Download - Impression Evidence.pdf
-
7/29/2019 Impression Evidence.pdf
1/20
26PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266
Impessin
Evience
Often thought of as a form of evidence nearly as valuable as fingerprints,impression evidence must receive priority handling. Impression evidencemay exist in the following forms:
Ftprintsinsilrnflrs,cks,tc...
Tirtracksinsil,annrivwaysrraways
Tlmarksattpintfntryrwitintcrimscn. Bitmarksntvictim.
Latent or very difficult to see impressions may also be present, includingdust prints or foot impressions left on dry floors.
A visual search for impression evidence should be made prior to anyattmptstlcatancllcttrfrmsfpysicalvinc.Tiswillhelp to prevent footprint or tire impressions from being damaged duringsubsequent searches. When impression evidence is found, secure thearea using crime scene barrier tape or other means. It may be necessaryto erect a tent or similar shelter to protect fragile impression evidenceoutdoors in bad weather.
Tabilitytmatcsmls,tirtyps,anttpattrnsisigly
valued by investigators. Impressions yield individual characteristics, suchaswarpattrns,ctmarksantraltratinstatnancmatc-ingabilitisanarinvalablwnmakingpsitivintificatinsinaninvestigation.
Lcting n Ptecting
Impessin Evience
Vis methds f
cllecting impessin
evidence hve evlve
nw ppely
peseved impessinevidence cn pvide
psitive mtch t th
shoeswn by the
pepett, the tires
n the vehicle diven
the pepett nd th
tools sed t bek
int the pemises.
Sho print fond in md. Cast mad from sho print. Sspct sho matchs cast.
-
7/29/2019 Impression Evidence.pdf
2/20
Impessin
Evience
266 SIRCHIE Tradition. Expertise. Excellence. Web: www.sirchie.co
Liqi Silicne Csting
catalog no. description price
SRK800 N. 2 Silicne Casting Kit $148.25
no. 1 silicone casting Kit
Tiscnmical,spac-savingkitcntainsalltncssarymatrialsnfor casting small crime scene impressions such as single footprints, toolmarks,anbitmarks.Tliqisilicnisalstprfctmimfrliftingpowder-developed latent fingerprints from rough or textured surfaces. Easy toprepare and apply.
catalog no. description price
SRK700 N. 1 Silicne Casting Kit $65.50
no. 2 silicone casting Kit
Tiskitcntainsallftncssarymatrialsfrlargrimprssincastingapplicatins.Tkitcntains2-npnjarsfLiqiSilicnRbbrwit
Catalyst,aswllas16z.fSilicnRbbrTinnr.ApmpspraycntainrfSilicnRlasAgntisspplifrswncastingnifficltsurfaces such as deep impressions in wood or metal. Ideal for use on mostcrimscnimprssins.Allfttlsnarcntainintkit.
RK700 CONTENTS:
- 634C Liquid Silicne Rubber, 1 lb. (454g)
- TM1 Vial f Catalyst
- SRA10A Silicne Rubber Release AgentPump Spray, 4 z. (120ml)
- KCP199 Steel Spn
- KCP198 Plastic Mixing Cntainer, 1 qt.(946ml)
- KCP155 Spatula, 7 (17.8cm), Steel Blade
RK800 CONTENTS:
- 634C Liquid Silicne Rubber, 1 lb. (454g)
- 636C Silicne Rubber Thinner, 16 z.
(473ml)- TM1 Vials f Catalyst
- SRA10A Silicne Rubber Release AgentPump Spray, 4 z. (120ml)
- KCP199 Steel Spn
- KCP198 Plastic Mixing Cntainer, 1 qt.(946ml)
- KCP201 Plastic Mixing Cntainer, 1 pt.(473ml)
- KCP155 Spatula, 7 (17.8cm), Steel Blade
- SRK8001 Mlded Cplymer Carrying Case;Dimensins: 12.125 x 7.25 x 4.5(30.8cm x 18.4cm x 11.4cm);Weight: 4.92 lbs. (2.2kg)
-
7/29/2019 Impression Evidence.pdf
3/20
26PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266
Impessin
EvienceLiqi Silicne Csting
liQUid silicone rUBBer
Tisistmstcnmicalmimfrprcingxactrprctinsfvirtallyanysrfacinclingftprints,tirprints,tlanjimmymarks,prints in dust, fingerprints, crash debris, firearms and the identification ofdisaster victims. It features a long shelf life and is unaffected by temperaturesfrm-70Ft+500F.Liqisilicnrbbrisqick-sttingintrtfivmints,ytitflwsasilyintairlincracksancanalsbtinntflwmrfrly.Availablina1lb.(454g)jarwitcatalyst.
silicone rUBBer tHinner
Use silicone rubber thinner with No. 634C liquid silicone rubber compound.Tisprcttinstcmpn,allwingittflwmrfrlyancvrawirara.Itissppliina16fl.z.(473ml)bttl.
silicone rUBBer release agent
Tiscnvnintlypackagprctisstaiintsparatinfcrsilicnfrmimprssinaras.Italswrkswllwitplastranntalstone casting materials. Apply a thin, even coating over the surface to be
prsrv.Availablin4.5z.arslr4z.pmpspray.
catalog no. description price
634C Liquid Silicne Rubber, 1 lb. (454g) w/TM1 Catalyst $45.95
SRA10 Silicne Rubber Release Agent, 4.5 z. (128g) aersl $9.95
SRA10A Silicne Rubber Release Agent, 4 z. (12ml) pump spray $9.95
636C Silicne Rubber Thinner, 16 z. (473ml) $26.75
liQUid silicone casting Kit
Tisisacmpltfilkitwitalltmatrialsfrmakingaccratrprctinswitliqisilicn.Spplimatrialsfacilitatcastingftirand footprints in snow, mud and sand, as well as other casting requirements.
