Transcript
Page 1: Multiple sequence alignment MSA

Multiple sequence alignmentMSA

Page 2: Multiple sequence alignment MSA

What is MSA• Comparison of many (i.e., >2) sequences• local or global

Page 3: Multiple sequence alignment MSA

Why MSA• Biological sequences often occur in families. Homologous

sequences often retain similar structures and functions.• related genes within an organism• genes in various species• sequences within a population (polymorphic variants)

• MSA reveals more biological information than pairwise alignment• two sequences that may not align well to each other can be aligned

via their relationship to a third sequence, thereby integrating information in a way not possible using only pairwise alignments

Page 4: Multiple sequence alignment MSA

Edgar R.S. et al. Peroxiredoxins are conserved markers of circadian rhythms. Nature 2012 485(7399):459-64

Page 5: Multiple sequence alignment MSA

Edgar R.S. et al. Peroxiredoxins are conserved markers of circadian rhythms. Nature 2012 485(7399):459-64

Page 6: Multiple sequence alignment MSA

Why MSA• Can be a reasonable way to infer gene function• Characterize protein families by identifying shared regions

of homology (conserved regions called motifs), such as active sites

• Determine the consensus sequence of several aligned sequences

• Establish relationships and phylogenies

Page 7: Multiple sequence alignment MSA

What is a sequence motif?• A short conserved region in DNA, RNA or protein

sequence• simple combinations of secondary structure elements• motif = supersecondary structure• in proteins, structure motifs usually consist of just a few elements;

e.g., the 'helix-turn-helix' has just three• Corresponds to a structural or functional feature in

proteins• Shared by several sequences, can be generated by MSA

Page 8: Multiple sequence alignment MSA

Examples of motifs

beta hairpin

greek keyhelix-loop-helix

Page 9: Multiple sequence alignment MSA

What is a protein family?• A protein family is a group of evolutionarily-related

proteins.• Proteins in a family descend from a common ancestor and

typically have similar three-dimensional structures, functions, and significant sequence similarity.

• Members of a protein family may range from very similar to quite diverse.

• Currently, over 60,000 protein families have been defined, although ambiguity in the definition of protein family leads different researchers to wildly varying numbers

Page 10: Multiple sequence alignment MSA

What is a protein family?• the use of protein family is somewhat context dependent• A common usage is that superfamilies (structural

homology) contain families (sequence homology) which contain sub-families.

• Example: superfamily PA clan• the largest group of proteases with common ancestry as identified

by structural homology• has far lower sequence conservation than one of the families tit

contains, the C04 family

Page 11: Multiple sequence alignment MSA

http://en.wikipedia.org/wiki/PA_clan

Page 12: Multiple sequence alignment MSA

PA clan structure

the double-beta barrel motif

Page 13: Multiple sequence alignment MSA

Pfam - http://pfam.sanger.ac.uk/• Database of protein families that includes their

annotations and multiple sequence alignments 

Page 14: Multiple sequence alignment MSA

What is a domain• Families often share domains. Domain is a part of a

protein, and is greater than a motif.• Domain is formed by several motifs packed together.• i.e. domain = tertiary structure• Domain - a conserved part of a given protein sequence

and structure that can evolve, function, and exist independently of the rest of the protein chain

• One domain may appear in a variety of different proteins• Molecular evolution uses domains as building blocks and

these may be recombined in different arrangements to create proteins with different functions

Page 15: Multiple sequence alignment MSA

Pyruvate kinase domains

http://en.wikipedia.org/wiki/Protein_domains

Page 16: Multiple sequence alignment MSA

Sequence logo

Conserved: BIG letters with few others in that space

Divergent: small letters with many others in that space

Page 17: Multiple sequence alignment MSA

Logo and alignment reflect each other

Page 18: Multiple sequence alignment MSA

Doing MSA• As with aligning a pair of sequences, the difficulty in

aligning a group of sequences varies considerably with sequence similarity.

• If the amount of sequence variation is minimal, it is quite straightforward to align the sequences, even without the assistance of a computer program.

• If the amount of sequence variation is great, it may be very difficult to find an optimal alignment of the sequences because so many combinations of substitutions, insertions, and deletions, each predicting a different alignment, are possible.

