAGCGGGCTC
CAGGTATGATCTCGATTGACTCATCGACACGGCAATGTCGCTGTATCGTATGTCCATAAGACAGTTATC
TCGATTGACTCATCGACTTGGTATTTTGCTAACACTAAGTGTGATGTTAATGATATCCCCAATGACACA
AGCGACAGAAACCCAGGCAGGATGGCAACAATTTAAAGCGCGTTACATTACTCCCGAGGGGCGTGTC
ATTGACAGTGCTAATCAAAATATTTCACACTCAGAAGGCCAAGGATATGGCATGTTAATGGCGGTTAT
GAGTGACGATCGCCAAACCTTTGCACAATTATGGCACTGGACGGCAATGTCGCTGTATCGTGGTGATC
TTGGTTTATTTAAATGGCGTTATGAACCCGAAAATAACCAACATACACCCGATCCTAATAATGCAACA
GATGGTGATATTTTAATTGCTTGGGCATTATTAAAGGCTGGGGAAAAATGGCAGGACGAAAGCTATCT
TTCAGCGTCAGATTCTATTCAGCATGCGATCCTCGAACACACTTTAGTGAAGACAGAAAACTACAGTG
TACTCTTACCGGGAATTAATGGCTTTAAAACTCCCGAAGAAATTATTATTAACCCCTCCTATTTTATCTT
TCCGGCATGGAAAGATTTCTATCGAGTTAGTCATGATAGCCGCTGGAAAAACTTAATTAACGATAGCC
AATCCTTATTAAGAAAAATGCGTTTTGGTAAATATAAATTACCAAGTGATTGGGTAAGTTTATACCCTG
ATGGTCATCTTGCCCCGAGTGAAAAATGGCCAGCACGATTCAGTTTTGATGCTATTCGCATTCCTCTTT
ATTTAGCATGGGCACAAGATAAACTCGCATTACAACCTTTTGTGAATTATTGGCAACAATTCGATCGTG
ATAAGACGCCTGCGTGGATCAGTATTGATGGTAAAGAGCGCGCTGATTATAACTTAACGCCAGGTATG
ATGGCGGTAAGAGATCTGACAATGAAAACAGTAATTGAAAATGTTGATTTAACCAAGGATACGGATT
ATTACTCTTCAGCCTTACATTTATTAGCCGCCTTTGCGCAGAATAATCACAACGACTATTAACGACAGA
AACCCAGGCAGGATGGCAACTCTTTCCGGCATGGAAAGATTTCTATCGAGTTGATTATAACTTAACGC
CAGGTATGATTGGCTTTAAAAGCTATTCGCATTCCTCTTTATTTATATGGCACTGGACGGCAAGGATCC
Insert Size 1,356bp
Coding region 1,038bp
Promote
Cellulase gene coding sequence
![Page 41: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/41.jpg)
Fig. 44 Restriction map of cellulase gene containing DNA cloned from Proteus mirabilis strain JV
![Page 42: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/42.jpg)
Fig. 45 Deduced amino acid sequence of cellulase gene cloned from Proteus mirabilis strain JV
MSLYRMSIRQLSRLTHRLGILLTLSVMLMISPMTQATETQAGWQQFKARYITPEGRVIDSANQNISHSEGQG
YGMLMAVMSDDRQTFAQLWHWTAMSLYRGDLGLFKWRYEPENNQHTPDPNNATDGDILIAWALLKAG
EKWQDESYLSASDSIQHAILEHTLVKTENYSVLLPGINGFKTPEEIIINPSYFIFPAWKDFYRVSHDSRWKNLI
NDSQSLLRKMRFGKYKLPSDWVSLYPDGHLAPSEKWPARFSFDAIRIPLYLAWAQDKLALQPFVNYWQQF
DRDKTPAWISIDGKERADYNLTPGMMAVRDLTMKTVIENVDLTKDTDYYSSALHLLAAFAQNNHNDY
![Page 43: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/43.jpg)
Fig. 46 Restriction map of plasmid pET cel Pm having cellulase gene containing DNA cloned from Proteus mirabilis strain JV
![Page 44: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/44.jpg)
2.4 Discussion
Cellulase enzyme has a wide range of applications in food, animal feed, textile, fuel and
chemical industries. Other areas of application include the paper and pulp industry, waste
management, medical/pharmaceutical industry, plant protoplast production and in the treatment
of pollutants (Mandels, 1985; Beguin and Aubert, 1993; Coughlan, 1985). Bacterial cellulase
enzyme is easy to be expressed and purified from bacterial system (E. coli). Cellulase is a
complex enzyme system having exo, endo and β glucocidase. Using gene cloning strategies, it is
possible to clone genes and get their products for various applications. Utilizing them for
digesting cellulosic materials for ethanol fermentation is one of the several uses of cellulase. In
order to express the bacterial cellulase gene in ethanol fermenting bacteria, five different
cellulase genes were cloned from cellulolytic bacteria such as, E. cloacae, P. mirabilis,
P. fluorescens, P. aeruginosa and K. pneumoniae. The cellulase gene from cellulolytic bacteria
has been cloned in E. coli using pET20b(+) plasmid vector having T7 inducible promoter
(Gunasekera and Kemp, 1999). Cellulase gene clones from different cellulolytic bacteria were
screened by congored overlay method (Teather and Wood, 1982). It is a relatively straight
forward technique to screen and select a small fraction of recombinant clones which express and
secrete cellulase enzyme. With this technique cellulase gene clones were screened by overlaying
agar the medium supplemented with CMC and then incubating the plates, usually at 37°C for 24
hr. During this time, the CMC molecules that are present in the immediate vicinity of a cellulase-
producing colony are digested. To visualize the digestion of CMC the petri plate was flooded
with a solution of Congored and then with sodium chloride. The bacterial colony producing