catalog no. description price
640C Liquid Silicne Casting Kit $375.50
No. 636C
No. SRA10
No. 634C
No. SRA10A
640C CONTENTS:
2- 634C Liquid Silicne Rubber, 1 lb. (45
1- 636C Silicne Rubber Thinner, 16 z.(473ml)
2- TM1 Vials f Catalyst
1- SRA10 Aersl Silicne Rubber Relea
Agent, 4.5 z. (133ml)1- KCP142 Steel Spn
1- KCP155 Spatula, 7 (17.8cm), Steel B
1- 642C Flexible Mixing Bwl, 4.25 (10
1- 643C Flexible Mixing Bwl, 4.75 (12
1- 644C Flexible Mixing Bwl, 5.25 (13
1- SP1000 Snw Impressin Wax,Net Wt. 15 z. (425g)
1- 638CA Aersl Dust & Dirt Hardener,Net Wt. 15 z. (425g)
1- SK900 Tape Measure, English/metric,ft. (30m)
25- 608E01 Evidence Tags w/Ties
1- KCP200 Surface Brush
1- FCF100 Adjustable Casting Frame,7.25 x 12-18 (18.4cm x 30.5cm-45.7cm)
1- Technical Instructins
1- 640CC Black Mlded Cplymer Carring Case w/Flding Handle and LckinLatches; Dimensins: 17 x 13 x 7.3(43.2cm x 33cm x 18.7cm);Weight: 16.5 lbs. (7.5kg)
-
7/29/2019 Impression Evidence.pdf
4/20
Impessin
Evience
268 SIRCHIE Tradition. Expertise. Excellence. Web: www.sirchie.co
STEP 1: Apply Dst and Dirt Hardnr (No.638CA)*.
STEP 2: Por watr into zip-topbag, sal.
STEP 3: Knad bag for 1-2 mints.
STEP 4: Por into imprssion*.(* Optional accssoris shown.)
Plste Csting
ZMP100 CONTENTS:
1- ZMP101 Bttle f Pre-Treated Water,24 z. (709.56ml)
1- ZMP102 Package f Plaster, 3 lbs.(1.36kg)
1- ZTE031 ZIP-MIX Mixing Bag, 13 x 18(33cm x 45.7cm)
FoUr steps to
zip-mix plaster
casting:
adJUstaBle casting
Frames
Tsall-alminm,ajstablcastingframsrestrict the flow of castingcompounds. Each sizeexpands a full six inches inlength. Manufactured out of0.060 x 1 3/4 aluminum.
casting plaster
Tisspcialfrmlaplastrisfrtiranftprint
vinc.Txtrmicrtarrslwsst-pwilmixinganrcssrinkagwilcring.Cmsina8lb.(3.6kg)cntainr.
catalog no. description price
639C1 Casting Plaster, 9 lb. (4.08kg) $16.95
catalog no. description price
ZMP100 ZIP-MIX Plaster Casting $19.95
catalog no. description price
FCF100 Adjustable Casting Frame, 7 1/4 x 12 t 18 $16.50
FCF200 Adjustable Casting Frame, 12 x 18 t 24 $24.50
zip-mix plaster casting
Eliminate the mess and difficultyfmixingplastrsZIP-MIXPlastrCasting.Castingplastrmstbe mixed uniformly and all lumpsliminat.ZIP-MIXplastrnsrsa uniform, smooth mixture everytim.Simplycmbinwatranplastrintzip-tpbaganknawith both hands until no lumps areflt.TZIP-MIXstinclsapre-measured amount of plaster andwatrngtcastafll-sizadult footprint. Everything needed isinncnvnintpackag.
-
7/29/2019 Impression Evidence.pdf
5/20
26PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266
Impessin
EviencePlste Csting
catalog no. description price
641C Flexible Mixing Bwl, 3 1/2 (8.9cm) diameter $11.95
642C Flexible Mixing Bwl, 4 1/4 (10.8cm) diameter $15.95
643C Flexible Mixing Bwl, 4 3/4 (12.1cm) diameter $19.95
644C Flexible Mixing Bwl, 5 1/4 (13.3cm) diameter $23.95
646C Flexible Mixing Bwls, 4 piece set $68.95
FlexiBle mixing BoWls
Tsiglyflxibl,slf-claningmixingbwlsarialfrmixingliqisilicone rubber, plaster, and hARd-CoRe.Tbwlsfatrann-sticksurface that is resistant to chemicals and petroleum products.
tire and Footprint plaster casting Kit
Tiscmpltkitisialfrcastingxactrprctinsfftprintsantire prints in snow, mud, sand and dirt. It is excellent for field investigations.Comes complete with application procedures and instructions.
catalog no. description price
639C Tire and Ftprint Plaster Casting Kit $279.50
Cast mad sing casting plastrincldd in th No. 639C kit.
No. 644C No. 643C No. 642C No. 641C
639C CONTENTS:
1- SP1000 Snw Impressin Wax,Net Wt. 15 z. (425g)
1- 639C2 Water Cntainer, 24 z. (709.5
1- 638CA Aersl Dust & Dirt Hardener,Net Wt. 15 z. (425g)
1- SRA10 Aersl Silicne Rubber ReleaAgent, 4.5 z. (133ml)
1- KCP142 Steel Spn
1- KCP155 Spatula, 7 (17.8cm), Steel B
1- 642C Flexible Mixing Bwl, 4.25 (10
1- 643C Flexible Mixing Bwl, 4.75 (12
1- 644C Flexible Mixing Bwl, 5.25 (13
1- KCP114 Retractable Measuring Tape
1- KCP154 Pipette with Suctin Bulb
1- KCP200 Surface Brush
1- 639C15 Tire and Ftprint Casting Pla3 lbs. (1.36kg)
1- 639C5 Wire Mesh Reinfrcement, 2 (5.1cm x 10.2cm), 10 each
1- STM1003 Mdeling Clay, 1/4 lb. (1131- FCF100 Adjustable Casting Frame,
7.25 x 12-18 (18.4cm x 30.5cm-45.7cm)
24- 608E01 Evidence Tags, Pre-printed
1- Technical Infrmatin
1- 639CC Black Mlded Cplymer Carring Case w/Flding Handle and LckinLatches, Includes Mlded Inserts;Dimensins: 17 x 13 x 7.375(43.2cm x 33cm x 18.7cm);Weight: 18 lbs. (8.2kg)
-
7/29/2019 Impression Evidence.pdf
6/20
Impessin
Evience
270 SIRCHIE Tradition. Expertise. Excellence. Web: www.sirchie.co
catalog no. description price
SNC42 Shake-N-Cast Impressin Kit $14.50
SNC428 Shake-N-Cast Impressin Kit, 8 each $108.00
shk-n-c impression casting Kit
Tisincriblysimpltskitliminatsalltmssangsswrkinrntwitmsttrcastingmts.Sak-N-Castcntains42z.(1191.7g)fprpritarygypsmcastingmatrialpackagwitanintrnalprmasrwatrcapsl.Tmixtrisalwaystcrrctcnsistncy!
dtitsxcptinalstrngt,Sak-N-Castisfastbcmingtprfrrcicfcrimscnspcialistsancrimlabratryprsnnl.Typicalcastsarnly0.5t0.75(13mmt19mm)tick.Nrinfrcmntisneeded.
eackitissfficintfrcastingafll-sizaltsprintin4asystps:
1) Applyprssrtbraktintrnalwatrcapsl.
