![Page 1: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/1.jpg)
Protein structure determination
and our software tools Mark Berjanskii
Edmonton Februrary 2015
![Page 2: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/2.jpg)
Outline
1) X-ray crystallography
2) Cryo-electron microscopy (Cryo-EM)
3) NMR spectroscopy
4) Mass spectrometry
5) MS23D
![Page 3: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/3.jpg)
Why do we need to know protein
structure?
![Page 4: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/4.jpg)
Why do we need to know protein
structures?
1) Prediction of protein function from 3D structure (e.g. fold,
motifs, active site prediction)
2) Mechanism of protein function (e.g. enzyme catalysis,
structural effect of known mutations).
3) Rational drug design
4) Design of novel proteins with novel function. Sequence-to-
function and sequence-to-structure predictions
1) Ubiquitin
- degradation by the proteasome,
2) Ubiquitin-like modifiers
- function regulation by post-translation
modification
![Page 5: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/5.jpg)
X-ray crystallography
![Page 6: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/6.jpg)
X-ray crystallography
Quality metrics: 1) Experimental data: -Number of reflections -Signal to noise ratio 2) Model-to-experiment agreement: - R factor -R free factor
3) Coordinate uncertainty: - B-factor 4) Stereo-chemical normality: - backbone torsion angles (Ramachandran plot) - bond length, angles - side-chain torsion angles
![Page 7: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/7.jpg)
X-ray Resolution
Minimum spacing (d) of crystal lattice planes that still provide measurable diffraction of X-rays. Minimum distance between structural features that can be distinguished in the electron-density maps.
High resolution Low resolution High resolution
Low resolution
200,000 reflections
500 reflections Many reflections Few reflections
![Page 8: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/8.jpg)
Resolution and protein quality
![Page 9: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/9.jpg)
X-ray resolution by proxy
ResProx would be able to detect
most of the withdrawn X-RAY
structures from the Murthy lab
ResProx vs X-ray resoltion
![Page 10: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/10.jpg)
Number of protein structures
per year
![Page 11: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/11.jpg)
Cryo-electron microscopy
(Cryo-EM)
![Page 12: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/12.jpg)
Cryo-electron microscopy
Image formation in the electron
microscope.
(a) Electrons, emitted by a source that is
housed under a high
vacuum, are accelerated down the
microscope column . After passing through
the specimen, scattered electrons are
focused by the electromagnetic lenses of
the microscope
(b) Schematic illustrating the principle of
data collection for electron tomography. As
the specimen is tilted relative to the
electron beam, a series of images is
taken of the same field of view.
(c) Rendering of selected projection views
generated during cryo-electron tomography
![Page 13: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/13.jpg)
3D image from Cryo-EM
![Page 14: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/14.jpg)
Examples of Cryo-EM images
(a,b) Illustration of spiral architecture of
the nucleoid in Bdellovibrio
bacteriovorus showing
(a) a 210 Å thick tomographic slice
through the 3D volume of a cell
(b) a 3D surface rendering of the same
cell, with the spiral nucleoid
highlighted
(c) Higher magnification view of a
tomographic slice through the cell,
showing well-separated nucleoid
spirals and ribosomes (dark dots)
distributed at the edge of the
nucleoid.
(d) Expanded views of 210 Å thick
tomographic slices, showing top-
views of polar chemoreceptor arrays.
![Page 15: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/15.jpg)
Cryo-EM revolution in structural
biology
![Page 16: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/16.jpg)
Cryo-EM can now achieve a resolution
necessary for de novo structure
determination
![Page 17: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/17.jpg)
Cryo-EM structures <5Å
![Page 18: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/18.jpg)
Examples of “high-resolution”
de novo structures from Cryo-EM
A) transient receptor
potential cation
channel subfamily V
member 1 (TRPV1) ion
channel
B) F420-reducing [NiFe]
hydrogenase
C) large subunit of the
yeast mitochondrial
ribosome
D) γ-secretase.
![Page 19: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/19.jpg)
NMR spectroscopy
![Page 20: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/20.jpg)
Protein NMR spectroscopy Experiment Spectra processing Spectra assignment
NOE assignment
Distance restraints
Model generation
![Page 21: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/21.jpg)
Resolution of NMR structures
Macromolecular NMR spectroscopy for the non-spectroscopist. Kwan AH, Mobli M, Gooley PR, King GF, Mackay JP. FEBS J. 2011 Mar;278(5):687-703
![Page 22: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/22.jpg)
Protein NMR structures from
Wishart group 2B0F
Human Rhinovirus
3C Protease
1DE1
Oxidized bacteriophage
T4 glutaredoxin.
1DE2
Reduced bacteriophage
T4 glutaredoxin.
