Transcript
Page 1: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health.

fairhavenhealth.com

Helping you embrace life’s important stages with confidence.

Page 2: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

2 fairhavenhealth.com (800) 367-2837

Fertility Supplements FertilAid for WomenFertilAid for MenFH PRO for WomenFH PRO for MenFH PRO Omega-3OvaBoostMyo-InositolFertileCMFertileDetoxCountBoostMotilityBoostFertiliTeaViriliTeaEvening Primrose OilMacaRoyal JellyCoQ10

Ovulation Prediction Tools OvaCue Fertility MonitorOvaCue MobileTempCue Basal ThermometerOvaGraph Fertility ChartingFertile-Focus MicroscopeDigital Basal ThermometerGlass Basal ThermometerOvulation & Pregnancy Wheel

Pregnancy & Ovulation Tests BFP Ovulation Test StripsBFP Pregnancy Test StripsBFP Midstream TestsBFP Test Combo Packs

Other Fertility Products BabyDance Fertility LubricantBend, Breathe & Conceive Fertility Yoga DVDAcupressure for Fertility DVD

Pregnancy ProductsPeapod Prenatal VitaminPeapod Omega-3Peapod Cal-Mag PregEase for Morning SicknessBabyIt Perineal Massage GelDreamBelly Stretch Mark ButterTea-for-Two Pregnancy TeaHealthy Mom, Happy Baby Prenatal Yoga DVD

Milkies Breastfeeding ProductsMilk-SaverMilk TraysFreeze Storage SystemBreast Milk Storage BagsSofties Contoured Nursing PadsBreast Pad Ever Nipple Nurture BalmSoft Cloths

Milkies Breastfeeding SupplementsNursing BlendNursing PostnatalFenugreekNursing Time Tea

Other Women’s Health ProductsIsoFresh Balancing Vaginal GelBalance Blend for Menopause

Fairhaven Health Products Following the natural progression of fertility, pregnancy, nursing and beyond.

...... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

* The statements contained within have not been evaluated by the Food & Drug Administration. These products are not intended to diagnose, treat, cure or prevent any disease.

Page 3: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

3 fairhavenhealth.com (800) 367-2837(800) 367-2837

Pregnancy ProductsPeapod Prenatal VitaminPeapod Omega-3Peapod Cal-Mag PregEase for Morning SicknessBabyIt Perineal Massage GelDreamBelly Stretch Mark ButterTea-for-Two Pregnancy TeaHealthy Mom, Happy Baby Prenatal Yoga DVD

Milkies Breastfeeding ProductsMilk-SaverMilk TraysFreeze Storage SystemBreast Milk Storage BagsSofties Contoured Nursing PadsBreast Pad Ever Nipple Nurture BalmSoft Cloths

Milkies Breastfeeding SupplementsNursing BlendNursing PostnatalFenugreekNursing Time Tea

Other Women’s Health ProductsIsoFresh Balancing Vaginal GelBalance Blend for Menopause

• The only fertility supplement providing complete vitamin, mineral and antioxidant support - no additional prenatal vitamin needed.

• Patented formula includes Vitex and Red Clover to support hormonal balance and improve overall reproductive wellness.

• Recommended by OB/GYNs, the most trusted female fertility supplement that has helped tens of thousands of women conceive.

FertilAid for Women Formulated by a leading fertility expert for optimal reproductive health.

• Formulated to improve sperm parameters such as count, motility and morphology.

• Contains key ingredients for fertility, including L-Carnitine, Zinc, CoQ10, and Selenium.

• Recommended by Reproductive Endocrinologists and fertility specialists world-wide.

FertilAid for Men Clinically shown to help improve the total number of motile sperm.

Amos Grunebaum, MD, leading fertility expert and FertilAid formulator. Dr. Grunebaum serves as the Director of Obstetrics and Chief of Labor & Delivery at New York-Presbyterian/Weill Cornell Medical Center and isdouble-boardcertifiedinobstetrics/gynecologyandmaternal-fetalmedicine (high-risk pregnancy).