2) Sakanknatpcfrabt2mints.3) Ctffacrnrftpc.
4) Prtmixtrinttimprssin.*
Its Tht Esy!
*Whn working in loos, dry soil or sand, w rcommnd sing or No. 638CA Dst and Dirt Hardnr to prpar thimprssion prior to casting.
STEP 1: Prpar imprssion with 638CADst and Dirt Hardnr*.
STEP 2: Brak intrnal watr capsl.
STEP 3: Shak, thn knad bag p to2 mints.
STEP 4: Por mixd casting matrialinto imprssion*.
(* Optional accssoris shown.)
FEaTuRES:
Acompleteimpressioncastingkit
Nomoremess,nomoremeasuring,nomre mixing bwls, n mreguess wrk
Simpletouse
Superiorresults
FoUr easy steps:
Tie n Ftpint Csting
Rsltant cast singNo. SNC100 Shak-N-Cast
Imprssion Kit
-
7/29/2019 Impression Evidence.pdf
7/20
27PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266
Impessin
Evience
catalog no. description price
SNC100 Master Shake-N-Cast Impressin Kit $257.95
TLK700 Tactical Master Shake-N-Cast impressin Kit $249.95
master shk-n-c impression Kit
TisisSIRCHIEscmpltfilkitwitalltncssarymatrialsnfrmakingaccratimprssinstilizingrSak-N-Castmt.AlngwitfivpcsfSak-N-Cast,tiskitcntainstwcansfrdstandirtharnrfrprparingimprssinsinlsrsanysilantwcansfrSnwImprssinWaxfrcastinginsnwanic.Twcastingframsarinclfrcastingftprintsantirtracks.
FEaTuRES:
Nomoreguessingathowmuchwaterplaster t use
Makecastsinallkindsofconditionsmud, dirt, sand, even snw!
Nomessymixingbowlsorbuckets
Kitcontainsallmaterialsandtoolsfortbest pssible results
The ltimte in
cnvenience nd
tilitythe SNC100
nd TLK700 kits
cntin the mstften needed
mteils f tie n
ftwe csting.
CONTENTS:
5- SNC42 Shake-N-Cast Impressin KitNet Wt. 42 z. (1191.7g)
1- FCF100 Adjustable Casting Frame,7.25 x 12-18 (18.4cm x 30.5cm-45.
1- FCF200 Adjustable Casting Frame,12 x 18-24 (30.5cm x 45.7cm-61cm
2- 638CA Aersl Dust & Dirt Hardener,Net Wt. 15 z. (425g)
2- SP1000 Snw Impressin Wax, Net Wz. (425g)
1- SRA10 Aersl Silicne Rubber ReleasAgent, 4.5 z. (133ml)
1- KCP142 Steel Spn
1- ESP30W Pht Scales, 10 pk.
1- 608E1 Evidence Tags w/ties, 100 pk.
1- Technical Instructins
1- SNC100CC Heavy Duty, Mlded CarryiCase; Dimensins: 17 x 13 x 7.375(43.2cm x 33cm x 18.7cm);Weight: 26.2 lbs. (11.9kg)
Tie n Ftpint Csting
No. TLK700 Tactical Mastr Shak-N-Cast Kit incldsall th sam contnts in a drabl tactical bag.
TaCTiCal CaSE dESCRiPTiON:
16.5X12.5X5.5insidemaincompart
Twofrontpocketsmeasuring7X10X2
Largebackpocketmeasuring16.5X10.5X2
Molle/Aliceinteriorpanel
Madefrom1000-deniertexturednylon
Luggagehandlepanel
Nametapeholder
LargehiddenpocketwithfullBackUpSystem
Lightcoloredinteriorforeasyaccesst
Expandablesidepockets
Moldedhandle
-
7/29/2019 Impression Evidence.pdf
8/20
Impessin
Evience
272 SIRCHIE Tradition. Expertise. Excellence. Web: www.sirchie.co
catalog no. description price
638CA Aersl Dust and Dirt Hardener, 15 z. (425g) can $16.95
Tie n Ftpint Csting
Rsltant cast (abov)sing No. 638CA and
No. SNC42.
aerosol dUst and dirt Hardener
Tisfficintmtfrprparingftprintsantirtracksfninlsrsanysilisnwlypackaginaerosol form.
ordstandirtharnrfatrs
aqick-rying,claracrylicfrmlathat adds superior strength toimprssinslssningtcancof detail damage due to the weightof the casting material. Use it withplastr-f-paris,hARd-CoRe,rSak-N-Castmatrials.on15-nccanf638CAdstandirtharnrisngtmakpto 30 full-size adult shoe impressionapplications.
snoW impression Wax
Impression evidence found in snow or ice presents a
niqstfifficltisfrrcvry.dttfactthat most gypsum-based casting materials generateheat during the curing process, it is necessary toprvianinslatingmim.SpraySnwImprssinWax into the impression to prepare the surface for
casting.Tislckstimprssintailto avoid melting when the castingmedium is applied. It is supplied inan aerosol can.
catalog no. description price
SP1000 Snw Impressin Wax, 15 z. (425g) can $15.95
Ung snw impn Waxv a dua pup:
1. It pvides insltin fm the
cing het f the csting medim.
2.It hdens the impessin,peventing it fm being cshedby the weight f the cstingmedim.