cellulase will be surrounded by a yellow colored halo, whereas, the background will be red. The
![Page 45: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/45.jpg)
Congo Red-carboxymethylcellulose procedure has permitted researchers to isolate
endoglucanase genes that are expressed in E. coli from clone banks of Streptomyces lividians
(Shareck et al., 1987), Clostridium thermocellum (Millet et al., 1985; Beguin et al., 1987),
C. cellulolyticum (Faure et al., 1988), Thermoanaerobacter cellulolyticus (Honda et al., 1987),
Thermomonospora fusca (Hu and Wilson, 1988), Erwinia chtysanthemi (Boyer et al., 1987),
Pseudomonas fluorescens var. cellulosa (Gilbert et al., 1987; Lejeune et al., 1986), Cellvibrio
mixtus (Wynne and Pemberton, 1986), Ruminococcus albus (Ohmiya et al., 1988), Cellulomonas
uda (Nakamura et al., 1986), Bacteroides succinogenes (Crosby et al., 1984) and Bacillus
subtilis(Koide et al., 1986).
For this strategy to be effective the cloned endoglucanase gene must be expressed in the
heterologous host cell (E. coli) and secreted either into the growth medium or to the host cell
periplasm so that the substrate can be utilized. In additions to the Congo Red-overlay technique,
other methods have been employed to directly select the expression of endoglucanase gene
clones (Glick and Pasternak, 1989).
Totally more than 50 to 120 transformants were selected from each cellulolytic
bacterium by zone formation. Among the high cellulase expressing clones, pET-cel-Ec and pET-
cel-Pa, showed higher cellulase activity. The cellulase gene cloned from E. cloacae contained an
insert size 0f 2.25 kb BamHI. Sequencing of this insert revealed the presence of a 1083-bp open
reading frame (GQ368735) potentially encoding a protein with a molecular mass of 40. 33KDa.
The predicted amino acid sequence was 99–100% identical to that of the endo-1, 4-D-glucanase
of Citrobacter rodentium ICC168 (FN543502.1) and Enterobacter sp. (CP000653.1). The
cellulase gene cloned from P. fluorescens contained an insert size of 2.7 kb BamHI fragment.
Sequencing of this cloned DNA showed the presence of a 2247-bp open reading frame
![Page 46: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/46.jpg)
(HM235919) that encoded a protein with a molecular mass of 80.160 kDa. The predicted amino
acid sequence of the gene was 99% identical to that of the cellulase of Cellvibrio japonicus celC
gene for cellodextrinase C (X61299.1). The cellulase gene cloned from K. pneumoniae
contained in an insert 1.3-kb BamHI fragment. Sequencing of this insert DNA revealed the
presence of a 1107-bp open reading frame (HM174251) that potentially encoded a protein with
a molecular mass of 40.88 kDa The predicted amino acid sequence of this gene was 100%
identical to that of the cellulase of K. pneumoniae cellulase gene (HM235918.1). The cellulase
gene cloned from P. aeruginosa contained in an insert of 3 kb BamHI fragment. Sequencing of
this insert showed that the presence of a 2883-bp open reading frame (GQ872426) that
potentially encoded a protein with a molecular mass of 100.07 kDa. The predicted amino acid
sequence was 99–100% identical to that of the glycosyl hydrolase family of Teredinibacter
turnerae T7901 (CP001614.2). The recombinant cellulase producing E. coli harbored a Proteus
mirabilis derived 1.7-kb BamHI fragment. Sequencing of this insert revealed the presence of a
1053-bp open reading frame (HM235922) that potentially encoded a protein with a molecular
mass of 40.54 kDa. The predicted amino acid sequence was 100% identical to that of the putative
cellulase family of P. mirabilis (AM942759.1). The E. coli cells containing the cellulase genes
from different cellulolytic bacteria exhibited cellulase activity comparable to that of wild type
cellulolytic bacteria from which the cellulase genes were isolated. Clearing zone around the
colonies containing cellulase gene was larger than the clearing zone found in wild type colonies
of wild type of cellulolytic bacteria. High copy number (~40) of pET20b(+) might be the reason
for the higher expression of the cellulase in E. coli clones (Gunasekera and Kemp, 1999).