Page 19: Multiple sequence alignment MSA

Challenges of the MSA• Finding an optimal alignment of more than two sequences

that includes matches, mismatches, and gaps, and that takes into account the degree of variation in all of the sequences at the same time poses a very difficult challenge.

• A second computational challenge is identifying a reasonable method of obtaining a cumulative score for the substitutions in the column of an MSA.

• Finally, the placement and scoring of gaps in the various sequences of an msa presents an additional challenge.

Page 20: Multiple sequence alignment MSA

MSA algorithms• As with the pairwise sequence comparisons, there are two

types of multiple alignment algorithms• optimal• heuristic

Page 21: Multiple sequence alignment MSA

Optimal algorithms• Extension of dynamic programming to multiple sequences• Exhaustive search• Produce best alignment• Computationally expensive• Not feasible for n>10 sequences of length m>200

residues

Page 22: Multiple sequence alignment MSA

Heuristic algorithms• Limit the exhaustive search• Attempt to rapidly find a good, but not necessarily optimal

alignment• Most popular methods:

• progressive methods (ClustalW)• start from the most similar sequences and progressively add new

sequences• iterative methods (MUSCLE)

• make initial crude alignment, then revise it

Page 23: Multiple sequence alignment MSA

Progressive sequence alignment• The most commonly used algorithm, the most commonly

used software ClustalW• Popularized by Feng and Doolitle, often referred by these

two names.• Permits the rapid alignment of even hundreds of

sequences.• Limitation: the final alignment depends on the order in

which sequences are joined.• Not guaranteed to provide the most accurate alignments.

Page 24: Multiple sequence alignment MSA

ClustalW• http://www.clustal.org • http://www.ebi.ac.uk/Tools/msa/clustalw2/• EMBOSS – a free open source software analysis package

(European Molecular Biology Open Software Suite) - http://emboss.sourceforge.net• Program emma is a ClustalW wrapper• A variety of EMBOSS servers hosting emma are available, e.g.

http://embossgui.sourceforge.net/demo/emma.html• ClustalX – a downloadable stand-alone program offering a

graphical user interface for editing multiple sequence alignments• http://www.clustal.org/clustal2/

Page 25: Multiple sequence alignment MSA
Page 26: Multiple sequence alignment MSA
Page 27: Multiple sequence alignment MSA

ClustalW – how it works?

Three stages

Page 28: Multiple sequence alignment MSA

1st stageThe global alignment (Needlman-Wunsch) is used to create pairwise alignments of every protein pair.

number of pairwise alignments

Page 29: Multiple sequence alignment MSA

1st stage• The raw similarity scores are shown. However, for the

next step the distance matrix is needed, and not the similarity one.

• Similarity scores must be converted into distances. • Won't tell you how, believe me, it is doable.

Page 30: Multiple sequence alignment MSA

2nd stage• A guide tree is calculated from the distance matrix.• The tree reflects the relatedness of all the proteins to be

multiply aligned

Newick format

Page 31: Multiple sequence alignment MSA

Guided tree• Guide trees are not true phylogenetic trees.• They are templates used in the third stage of ClustalW to

define the order in which sequences are added to a multiple alignment.

• A guided tree is estimated from a distance matrix of the sequences you are aligning.

• In contrast, a phylogenetic tree almost always includes a model to account for multiple substitutions that commonly occur at the position of aligned residues.

Page 32: Multiple sequence alignment MSA

Construction of guided tree• Unweighted Pair Group Method with Arithmetic Mean

(UPGMA)• A simple hierarchical clustering method• How it works?

http://www.southampton.ac.uk/~re1u06/teaching/upgma/• Neighbor joining

• Uses distance method, distance matrix is an input.• The algorithm starts with a completely unresolved tree (its topology

is a star network), and iterates over until the tree is completely resolved and all branch lengths are known.

Page 33: Multiple sequence alignment MSA

Source: wikipedia

Page 34: Multiple sequence alignment MSA

3rd stage• The multiple sequence alignment is created in a series of

steps based on the order presented in the guide tree.• First select the two most closely related sequences from

the guide tree and create a pairwise alignment.