Rslting imprssion castsing Snow ImprssionWax.
STEP 1: Rmov loos dbris and plac acasting fram arond th imprssion.
STEP 2 : Apply svral light coats of Dst andDirt Hardnr allowing 2-3 min. drying tim
btwn coats.
STEP 3: Mix and por casting matrial intoimprssion braking th fall with spoon or
spatla to 1/2-3/4 thicknss. Allow 30 min.to cr.
tHree easy steps:
HoW to Use:
Apply 2 coats of Snow Imprssion Wax from10-12. Thn, spray 6 mor coats from 6.
Allow 1-2 min. drying tim btwn coats.
Prpar a sfficint amont of casting matrialto mak th cast 1/2-3/4 thick. Can b sd
with all casting matrials.
-
7/29/2019 Impression Evidence.pdf
9/20
27PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266
Impessin
Evience
Stp 2
Hard-CorE BLuE
Csting Techniqes
casting WitH Hard-core BlUe
hARd-CoReBLueissintsammannrascastingplastr.Fllwthese procedures for consistently good casts: 1.Rmvanybris,twigsrlavsfnlyingntpftimprssin.doNoTrmvanybjctimbedded in the impression. 2. Placacastingfram(N.FCF100)arnthe impression and prepare the surface by adding several light coatings ofstanirtarnr(N.638CA).Allwtwttrmintsfryingtime between coatings. Hard soil or clay generally will not require hardening.Applyaligtcatingfsilicnrlasagnt(N.SRA10)ttimprssin.
3.PrtrqiramntfmixingsltininttbagwitthARd-CoReBLuecasting material. 4. Knead the mixture until thoroughlybln(apprximatlytwmints).Tntirmixtrslbanifrmcolor. 5. Printtimprssin.Bcrtaintbraktfallftmixtrsingastick,spnrspatla.Bginpringarntgsanallwtmixtrtflwvrtimprssin.Gnrally,tcastslb1/2t3/4tick.Nrinfrcmntisrqir.
casting in standing Water
Itispssibltmakacastfanimprssintatisfnnrwatrsing
the following procedure.
Stp 1 Stp 2 Stps 3 and 4
1. Carefully place a casting frame around the impression. If possible, theframe should be wide enough so that it stands above the surface of thewater.
2.LigtlysprinklhARd-CoReBLue compound to completely cover theimprssintaticknsspnntntwatrpt.
3. Mix a quantity of hARd-CoReBLuewith mixing solution and pour themixtrntpftcmpncvringtimprssin.Bcrtaintbraktfallftmixtrwitastick,spnrspatla.
4.Allwatlast30mintsfrstp.Rmvtcastanallwatlast24rsfryingtimbfranyfrtrxaminatinranling.
De t thei size, tie ndftpint impessins eqidiffeent csting medim thtl mks. F mny yes,cime scene investigts
pefeed Plste f Piss thei fist chice f
ecveing lge impessinIn ecent yes, investigthve switched t die stne dentl stne mteils.
Die stne dentl stnefms vey dble cst,eqies n einfcement demnsttes n ppent
shinkge.
Stp 1 Stp 3 Stp 4 Stp 5
Footwar imprssion shownprior to casting.
HARD-CORe BLue is pordonto th srfac to mak a cast
of th imprssion.
-
7/29/2019 Impression Evidence.pdf
10/20
Impessin
Evience
274 SIRCHIE Tradition. Expertise. Excellence. Web: www.sirchie.co
aBoUt Hard-core
BlUe dental stone
casting material
HarD-CorE BLuE is nll-ppse, gypsm-bsed
sting mteil tht ffesHeclen stength, ccteepdctins, simplicity f
se nd lng-tem ecnmy.t is dentl stne csting
mteil pven t be the mstfficient nd pcticl methd csting tie nd ftpintmpessins. Its speitength elimintes the need einfcement. Typiclsts e 1/2 t 3/4 thickcmped with sevel inches
hick sing plste), nd ffeme mzing ppeties. It
hs been sted f mnths nnd in the tnk f vehicle
with n ppent lss ffficiencyfm sbfeezing tempetes in excess f 100
F (38 C). It sets p in shteime nd hs nly minxthemic ectin. only
ge impessins eqiedmming flw estictin.
zip-mix Hard-
core casting
comBinations
Prmasrar-crcastingmaterial and hARd-CoReBLue
solution ensure a uniform mixturevrytim.Simplyatblsolution to the zip-top baganknawitbtansntilsmt.Tn,printprepared impression area.
catalog no. description price
HCB2001 HARD-COREBLUECastingMaterial,3lbs.(1.36kg) $16.95
HCB2002 HARD-COREBLUESolution,24fl.oz.(709.56ml) $4.95HCB3001 HARD-COREBLUECastingMaterial,9lbs.(4.08kg) $29.25
HCB3002 HARD-COREBLUESolution,72fl.oz.(2.13L) $7.75
HCB4001 HARD-COREBLUECastingMaterial,50lbs.(22.68kg) $69.95
catalog no. description price
HCB100Z ZIP-MIX Casting Cmb (3 lbs. material, 24 z. slutin) $13.95
HCB100 ZIP-MIX Casting Cmb (6 lbs. material, 48 z. slutin) $25.95
HCB100Z CONTENTS:
- HCB100Z2.2 HARD-CoRE Casting Material,3 lbs. (1.36kg)
- HCB400Z HARD-COREBLUESlutin,24 fl. z. (709.56ml)
This cmbinatin is enugh fr tw ftprintsr a partial tire track)
Hard-CorE BLuE
Pcts
Hard-core BlUe dental stone casting material
hARd-CoReBLue casting material and solution are sold in premeasuredamounts required for mixing.
HCB100 CONTENTS:
- N. HCB100Z 4.4 HARD-CoRE CastingMaterial, 6 lbs. (2.72kg)
- N. HCB2002 HARD-COREBLUESlutin,48 fl. z. (1.42L)
No.HCB3001
No. HCB2002
No. HCB2001
No.HCB3002
-
7/29/2019 Impression Evidence.pdf
11/20
27PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266
Impessin
Evience
catalog no. description price
639HCB HARD-CoREBLUETireandFootprintCastingKit $306.50
Hard-core BlUe tire and Footprint casting Kit
Tiscmpltkitinclstmatrialsanspplisfrcastingtiranfootprint impressions at the crime scene. hARd-CoReBLuecastingmaterial is provided to permit detailed reproduction of impression evidence.Rsltingcastsarrck-aranrqirnrinfrcmnt.ustiskitfrrecovery of impressions found in snow, mud, sand and soil.