The #1-Selling Fertility Supplements

US Patent # 8,383,165B1

US Patents: 8,663,709; 8,974,838

Page 4: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

4 fairhavenhealth.com (800) 367-2837

• Doctor-formulated to support fertility treatments such as IVF or for those conceiving naturally.

• Contains full prenatal vitamin support plus effective doses of scientifically-validatedfertilityingredients.

• The most comprehensive fertility supplement for women, recommended by OB/GYNs and fertility specialists.

• Formulated to support men undergoing fertility treatments or for those conceiving naturally.

• Complete vitamin and mineral support plus an array of antioxidants to reduce oxidative stress and improve sperm function.

• Recommended by fertility specialists as the most comprehensive male supplement available.

Contains pharmaceutical grade EPA and DHA to support optimal reproductive health. Can be taken in conjunction with FH PRO for Women and FH PRO for Men.

FH PRO Omega-3

FH PRO for Women Clinical-Grade, comprehensive formula to promote egg quality, ovarian function, and overall female fertility.

FH PRO for Men Clinical-Grade fertility supplement for men to improve sperm count, motility, and morphology.

Clinical-Grade Fertility SupplementsSupplement FactsServing Size: 6 capsulesServings Per Container: 30

Amount Per Serving % Daily ValueVitamin A (as beta-carotene) 5000 IUVitamin C (as ascorbic acid) 240 mgVitamin D3 (as cholecalciferol) 2800 IUVitamin E (87.5% as d-alpha tocopheryl succinate and 12.5% as mixed tocopherols) 100 IU Vitamin K (50% as K1 and 50% as K2) 80 mcgThiamin (as thiamine HCl and benfotiamine) 3 mgRiboflavin (as riboflavin 5 phosphate) 3.4 mgNiacin (as niacinamide) 40 mgVitamin B6 (as pyridoxal 5 phosphate) 4 mgFolate (as Quatrefolic®) 800 mcgVitamin B12 (as methylcobalamin) 12 mcgBiotin (as d-biotin) 600 mcgPantothenic Acid (as d-calcium pantothenate) 20 mgIron (as iron glycinate) 18 mgIodine (as potassium iodide) 150 mcgZinc (as zinc citrate) 30 mgSelenium (as selenomethionine) 70 mcg Copper (as copper sulfate) 1 mgManganese (as manganese bisglycinate chelate)2 mgChromium (as chromium polynicotinate) 240 mcgMolybdenum (as molybdenum glycinate chelate)75 mcg

Myo-Inositol 2000 mgCoQ10 (as ubiquinone) 300 mgAlpha Lipoic Acid 100 mgCholine (as choline bitartrate) 50 mgD-Chiro-Inositol 50 mgGrape Seed Extract 50 mgtrans - Resveratrol (from Polygonum cuspidatum root extract) 50 mgN-Acetyl L-Cysteine 50 mgMelatonin 2 mgBenfotiamine 1 mg

100%400%700%333%

100%200%

200%200%200%200%200%200%200%

100%100%200%100%

50%100%

200%

100%

**************

******

** Daily Value not established

Other ingredients: Vegetable capsule, microcrystalline cellulose, magnesium stearate, silicon dioxide

Supplement FactsServing Size: 6 capsulesServings Per Container: 30

Amount Per Serving % Daily ValueVitamin A (as beta-carotene) 5000 IUVitamin C (as ascorbic acid) 120 mgVitamin D3 (as cholecalciferol) 1200 IUVitamin E (87.5% as d-alpha tocopheryl succinate and 12.5% as mixed tocopherols) 200 IUVitamin K (50% as K1 and 50% as K2) 80 mcgThiamin (as thiamine HCl and benfotiamine) 3 mgRiboflavin (as riboflavin 5 phosphate) 3.4 mgNiacin (as niacinamide) 20 mgVitamin B6 (as pyridoxal 5 phosphate) 25 mgFolate (as Quatrefolic®) 800 mcgVitamin B12 (as methylcobalamin) 1000 mcgBiotin (as d-biotin) 600 mcgPantothenic Acid (as d-calcium pantothenate)20 mgIodine (as potassium iodide) 150 mcgZinc (as zinc citrate) 30 mgSelenium (as selenomethionine) 140 mcgCopper (as copper sulfate) 1 mgManganese (as manganese bisglycinate chelate) 2 mgChromium (as chromium polynicotinate)120 mcgMolybdenum (as molybdenum glycinate chelate) 75 mcg