Page 35: Multiple sequence alignment MSA

3rd stage

Page 36: Multiple sequence alignment MSA

3rd stage

• The next sequence is either added to the pairwise alignment (to generate an aligned group of three sequences, sometimes called a profile) or used in another pairwise alignment.

• At some point, profiles are aligned with profiles. • The alignment continues progressively until the root of the

tree is reached, and all sequences have been aligned.

Page 37: Multiple sequence alignment MSA

Gaps• “once a gap, always a gap” rule• The most closely related pair of sequences is aligned first. • As further sequences are added to the alignment, there

are many ways that gaps could be included.• Gaps are often added to first two (closest) sequences.• To change the initial gap choices later on would be to give

more weight to distantly related sequences.• To maintain the initial gap choices is to trust that those

gaps are most believable.

Page 38: Multiple sequence alignment MSA

Iterative approaches• Progressive alignment methods have the inherent

limitation that once an error occurs in the alignment process it cannot be corrected, and iterative approaches can overcome this limitation.

• Create an initial alignment and then modify it to try to improve it.

• e.g. MUSCLE, IterAlign, Praline, MAFFT

Page 39: Multiple sequence alignment MSA

MUSCLE• Since its introduction in 2004, the MUSCLE program of

Robert Edgar has become popular because of its accuracy and its exceptional speed, especially for multiple sequence alignments involving large number of sequences.

• Multiple sequence comparison by log expectation• Three stages

Page 40: Multiple sequence alignment MSA

MUSCLE

Edgar, R. C. Nucl. Acids Res. 2004 32:1792-1797; doi:10.1093/nar/gkh340

1. Draft alignment

2. Improved alignment

3. Refinement

Page 41: Multiple sequence alignment MSA

MUSCLE online

https://www.ebi.ac.uk/Tools/msa/muscle/

Page 42: Multiple sequence alignment MSA
Page 43: Multiple sequence alignment MSA
Page 44: Multiple sequence alignment MSA

>neuroglobin 1OJ6A NP_067080.1 [Homo sapiens] -------------MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCR QFSSPEDCLSSPEFLDHIRKVMLVI---DAAVTNVEDLSSLEEYLASLGRKHRAVGVKLS SFSTVGESLLYMLEKCLGPA-FTPATRAAWSQLYGAVVQAMSRGWDGE---- >rice_globin 1D8U rice Non-Symbiotic Plant Hemoglobin NP_001049476.1 [Oryza sativa (japonica cultivar-group)] MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSF-LR NSDVP--LEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDA HFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE--- >soybean_globin 1FSL leghemoglobin P02238 LGBA_SOYBN [Glycine max] ----------MVAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSF-LA NGVDP----TNPKLTGHAEKLFALVRDSAGQLKASGTVVAD----AALGSVHAQKAVTDP QFVVVKEALLKTIKAAVGDK-WSDELSRAWEVAYDELAAAIKKA-------- >beta_globin 2hhbB NP_000509.1 [Homo sapiens] ----------MVHLTPEEKSAVTALWGKVNVD--EVGGEALGRLLVVYPWTQRFFES-FG DLSTPDAVMGNPKVKAHGKKVLGAF---SDGLAHLDNLKGTFATLSELHCDKLH--VDPE NFRLLGNVLVCVLAHHFGKE-FTPPVQAAYQKVVAGVANALAHKYH------ >myoglobin 2MM1 NP_005359.1 [Homo sapiens] -----------MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDK-FK HLKSEDEMKASEDLKKHGATVLTAL---GGILKKKGHHEAEIKPLAQSHATKHK--IPVK YLEFISECIIQVLQSKHPGD-FGADAQGAMNKALELFRKDMASNYKELGFQG

Page 45: Multiple sequence alignment MSA

MUSCLE vs. Clustal

Q = fraction of correctly aligned residues (pairwise)TC = fraction of correctly aligned columns

Page 46: Multiple sequence alignment MSA

Logo visualization of the alignment• Make a logo from your alignment• Can be easier to compare• Nice graphic• Students love ‘em

• http://weblogo.berkeley.edu/logo.cgi

Page 47: Multiple sequence alignment MSA
Page 48: Multiple sequence alignment MSA

Top Related