A cast mad with HARD-CORe BLue casting matrial is flly-crdin approximatly 30-45 mints.
639HCB CONTENTS:
1-HCB2001HARD-COREBLUECastinMaterial, 3 lbs. (1.36kg)
1-HCB2002HARD-COREBLUEMixinSlutin, 24 fl. z. (709.56ml)
1- KCP155 Spatula, 7 (17.8cm), Steel B
1- EPS30W Pht Evidence Rulers, 10 e25- 608E01 Evidence Tags with Ties
1- STM1003 Mdeling Clay, 1/4 lb. (113
1- 638CA Aersl Dust & Dirt Hardener,Net Wt. 15 z. (425g)
1- SRA10 Aersl Silicne Rubber ReleaAgent, 4.5 z. (133ml)
1- 642C Flexible Mixing Bwl, 4.25 (10
1- 643C Flexible Mixing Bwl, 4.75 (12
1- 644C Flexible Mixing Bwl, 5.25 (13
1- SP1000 Snw Impressin Wax,Net Wt. 15 z. (425g)
1- FCF100 Adjustable Casting Frame,7.25 x 12-18 (18.4cm x 30.5cm-45.7cm)
2- 639C4 Base Builder, 8 z. vl. (236ml
1- KCP200 Surface Brush
1- SK900 Tape Measure, English/metric ft. (30m)
1- KCP142 Steel Mixing Spn
1- 639HCBC Black Mlded CplymerCarrying Case w/Flding Handle, LckLatches; Dimensins: 17 x 13 x 7.3(43.2cm x 33cm x 18.7cm);Weight: 22 lbs. (10kg)
Shp online t:
www.sichie.cm
Emil us t:
Hard-CorE BLuE
Pcts
-
7/29/2019 Impression Evidence.pdf
12/20
Impessin
Evience
276 SIRCHIE Tradition. Expertise. Excellence. Web: www.sirchie.co
catalog no. description price
CSP1000 Master HARD-CoREBLUEandLiquidSiliconeCastingKit $339.95
Silicon cast of a sho printfond at a crim scn.
master Hard-core BlUe and
liQUid silicone casting Kit
Tiscmpltfilkitcntainsalltmaterials necessary to recover most forms ofimpression evidence found at crime scenes.Frmtlmarksttirtracks,tiskitffrsfficint,trgvinccllctin.Tflxibilityftiskitbcmsvintwnconfronting various environmental situations.
Hard-CorE BLuE
Pcts
CSP1000 CONTENTS:
1-HCB2001HARD-COREBLUECastingMaterial, 3 lbs. (1.36kg)
1-HCB2002HARD-COREBLUEMixingSlutin, 24 fl. z. (709.56ml)
1- KCP155 Spatula, 7 (17.8cm), Steel Blade
1- EPS30W Pht Evidence Rulers, 10 ea.1- EIL01R SIRCHSEAL Label Rll
5- 608E01 Evidence Tags with Ties
1- STM1003 Mdeling Clay, 1/4 lb. (113g)
1- 638CA Aersl Dust & Dirt Hardener,Net Wt. 15 z. (425g)
1- 634C Liquid Silicne Rubber, 1 lb. (454g)
1- SRA10 Aersl Silicne Rubber ReleaseAgent, 4.5 z. (133ml)
1- TM1 Vial f Catalyst
1- 636C Silicne Rubber Thinner, 16 z.(473ml)
1- 642C Flexible Mixing Bwl, 4.25 (10.8cm)
1- 643C Flexible Mixing Bwl, 4.75 (12.1cm)
1- 644C Flexible Mixing Bwl, 5.25 (13.3cm)1- SP1000 Snw Impressin Wax,
Net Wt. 15 z. (425g)
2- 639C4 Base Builder, 8 z. vl. (236ml)
1- FCF100 Adjustable Casting Frame,7.25 x 12-18 (18.4cm x 30.5cm-45-.7cm)
1- KCP200 Surface Brush
1- SK900 Tape Measure, English/metric100 ft. (30m)
1- KCP142 Steel Mixing Spn
1- CSP1000C Black Mlded CplymerCarrying Case w/Flding Handle, LckingLatches; Dimensins: 17 x 13 x 7.375(43.2cm x 33cm x 18.7cm);
Weight: 24 lbs. (10.9kg)
Shp online t:
www.sichie.cm
Emil us t:
-
7/29/2019 Impression Evidence.pdf
13/20
27PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266
Impessin
Evience
No. uPS100(camra not incldd).
Th No. uPS100 otprforms cmbrsotripodsand th ntir nit disassmbl
sconds!
uPS100 SPECiFiCaTiONS:
Frame Interir Area:12.75 x 14.875(32.4cm x 37.8cm)
Adjustable Extensin Arm:9.5-16 (21.4cm-40.6cm)
Ttal Weight: 5.9 lbs. (2.7kg)
catalog no. description price
BIF100 BIo-FoAM Impressin Kit $5.95
BIF101 BIo-FoAM Impressin Kits (case f 24) $135.95Rslting cast mad with
No. SNC42 Shak-N-Cast.
Bio-Foam impression system
hrsaqickanasysystmfmakingfootwear impressions without damaging orcntaminatingtftwar.Simplyprssthe footwear onto the BIo-FoAMsurface, spray on a thin coating ofArsldst&dirtharnr(Cat.N.638CA),antnmixanprinSak-N-Cast(N.SNC42)ray-
to-use casting material.Tismaksaprmanntimprssinftftwar.Thigh-density foam provides extremelyfintailancmspackaginaslf-storing cardboard container.
Tie n Ftpint Csting
Universal evidence pHoto stand
SIRCHIEsunivrsalPtevincStanisanxcllntaltrnativttraitinalcmbrsmcamratrips.Tisptstanliminatstproblem of tripod legs showing up in evidential photographs. It featuresfll-lngtenglis(N.uPS100)rMtric(N.uPS100M)ptscalson all four sides.