L-Carnitine L-Tartrate 2000 mgL-Arginine HCl 350 mgCoQ10 (as ubiquinone) 200 mgN-Acetyl L-Cysteine 200 mgGrape Seed Extract 20 mgLycopene 10 mgBenfotiamine 1 mg

100%200%300%667%

100%200%

200%100%

1250%200%

16667%200%200%

100%200%200%

50%100%

100%

100%

**************

** Daily Value not established

Other ingredients: Vegetable capsule, microcrystalline cellulose, magnesium stearate, silicon dioxide

Page 5: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

5 fairhavenhealth.com (800) 367-2837(800) 367-2837

OvaBoost for Women Formulated to improve egg quality and help eggs produce the energy needed for successful conception and implantation.

• BeneficialforwomenwithPCOSorthosetryingtoconceivelaterin life.

• Contains ingredients that support egg quality, ovarian function, and hormone balance, including Myo-Inositol, Folate (as Quatrefolic™), and CoQ10.

Myo-Inositol Doctor-formulated to help balance hormones and support ovulatory function.

• Particularly helpful for women with PCOS who may have hormonal imbalances negatively impacting fertility.

• An excellent companion product to OvaBoost for those wanting to take additional Myo-Inositol.

FertileCM Formulated to increase the quantity and quality of fertile-quality cervical mucus.

• Helpssupportthehydrationandliquidityofcervicalfluidsthatplay a crucial role in conception.

• Enhances endometrial secretions that can help strengthen the uterine lining for healthy implantation of the embryo.

FertileDetox Helpsthebody’sowndetoxificationsystemstoremoveharmfultoxinsthat can impact fertility.

• Doctor-designed to be used by both men and women.

• Comprehensive formula includes vitamins, minerals, amino acids, herbs, and a proprietary probiotic blend.

Specialty Fertility Supplements

Page 6: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

6 fairhavenhealth.com (800) 367-2837

CountBoost for Men Designedspecificallyformendiagnosedwithlowspermcount.

• Containsingredientsscientifically-validatedtohelpincreasesperm count.

• Provides supplemental dosage of vitamins, antioxidants and herbs to be taken as a companion product to FertilAid for Men.

MotilityBoost for Men Doctor-formulatedspecificallyformendiagnosedwithlowspermmotility or movement.

• Clinically-validated ingredients to help improve sperm motility.

• Provides supplemental dosage of vitamins, antioxidants and herbs to be taken as a companion product to FertilAid for Men.

FertiliTea for Women A delicious tea to help improve overall reproductive health. Made with organic and wild-crafted herbs.

• Includesscientifically-validatedingredientssuchasVitexandRedClover to support ovarian function.

• Comes in both a loose-leaf and individual tea bag version.

ViriliTea for Men Made with organic and wild-crafted herbs to naturally promote male fertility and sexual vitality.

• Formula combines Ayurvedic medicine and emerging Western scientificresearchtoenhancefertility.

• Comes in a loose-leaf format, each bag is roughly a 1-month supply.

Specialty Fertility Supplements

Page 7: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

7 fairhavenhealth.com (800) 367-2837(800) 367-2837

Evening Primrose Oil Helps to enhance cervical mucus production and regulate hormones.

• Each capsule contains 500mg of EPO with 5% GLA plus Vit E and Selenium.

• Designedtobetakenduringthefirsthalfofthemenstrualcycleto support production of fertile quality cervical mucus.

Maca Designed to enhance fertility in women and men, 500 mg of organic Maca per capsule.

• Shown in studies to improve sperm parameters such as count and motility.