There are reports of cloning and sequencing of cellulase genes for various purposes. A
gene encoding cellulase was cloned from Bacillus sp. into E. coli and the nucleotide sequence
![Page 47: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/47.jpg)
was determined. The cellulase gene, designated as celS, was composed of 1,497 base pairs and
the nucleotide sequence of the celS gene was found highly homologous to those of other
B. subtilis cellulase genes. The enzyme encoded by celS was highly active on CMC (Jung et al.,
1996). The sequence coding for CMCase was isolated from the Salmonella typhimurium.
Comparison between the deduced amino acid sequence of CMCase (368 amino acid residues)
and that of the previously published CMCase revealed that this enzyme belongs to the cellulase
family. The protein was overproduced in E. coli using T7 expression system. The CelC protein
was able to degrade cellulosic substrates, such as CMC (Yoo et al., 2004).
A genomic library of Bacillus subtilis CD4 was constructed in E. coli JM83. A clone
designated as E. coli pBcelR was identified which formed blue colony in the presence of 5-
bromo-4-chloro-3-indolyl-D-galactopyranoside (X-gal) and hydrolysed carboxymethyl cellulose
(CMC). The clone E. coli (pBcelR) expressed both cellobiase and endoglucanase activities and
contained an insert of 1.2 kb. E. coli pBcelR encoded a protein of 12.9 kDa which was endowed
with bifunctional (endoglucanase and cellobiase) activities (Srivastava et al., 1999).
The maximum exoglucanase, endoglucanase and cellobiase activity of pET-cel-Ec was
observed (8.5 CMC/ml, 0.171 FPU/ml and 2.7 CB/ml) when compared to others. A similar kind
of bifunctional cellulase was described from Caldocellum sacchrolyticum (Saul et al., 1990)
which contained one catalytic domain for hydrolysis of CMC and another for 4,
methylumbelliferyl-Umbelliferyl β-D cellobioside (MUC). The bi- and multi-functional
polysaccharide hydrolases have been characterized from few microorganisms possessing
considerable levels of activities of endoglucanase, exoglucanase and/or xylanase (Hamamoto et
al., 1990; Gilkes et al., 1991). These hydrolases have been shown to possess either single or
multi-functional properties (Foong et al., 1991; Xue et al., 1992) or mono-functional catalytic
![Page 48: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/48.jpg)
domains (Saul et al., 1990; Gilbert et al., 1990). A bifunctional enzyme from Clostridium
cellulovorans has also been reported (Foong et al., 1991) of which endoglucanase and xylanase
activities were located on the same region of the gene. The multi-functional polysaccharide
hydrolases are ideally suited for genetic manipulation, as simultaneous expression of
endoglucanase and cellobiase activities should alleviate the problem of catabolic repression
which is a rate limiting step in the economics of cellulose hydrolysis. In the construction of
cellulolytic E. coli strains, the transfer of genetic information in the form of bi-functional enzyme
possessing exo, endoglucanase and cellobiase activities could overcome these problems of
coordinate expression of these three activities.
Most of the cloned genes expressed detectable cellulase activity in E. coli, and in many
cases, expression was independent from vector promoters. However, fusion of the genes with
promoters and ribosomal initiation sites from highly expressed genes in E. coli generally resulted
in considerably higher expression (Schwarz et al., 1988). Besides E. coli, cellulase genes from
Streptomyces lividans, Clostridium thermocellum Cellulomonas fimi, E. cloacae, P. fluorescens
var. cellulosa and Trichoderma reesei have also been cloned and introduced into a variety of
other hosts, such as B. subtilis (Ghangas and Wilson, 1987), Bacillus megaterium (Lee et al.,
1988), Bacillus stearothermophilus (Soutschek-Bauer and Staudenbauer, 1987), Brevibacterium
lactoJermentum (Paradis et al., 1987), Streptomyces lividans (Ghangas and Wilson, 1988),
Z. mobilis (Vasan et al., 2011; Lejeune, 1986) and S. cerevisiae (Shoemaker et al., 1984). The
choice of an alternate host was motivated by the ability to secrete proteins. Z. mobilis are
organisms that efficiently ferment simple sugars such as glucose into ethanol. They could be
used as hosts for the expression of cloned cellulase genes. The expression of active cellulase
genes would enable these organisms to directly digest cellulosic substrates such lignocellulosic
![Page 49: CLONING OF CELLULASE GENES FROM CELLULOLYTIC BACTERIAshodhganga.inflibnet.ac.in/bitstream/10603/4784/12/12_chapter 2.pdf · recombinant colonies were subcultured on ampicillin plates](https://reader030.vdocument.in/reader030/viewer/2022040909/5e81e519953eeb60f2083dfa/html5/thumbnails/49.jpg)
biomass to ethanol. In the present study Z. mobilis was used to express the cloned cellulase gene
from five different cellulolytic bacteria.