Ttrframiscnstrctfstrystlwitamattblackwrinklcatfinis,antajstablptscalmntsarplisstl.Tnitalsfatrsatlscpingprfssinal-tycamramnt.TunivrsalPtevincStanisstryngtspprtmstigitalananalgcamraspt2.5lbs.(1.1kg).Tunit can be assembled and disassembled in seconds for easystorage and transport.
Tvincscalsarprintnmagnticstripsfrasyrplacmnt.Tfrntanbackscalsarmntnsliingscalmntsfrasyajstmnttcvrtevidence being photographed.
catalog no. description price
UPS100 UniversalEvidencePhotoStandw/EnglishScales $249.50
UPS100M UniversalEvidencePhotoStandw/MetricScales $249.50
UPS101W MagneticScaleSet,White,English,4each $5.95
UPS102W MagneticScaleSet,White,Metric,4each $5.95
UPS101B MagneticScaleSet,Black,English,4each $5.95
UPS102B MagneticScaleSet,Black,Metric,4each $5.95
-
7/29/2019 Impression Evidence.pdf
14/20
searcH rUBBer/gel Footprint liFters
TSeARChRbbr/GeLFtprintLiftrsarniqlysigntallwfor an accurate transfer of foot or footwear prints from dusty and/or dirtysrfacs.Tyarparticlarlysflwnalingwitligtlycvrsrfacsbcastyntgnratstaticlctricitylikstanarliftingtaps.Tw6x15rbbrftprintliftrsnblackannwit.
Ftpint Csting n Lifting
Footprint residUe liFters
Tsniqliftingvicsarcatwitspr-snsitivacrylicasivfrliftingtmstmintparticls.Simplyrmvtasivprtctr,applyttara,liftanmntnbackingmatrialsppliwitacliftr.Liftrsar6x15anarsppliinapackagf12.Liftrsarsppliwittwlv6x15x0.010transparntplasticbackingsts.
catalog no. description price
FR001 Ftprint Residue Lifters, 12 each $24.25
catalog no. description price
647C100 Rubber/GEL Ftprint Lifters (1 white, 1 black) $19.95
No. FR001
No. 647C100
Impessin
Evience
278 SIRCHIE Tradition. Expertise. Excellence. Web: www.sirchie.co
sircHtraK tire tread and FootWear
print-oUt system
Taccratlycmpartirprintvinc,ttracklftbytsspcttirslbrcrnrtprssrftvicl.SIRChTRAKisaneasy-to-use drive over system that gives a permanent record of the tirenrla,makingcmparisnstcastsan/rptgrapsmrrliablanliminatingstingrinkingftirstbxamin.
HOW IT WORKS:SimplylayastfSIRChTRAKntimprssinbaranrivtviclvrit.Tprssrfttirnrlacasstintrlavcarbncarrirttransfrttasiv-catrcivrst.Simplypl
off the carbon carrier and discard.
BENEFITS:unlikcnvntinalmtsfmakingtsttracks,ttirtread imprints are exact, uniform, high-contrast reproductions which becomeanaccratsignatrftsspcttir.TSIRChTRAKprinttisperfect for comparison purposes and ultimate courtroom presentations.
1.Driv th vhicl with th sspcttir trad ovr a sht of SIRCHTRAK
attachd to th imprssion board.
2.Prssr of th tir ndr load transfrsth carbon carrir to th adhsiv-coatd
rcivr sht. Simply pl off carrir anddiscard.
HoW sircHtraK
WorKs:
POiNTS OF COMPaRiSON:
IRCHTRAK enables the investigatr tmre precisely examine the fllwing pints fmparisn:
. overall tread design
. Dimensins between ridges and sectins
. Psitins f ridges relative t ne anther
.Unusualwear,markingsanddistinctivefeatures
. Amunt and type f wear
STT100 CONTENTS:
0- STT103 SIRCHTRAK Print-out Sheets
1- STT102 SIRCHTRAK Impressin Bard,13 x 19 (33cm x 48.3cm)
1- STT101 Sheet f Fam Rubber Material frshe print impressins, 11 x 17 (27.9cmx 43.2cm)
catalog no. description price
STT100 SIRCHTRAK System $99.50
-
7/29/2019 Impression Evidence.pdf
15/20
ezid stainFree FootWear system
Up until now the choices for recording actual shoe print evidence tocmparagainstliftimprssinsavbnlimit.Twftmrpplarmtsinvlvrllingfingrprintinkntslftsantransfrringittpaprrapplyingblackfingrprintpwrttsl,antntransfrringittanasiv-catsrfac.Btmtscratqitamssbtbfrtakingtimprssinanclaning-paftrwar.
After months of research, development and testing a completely newformulation,SIRCHIE is proud to introduce the new EZID StainfreeFootwear Sste asystmtatprcsqalityimprssinswitttmssyclan-p!
TnweZIdsystmcnsistsof a pre-impregnated stainfreepad and pre-sensitized impression
cars.Mrtan200ftwarimprssinscanbtaknfrmasingleZIdstainfrpa.Ansincninkisvisiblntsurface it is applied to, no cleanupisncssary.Pls,trvrssiof the impression cards are printedwith an impression evidencereport for recording all pertinentinformation.
TeZId400kitistialtlfruse in the crime laboratory or atthe crime scene and is excellent for
elimination of prints on-the-spot.It is simple to use and can recordeven the smallest details of wearantarfnnftwar.Tmost outstanding feature is thatthere is no messy cleanup afterimprssinsartakn.
catalog no. description price
EZID400 EZID Stainfree Ftwear Impressin System $79.50
EZID402C Inkless Impressin Cards, 5 1/2 x 16 1/2, 200 each $44.95
Info Sid
The Dst Pint Lifte Cmpnin!