• For women, helps to encourage a favorable estrogen/progesterone balance.

Royal Jelly Used for centuries to promote hormonal balance and reproductive health.

• Densely packed with vitamins, minerals, amino acids, and beneficiallipids(fats).

• Helpful for both women and men to support optimal reproductive health.

CoQ10 A potent antioxidant shown to enhance male and female fertility.

• Clinical studies demonstrate positive effects on sperm count, motility, and morphology.

• Studies indicate that CoQ10 may improve egg quality and fertilization rates.

Specialty Fertility Supplements

Page 8: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

8 fairhavenhealth.com (800) 367-2837

• Patented Electrolyte Method technology displays your fertile window and ovulation date.

• No recurring costs for urine test sticks or charting subscriptions.

• Easy to test - takes only a few seconds a day - plus seamless integration with OvaGraph, a free fertility charting app.

OvaCue The Gold-Standard in fertility monitors for over 30 years, predicts ovulation up to 7 days in advance.

• Conveniently take readings in just seconds a day.

• Charts and data can be easily viewed and shared with your OB/GYN.

• Comes with a 1-year warranty and exceptional customer service and support.

OvaCue Mobile Same great OvaCue patented technology on your smartphone or tablet.

Fertility Monitors to Pinpoint Ovulation

US Patent # 6,364,844

US Patent # 6,364,844

Page 9: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

9 fairhavenhealth.com (800) 367-2837(800) 367-2837

• Syncs your temperature readings withOvaGraph,theofficialchartingapp of the best-selling book, Taking Charge of Your Fertility.

• More accurate than traditional basal thermometers plus helps you interpret your fertility chart.

• Powered by your smart phone with readings in as short as 20 seconds.

TempCue A connected basal thermometer that automates fertility charting.

• TheofficialchartingtoolofToniWeschler’s best-selling book, Taking Charge of your Fertility.

• Easy to chart all your fertility indicators such as BBT, cervical mucus, and much more.

• Supportive TTC community plus free access to our knowledgeable fertility charting specialists.

OvaGraph Fertility Charting Free, full-featured fertility charting app and trying-to-conceive (TTC) community.

“Whether you are actively trying to conceive or simply want to understand your menstrual cycle better, I know you will find everything you need here at OvaGraph to store and track your fertility, and a warm, safe community in which to ask questions and share your journey.” - Toni Weschler, MPH

Automated Basal Charting & Fertility App

Page 10: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

10 fairhavenhealth.com (800) 367-2837

Fertile-Focus Predicts ovulation up to 72 hours in advance without messy urine testing.

• Works by viewing the changes that occur in your saliva throughout the cycle.

• Discreet, easy-to-use and reusable for unlimited testing.

Digital Basal Thermometer Reliable, accurate BBT thermometer ideal for trying-to-conceive women.

• Accurately displays temperature readings to 1/100th of a degree.

• Includes memory recall, perfect for fertility charting.

Glass Basal Thermometer A mercury-free basal thermometer that is family and earth-friendly.

• Extremely accurate with an easy-to-read magnifying case.

• Easy to care for - simply wash with soap and water.

Ovulation Calendar & Pregnancy Wheel Provides day-to-day information on fertility, ovulation, and pregnancy milestones.

• The only ovulation prediction wheel that adjusts for short or long cycles.

• Designed by a fertility expert and OB/GYN for use by medical professionals and trying-to-conceive couples.

More Ovulation Prediction Tools

Page 11: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

11 fairhavenhealth.com (800) 367-2837(800) 367-2837

BFP Ovulation Test BFP (Big Fat Positive) test strips detect ovulation 24-48 hours in advance.

• BFP tests are made in North America vs. most others manufactured in China.

• Over 99% accurate, results you can count on.

BFP Pregnancy Test Accurate and affordable early detection pregnancy tests.

• Made in North America to ensure the highest quality.

• Sensitive to just 20 miu/ml hcg, enabling you to test as early as 7 days past ovulation.

BFP Midstream Tests Ovulation and Pregnancy tests in a convenient midstream format.

• Made in North America for quality and accuracy.

• BFP tests are affordable, only a fraction of the cost of drugstore prices.

BFP Test Combo Packs Ovulation & Pregnancy test bundles for added savings and convenience.

• Combo packs available in test strip and midstream format.

• Bundles of 15 ovulation and 5 pregnancy tests plus many other variations.

Ovulation & Pregnancy Tests

Page 12: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

12 fairhavenhealth.com (800) 367-2837

• Does not harm sperm motility, damage sperm DNA, interfere with sperm penetrationintocervicalfluid,orinterfere with egg fertilization.*

• Made without parabens, BabyDance doesn’t use harsh chemical preservatives like other leading brands.

• Isotonic - because the salt concentration of BabyDance matches that of your vaginal cells, it won’t irritate sensitive tissues.

BabyDance Fertility Lubricant Isotonic and made without parabens, the gold-standard in fertility lubricants.

• Led by Anna Davis, PhD, RYT, scientist andcertifiedyogainstructor.

• Program suitable for all levels - includes poses, breathing techniques, visualization, and a guided relaxation.

Bend, Breathe, and Conceive Fertility Yoga DVD FertilityYogaprogramcreatedspecificallyfortrying-to-conceivecouples.

• Acupressure has been shown to help restore hormonal balance and decrease stress.

• Developed by Shasta Tierra, L.Ac., an acupuncurist,certifiedyogateacherandacupressure instructor.

Acupressure for Fertility DVD A gentle acupressure and stretching program to enhance reproductive health.

More Fertility Aids

*Laboratorystudiesonfile

Page 13: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

13 fairhavenhealth.com (800) 367-2837(800) 367-2837

Peapod Prenatal Vitamin A natural, once-daily prenatal vitamin for before and during pregnancy.

• Noartificialdyes,colors,flavorsorpreservatives.

• 100% Daily Value or more of essential vitamins and minerals, each bottle is a 2-month supply.

PregEase-Morning Sickness Relief Doctor-designed to help ease digestive discomforts of pregnancy.

• The most comprehensive formula available that includes B Vitamins, Ginger, Calcium Carbonate and more.

• Allnaturalchewabletabletswithadelicioussweetorangeflavor.

Peapod Omega-3 Pharmaceutical-grade EPA and DHA to support fetal brain and eye development.

• PremiumIcelandicfishoilfromsmallfishtoensurepurity

• Small,easytoswallowsoftgelswithnaturalcitrusflavortoeliminatefishyaftertaste.

Peapod Cal-Mag Supplemental Calcium, Magnesium and Vit D3 for before, during, and after pregnancy.

• Includes two different forms of Calcium and Magnesium for enhanced absorption.

• Noartificialcolors,flavorsorpreservatives.

Supplements for Pregnancy

Page 14: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

14 fairhavenhealth.com (800) 367-2837

BabyIt Perineal Massage & Postpartum Comfort Gel A 2-in-1, must-have product for use during and after pregnancy.

• Daily perineal massage helps prevent trauma to vaginal tissuesduringchildbirth.BabyItisthefirstmassagegelformulatedspecificallyforperinealmassage.

• Anti-inflammatory,antioxidant,andhydratingpropertiesprovide soothing comfort postpartum.

DreamBelly Stretch Mark Butter The only stretch mark prevention, treatment and repair cream you’ll ever need.

• Deep moisturizing with no greasy residue plus antioxidants to help soothe and revitalize strained skin.

• Luxurious texture with a pleasant milk and honey scent.

Tea-for-Two Pregnancy Tea A natural herbal tea to help support a healthy pregnancy.

• Designed to help tone the uterus, relieve morning sickness, and prepare the body for childbirth.

• Made with organic and wildcrafted herbs - a delicious, loose-leaf tea that provides excellent nutritional support.

Healthy Mom, Happy Baby Prenatal Yoga DVD A yoga program suitable for women in all stages of their pregnancy.