EZid400 CONTENTS:
1- EZID402 Pre-impregnated Inkless ImprePad, 6 3/4 x 16 3/4 (17.1cm x 42.5cmGd fr 250-300 Impressins
1- EZID402C Preprinted Inkless She Impsin Cards, 5 1/2 x 16 1/2, (14cm x 4200/pack
1- KCP212 Mlded Plyprpylene CarryinCase; Dimensins: 17 1/2 x 7 3/4 x 2(44.5cm x 19.7cm x 6cm)
Stp 2. Plac clan sho on top ofimprssion pad, rolling from hl to t
The EZID STAINFRE
FOOTWEAR
ImPRESSION SySTEm
pvides spei es
with bsltelyNo MESS!
Stp 1. Fill ot information sid of car
Stp 3. Plac card with nprintdsid p on a smooth srfac. Plac
sho on top of imprssion card androll from hl to to. Allow p to
5 mints for dvlopmnt.
Imprssion Sid
Ftpint Csting n Lifting
27PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266
Impessin
Evience
-
7/29/2019 Impression Evidence.pdf
16/20
dst Pint Lifting
No. eSP900 elctrostaticDst Print Liftr
tHe electrostatic dUst print liFter
onftmstvrlkfrmsfpysicalvincattcrimscn
isimprssinvinc.Tisislarglytalackfspcifictrainingintproper search, collection and preservation techniques and procedures.
Locating and recovering obvious impressions from mud, dirt or blood areusually accomplished, but dust prints found in many indoor crime scenes areftnvrlkanmanytimsamagrblitrat.
BysingtelctrstaticdstPrintLiftr,printslftintstfaflr,ligtsilfrmacriminalsss,rimprssinsmanvrlkarasscas
dusty walls or doors can be recovered.
TelctrstaticdstPrintLiftrcnsistsfaigvltagpwrspply/cntrlnit,anickl-platstlgrnplananamtalizliftingmim.olrlctrstaticmlsrqirtsftwliftingmatsnpsitivlycharged and one negatively charged. Our latest electrostatic lifter uses only
one metalized plastic sheet and a metal ground plane. As high voltage isapplittliftingmat,ittaksnangativcargantgrnplanbcmspsitiv.Anystprsntnrtmatwilltaknapsitivcharge and will then be attracted to the negatively charged collection mat. Adust print that is transferred to the lifting mat will appear as a precise mirrorimage of the original print and lifts made from rough-surfaced floor tile orirrglarflringfanykinarfacilitatsingtismt.
Prints from vrtical srfacs,as sn abov, can also b liftd
with th No. eSP900.
Th typical st-p for liftingdst prints lik th rslting on abov is
dpictd to th right sing thNo. eSP900 on a vrtical srfac.
catalog no. description price
ESP900 Electrstatic Dust Print Lifter Kit $619.00
ESP901 Lifting Mats, 2 x 3, 5 each $15.50
ESP902 Lifting Mats, 2 x 3, 10 each $29.50
ESP905 Rll Lifting Material, 12 x 25 rll $16.25
ESP906 Rll Lifting Material, 12 x 50 rll $26.00
ESP909 Evidence Bx, Lifting Mat, 39 x 27 x 1, 10 each $29.95
The Electsttic Dst Pint Lifte Pdcing mzing
eslts n viety f sfces.
No. eSP900 Kit
SP900 CONTENTS:
-ElectrostaticVoltageControlUnit- Grund Plane, nickel-plated steel, 4 x 6
(10.2cm x 15.2cm)
- Grund Plane Plycarbnate InsulatingSheet, 5 x 7 (12.7cm x 17.8cm)
- Insulated Rller
- 9V Alkaline Battery
- Technical Infrmatin
- Static Discharge Cable
- ESP901T Metallized Lifting Mats in prtec-tive tube, 5 ea.
- Black Mlded Cplymer Case; Dimensins:12.25 x 9 x 3.875 (31.1cm x 22.9cm x9.8cm)
Impessin
Evience
280 SIRCHIE Tradition. Expertise. Excellence. Web: www.sirchie.co
-
7/29/2019 Impression Evidence.pdf
17/20
28PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266
Impessin
Evience
dUrocast impression
comp0Und
Frcntryfanyprmisssallyisaccomplished with the aid of toolsrjimmyingvics.Tinntatinslftby these tools should be preserved usingSIRCHIEs duRoCAST ImpressionCmpn.Tptty-likcnsistncyenables impression castings on vertical orhorizontal surfaces. Castings may be madeftlmarks,firingpinmarksanbrcfacmarks,witxacttail.
Tisisnftmstaccratprctsavailable for impression reproductions andiscapablfrprcingtinkptfu.S.paper currency. It is ideal for reproducing impressions in metals,wood, plastic and paper.No rELEaSE aGENT rEQuIrED For SEParaTIoN.Itsslflifismrtan2yarsinatigtlysalcntainr.Cmpn
inclsaN.doC100Smasringscp.Castingsrmainflxiblinfinitly.Nn-txicwitast-ptimf8-12mints.
Actal cast of th ink dpthof a $20-bill.
catalog no. description price
DOC1000 DUROCASTImpressionCompoundKit $89.50
Tl Mk Impessin
recvey
Cast of hammr claw.
catalog no. description price
DoC101 Cmpund w/Catalyst and scp, 23.28 z. (660g) $69.50
DoC330 Cmpund w/Catalyst and scp, 11.64 z. (330g) $25.50
2.Flattn bas matrial in palm ofhand and mak indntation with ovrtr
scoop.
3. Sqz a lin of catalyst th lngthindntation and mix thoroghly with ha
4.Prss compond into th imprssioRmov aftr 8-12 mints.
mixing procedUre
1. us on lvl scoop of bas matria
dUrocast
impression
compoUnd Kit
duRoCASTimprssin
casting compound highlightstiscnvnintfilkit.Extremely fine detail isavailable for impressionsranging from striations on abullet casting to a footprint inhardened concrete.
dOC1000 CONTENTS:
1-DOC1001CDUROCASTImpressionCpund, 23.28 z. (660g)
1-DOC100CDUROCASTImpressionCopund Catalyst, 5g
1- DoC100S Plastic Measuring Spn
1- DoC1 Carrying Case, Texturized MldePlastic; Dimensins: 12.125 x 7.25 x (30.8cm x 18.4cm x 14cm);Weight: 3.72 lbs. (1.7g)
-
7/29/2019 Impression Evidence.pdf
18/20
Impessin
Evience
282 SIRCHIE Tradition. Expertise. Excellence. Web: www.sirchie.co
miKrosil casting material Kit
When casting small details that need high-contrast for microscopicexaminations, use the MIKRoSIL Casting Material method. It consists of twoasy-t-stbs,mixingpaanwnspatla.Tlargtbcntainsputty material (availablinbrwn,gray,blackanwit)antsmallrtbcntainscatalyst.Brwnangrayarprfrrbytlmarkxaminrswilwitanblackarstliftstlatntfingrprintsfrmrgrtextured surfaces.