• Ledbycertifiedyogainstructor,neurophysiologistandscienceeducator Anna Davis, and Lisa Black, a nationally recognized SeniorCertifiedMasterBaptisteyogainstructor.

• Includes warm-up, breath work, poses, and a guided relaxation.

More Products for Pregnancy

Page 15: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

15 fairhavenhealth.com (800) 367-2837(800) 367-2837

Milk-Saver No more wasted breast milk, save every drop!

• Collects leaking milk from the non-nursing side during the breastfeeding session.

• Holds up to 2 ounces of milk, recommended by OB/GYNs and lactation specialists.

Milk Trays / Food Trays A convenient breast milk and baby food freezing system for moms on-the-go.

• Makesconvenient,1-ouncesticksthatfitallbottleopenings.

• Contains two trays and lids, made from food-grade, BPA-free plastic.

Freeze The ultimate solution for space-saving breast milk storage and retrieval.

• A BPA and pthalate-free first in, first out system that ensurestheoldestmilkisusedfirst.

• Can be used with any milk storage bags, stores up to 60 ounces.

Breast Milk Storage Bags “No-Break,No-Leak”easytofillmilkstoragebags.

• BPA-free and exceptionally durable with reinforced sides and a double zipper.

• Convenient milk storage guidelines printed on every bag.

More Products for Pregnancy Products for Breastfeeding

Award-winning Products!

Page 16: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

16 fairhavenhealth.com (800) 367-2837

Softies Contoured Nursing Pads Super soft, absorbent, and reusable bamboo rayon pads.

• 3 layers for ultimate protection plus contoured shape for added comfort.

• Machine wash and dry, each box contains 3 pairs.

• Thoughtfully designed, sustainably sourced, and easy to love.

Breast Pad Ever Comfortable, stylish leak protection in a reusable nursing pad.

• Spongy core provides unrivaled leak protection.

• Providescomfortableandflatteringliftandsupport,available in beige or black.

• Machine wash and dry, each box contains 1 pair.

Nipple Nurture Balm Made with organic ingredients, and contains no lanolin, harsh chemicals or additives.

• Recommended by lactation professionals to soothe sore, cracked nipples.

• Safe for mom and baby - no need to wash off before feedings.

• 1.5 oz in each container, generally a 1-month supply.

“As a Registered Nurse, Lactation Educator, Mom and inventor of the Milkies Milk-Saver, I’ve been fortunate to be in a position of helping women reach their breastfeeding goals. Our innovative products were developed by real moms who know firsthand the many challenges women face while breastfeeding.” - Helen Anderson, MSN, RN, CLE

Products for Breastfeeding

Page 17: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

17 fairhavenhealth.com (800) 367-2837(800) 367-2837

Nursing Blend Doctor-formulated to help increase milk quantity and quality.

• Contains complete postnatal vitamin support optimized for breastfeeding women.

• Includes a proprietary blend of herbal galactagogues to enhance milk production.

Nursing Postnatal Acomprehensivepostnatalvitamindesignedspecificallyforbreastfeeding women.

• Includes additional amounts of Vitamins D, B1, B2, B3, B6, B12, and Biotin.

• Formulated by a leading lactation expert and MD.

Fenugreek The most well-studied herb for supporting breast milk production.

• Includes a concentrated Fenugreek extract in addition to Fenugreek Seed.

• Delivers an equivalent dose of 2000 mg of Fenugreek powder in only 2 capsules.

Nursing Time Tea A natural tea to help increase breast milk supply and soothe digestive unease.

• Made with organic and wildcrafted herbs, including Fennel Seed, Goat’s Rue and Blessed Thistle to boost milk supply.

• Formulated to provide relief for colicky or gassy newborns.

Products for Breastfeeding Supplements for Breastfeeding

Page 18: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

18 fairhavenhealth.com (800) 367-2837

Everything you know about vaginal care products is about to change. Unlike most other vaginal health care products, IsoLove products are isotonic, meaning their salt concentration matches that of vaginal cells. IsoLove products are made without parabens and feature a fertility lubricant, a perineal massage & postpartum comfort gel, and an odor control freshening gel.

Our Family of Isolove BioGels

Other Products for Women’s Health

• SupportshealthyvaginalpHandfightsunwanted feminine odor.

• Provides 12 applications compared with 4-6 of most other brands.

• Made without parabens, doesn’t contain any harsh chemical preservatives like other leading brands.

Isofresh Balancing Vaginal Gel An isotonic vaginal freshening gel.

• 2-in-1 solution, contains vitamin and mineral support plus ingredients for hormonal balance.

• Helpsnaturallyalleviatehotflashes,night sweats, and mood swings.

Balance Blend for Menopause The most comprehensive formula available to help ease menopause symptoms.

Page 19: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

19 fairhavenhealth.com (800) 367-2837(800) 367-2837

Fairhaven Health works with leading medical experts to establish - and then meet - themost rigorous benchmarks for product development, supplement formulation, and overall quality assurance.

Amos Grunebaum, M.D. – Dr. Grunebaum is the Director of Obstetrics and the Chief of Labor & Delivery at New York-Presbyterian/Weill Cornell Medical Center andisdouble-boardcertifiedinobstetrics/gynecologyandmaternal-fetalmedicine (high-risk pregnancy). He is also full Professor of Clinical ObGyn at the leading Ivy League Medical School in New York and is recognized as one of New York’s foremost OB/GYNs as evidenced by his regular inclusion in Castle Connolly’s “Top Doctors: New York”.

Botros Rizk, MD, MA, FRCOG, FRCS, HCLD, FACOG, FACS - A Professor and the Head of Reproductive Endocrinology & Infertility at the University of South Alabama. Dr. Rizk has published over twenty medical textbooks covering various aspects of infertility, ultrasonography and robotic surgery and is one of the early members of European Society for Human Reproduction. Professor Rizk is recognized as a leading authority on endometriosis and has published over four hundred peer reviewed articles, book chapters, and abstracts over the past 25 years.

Helen Anderson, MSN, RN, CLE – Helen has an international reputation as a leader in innovative breastfeeding products. She studied nursing at Chemeketa Community College, Oregon Health and Sciences University, Western Governor’s University and earned her Master of Nursing Education degree. Helen received her Lactation Education teaching credential from Oregon’s top program and continues to educate women through published articles and lectures. Helen’s patented products have been used by women around the globe to help them reach their breastfeeding goals.

Dr. Chris D. Meletis – An internationally recognized naturopathic physician, an accomplishedauthor,andrespectededucatorinthefieldofnaturalmedicine.Dr. Meletis was honored as a past ‘Naturopathic Physician of the Year’ by the American Association of Naturopathic Physicians for his commitment to education and helping those in need. He has authored 14 books on subjects ranging from natural medicine interactions to fertility enhancement and has published over 80 articles in publications such as Natural Health and Natural Pharmacy.

Suzanne Munson, M.S. – Suzanne Munson’s passion for natural health and whole foods nutrition led her to Bastyr University, one of the world’s leading academic centers for natural health sciences. After earning a Master of Science in Nutrition, she completed the required coursework, internship and exam to become a Registered Dietician. Suzanne has served as adjunct faculty at Bastyr University, as clinic supervisor at the Bastyr University Natural Health Clinic, and has published several articles on nutrition and natural products.

Our Medical Advisory Team

Page 20: Helping you embrace life’s important stages with …...Science-based products to support fertility, pregnancy, breastfeeding and overall women’s health. fairhavenhealth.com Helping

We are proud to help thousands of couples conceive each year, and to support them throughout their pregnancy and beyond. Our natural, doctor-designed fertility, pregnancy, breastfeeding, and women’s health products help support you throughout your entire journey. All of our products are manufactured in U.S. GMP-certified and FDA-regulated facilities, and are distributed worldwide.

Fairhaven Health, LLC.1410 11th Street, Bellingham, WA 98225(800) 367 - [email protected] | www.fairhavenhealth.com

Partnered with:


Top Related