catalog no. description price
MCM100B MIKRoSIL Casting Material Kit, Brwn $26.95
MCM100BL MIKRoSIL Casting Material Kit, Black $26.95
MCM100G MIKRoSIL Casting Material Kit, Gray $26.95
MCM100W MIKRoSIL Casting Material Kit, White $26.95
MCM100CA MIKRoSIL Catalyst $5.95
MIKROSIL sd to lift latnt prints from a txtrdvinyl srfac.
MIKROSIL sd to cast a door jam whr a pry bar wassd to gain ntry.
1.Masr ot lngths of bas andcatalyst. (Not that catalyst is slightly
shortr than bas).
2.Mix thoroghly.
3.Apply to th srfacth cast will b mad from.
HoW to Use
miKrosil:
Tool mark fond at crim scn.
4.Aftr pling th cast from th srfac,compar with sspctd tool.
Tl Mk Impessin
recvey
CONTENTS:
1- MCM100 Mikrsil Casting Material, 7 0z.(198g), Spcify color whn ordring
1- MCM100CA Catalyst5- Wden applicatr sticks
5- White plastic mixing cards
-
7/29/2019 Impression Evidence.pdf
19/20
28PHONE: (800) 356-7311 (919) 554-2244 FAX: (800) 899-8181 (919) 554-2266
Impessin
Evience
catalog no. description price
DSP100 TexturLift MIKRoSIL Kit $116.50
textUrliFt miKrosil Kit
dvlpinglatntprintsntxtrsrfacsissallyntaifficlttask,btliftingtsprintsis.TTxtrLiftKitprvisasimpl-t-smttatpermits lifting prints from difficult surfaces such as computers, automobileassanintrirsipanls,latrgs,lggag,tc.Tkitalssimplifies lifting prints left in soft material such as wet paint, putty aroundwindows, clay, etc.
TTxtrLiftKitcnsistsfawitMikrsilKit,mixingmatrials,acmbinatinfingrprintpwr(N.SB201L)sablnvirtallyanysrfac,a PrintMaticInkPa(N.PFP602)anakit-sizFibrglassBrs(N.122L1).
HoW to liFt print
From textUred
sUrFaces:
1. Latnts ar dstd on crmpldplastic bag.
2. Lifting compond is mixd and applidlatnts. Allow 10-15 mints to st p.
3. Rsltant lift.
dSP100 CONTENTS:
1- SB201L Silver/Black Latent Print Pwd2 z. (59ml)
1- 122L1 Fiberglass Brush
1- MCM100W Mikrsil (white putty),7 z. (23ml) w/MCM100CA MikrsilCatalyst
1- PFP602 PrintMatic Ink Pad
1- LB002 Glss White Backing Card Pad, x 4 (5.7cm x 10.2cm), 50 sheets
5- Wden Applicatr Sticks
5- White Plastic Mixing Surface Cards
1- DSP100C Black Mlded Cplymer CaCase w/Flding Handle, Lcking Latcheand Mlded Inserts;Dimensins: 12.6875 x 8.9375 x 4.75(32.2cm x 22.7cm x 12.1cm);Weight: 2.6 lbs. (1.2kg)
Tl Mk Impessin
recvey
t M smp--U Md f
lfng Pn fm Dffcu sufac!
-
7/29/2019 Impression Evidence.pdf
20/20
Impessin
Evience
all-pUrpose evidence recovery Kit
TAll-PrpsevincRcvryKitffrsaniqmtfmixinganapplyingliqisilicnfrtcllctinftlmarks,bitmarks,blprints and even developed latent fingerprints.
TPVS200liminatstmssangsswrkbyatmaticallymixingt
exact proportions needed. Just squeeze the trigger and the two compoundsare forced through a mixing tip and dispensed onto the surface.
Tisincriblfrmlaistprfctmtfrliftingpwrlatntprintsfrmtxtr,irrglarrcrvsrfacs.Ttransparntfrmlaenables direct viewing of the print. Opaque formulas produce a reversedimage. In many instances, transparent prints may be placed directly onto a
flatbed scanner and scanned into a computer.
catalog no. description price
PVS200 All-Purpse Evidence Recvery Kit $199.50
PVS200W Replacement White Dual Cartridge, 75ml $27.50
PVS200B Replacement Brwn Dual Cartridge, 75ml $27.50
PVS200T Replacement Transparent Dual Cartridge, 75ml $27.50
PVS200NT Replacement Spreader Tips, 40 ea. $36.67
PVS200N Replacement Nzzles, 40 ea. $34.76
HoW pvs200
WorKs:
STEP 1:Latnt print is dvlopdon a soda can with SB201L
Silvr/Black Latnt Print Powdr.
STEP 2:Apply th siliconmatrial to th srfac with thextrdr Gn and allow to stp
4-6 mints.
STEP 3: Th rsltant lift pldfrom th can. Print will not rb
off th lift.
Powdr dvlopd latnt print is liftd from qartr withintricat dtail.
Tool mark lft bhind in wood is cast sing th browncompond of PVS200.
Tl Mk Impessin
recvey
PVS200 CONTENTS:1- PVS200EG Extruder Gun
4- PVS200N1 Mixing Nzzles
2- PVS200NT1 Spreader Tips
1- PVS200W White Dual Cartridge, 75ml
1- PVS200B Brwn Dual Cartridge, 75ml
1- PVS200T Transparent Dual Cartridge, 75ml
0- PVS200AS Applicatr Sticks
1- Mlded Plastic Carrying Case w/pre-cutinsert; Dimensins: 14 x 10 x 3 5/8(35.5 x 25.4cm x 9.2cm)Weight: 2.85 lbs. (1.3kg)