1NHO
Thioredoxin-like protein
(Mt0807)
1Z9V
MTH0776
![Page 23: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/23.jpg)
Secondary structure from NMR chemical
shifts PANAV
s
CSI
![Page 24: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/24.jpg)
Torsion angles from NMR
chemical shifts
![Page 25: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/25.jpg)
Accessible surface area from
NMR chemical shifts
![Page 26: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/26.jpg)
Prediction of NMR chemical
shifts from structure
![Page 27: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/27.jpg)
Protein model building from NMR data
![Page 28: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/28.jpg)
Validation of NMR protein models
![Page 29: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/29.jpg)
Mass-spectrometry
![Page 30: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/30.jpg)
Distance restraints from MS cross-
linking experiments
Distance restraints
Model generation
![Page 31: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/31.jpg)
Residue accessibility by MS
limited proteolysis
![Page 32: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/32.jpg)
Secondary structure localization
by MS HD exchange
![Page 33: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/33.jpg)
Problem Many structural solutions may be compatible
with few restraints and solvent exposure info
1 restraint
2 restraints
3 restraints
Trypsin-inhibitor complex (1TAB)
Lys222E-Lys16I, Lys224E-Lys16I, and
Lys60E-Lys31I (21Å links)
Probing native protein structures by chemical cross-
linking, mass spectrometry and bioinformatics. Leitner A,
Walzthoeni T, Kahraman A, Herzog F, Rinner O, Beck M,
Aebersold R. Mol Cell Proteomics. 2010 Mar 31.
![Page 34: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/34.jpg)
How many distance restraints
do we need?
For 2,3,4:
Young, M. M., Tang, N., Hempel, J. C., Oshiro, C. M., Taylor, E. W., Kuntz, I. D., Gibson, B.
W., and Dollinger, G. (2000) High throughput protein fold identification by using
experimental constraints derived from intramolecular cross-links and mass
spectrometry. Proc. Natl. Acad. Sci. U. S. A. 97, 5802-5806
1) Atomic resolution - 10- 20 restraints per residue (NMR)
2) Residue resolution – 3 restraint per residue
3) Fold – 1/10 restraint per residue ( = protein length/10 )
4) Complex of rigid bodies – 3 restraint per complex
5) Experimentally biased comparative / ab initio model – 1 restraint
Distance restraint requirements for different levels of
structure determination
![Page 35: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/35.jpg)
One contact per 12 residues is
enough to model protein topology
![Page 36: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/36.jpg)
MS-based structure determination
requires knowledge-based information
Cross-
links
Residue exposure
Advanced
Force-field:
solvation term
full electrostatic
knowledge-based
potentials
Fragment
information
Homology
information
![Page 37: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/37.jpg)
Disulfide restraints can bias conformational
search for BPTI towards the native state No restraints Three disulfide restraints
Native No restraints
RMSD= 8.2A
3 disulfide restraints
RMSD= 2.14A
BPTI from disulfide distance restraints
![Page 38: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/38.jpg)
PrP 90–232 modeled using the interlysine
cross-link distance constraints.
Mol Cell Proteomics. 2012 Jul;11(7): Use of proteinase K nonspecific digestion for selective and
comprehensive identification of interpeptide cross-links: application to prion proteins.
Petrotchenko EV1, Serpa JJ, Hardie DB, Berjanskii M, Suriyamongkol BP, Wishart DS, Borchers CH.
![Page 39: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/39.jpg)
N-terminus of PrP 68-228 has propensity to interact with the end of helix B, which is the first PrP region to unfold at low pH
HB
HC HA
HC HA HB
HA
HC
pH 5.2 pH 3.2
CA of N-terminal residue Gly68 is shown with blue spheres.
![Page 40: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/40.jpg)
MS-GAMDy
![Page 41: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/41.jpg)
Rigid-body docking in Cartesian space by XPLOR
Monomer A Monomer B
Monomer B backbone optimization
Monomer A backbone optimization
Docking
Dimer backbone optimization
Distances for monomer A
Starting model for monomer A
Distances for monomer B
Starting model for monomer B
Inter distances for dimer
![Page 42: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/42.jpg)
XPLOR rigid-body docking with initial alignment by distance restraints
1 min, 64 structures with no restraint violations from 64
![Page 43: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/43.jpg)
Beta-strand pairing - 5 beta-strands Unknowns: 1) parallel or anti-parallel 2) interacting residues 3) internal or external
Shift Partial coverage
assign ( ( resid 1 OR resid 2 OR resid 3 OR resid 4 OR resid 7 OR resid 6 OR resid 5 ) and name N ) ( ( resid 12 OR resid 13 OR resid 14 OR resid 17 OR resid 16 OR resid 15 ) and name O ) 2.8 0.8 0.2 assign ( ( resid 1 OR resid 2 OR resid 3 OR resid 4 OR resid 7 OR resid 6 OR resid 5 ) and name O ) ( ( resid 12 OR resid 13 OR resid 14 OR resid 17 OR resid 16 OR resid 15 ) and name N ) 2.8 0.8 0.2 assign ( ( resid 1 OR resid 2 OR resid 3 OR resid 4 OR resid 7 OR resid 6 OR resid 5 ) and name N ) ( ( resid 66 OR resid 67 OR resid 68 OR resid 71 OR resid 70 OR resid 69 ) and name O ) 2.8 0.8 0.2 assign ( ( resid 1 OR resid 2 OR resid 3 OR resid 4 OR resid 7 OR resid 6 OR resid 5 ) and name O ) ( ( resid 66 OR resid 67 OR resid 68 OR resid 71 OR resid 70 OR resid 69 ) and name N ) 2.8 0.8 0.2 assign ( ( resid 41 OR resid 42 OR resid 43 OR resid 45 OR resid 44 ) and name N ) ( ( resid 66 OR resid 67 OR resid 68 OR resid 71 OR resid 70 OR resid 69 ) and name O ) 2.8 0.8 0.2 assign ( ( resid 41 OR resid 42 OR resid 43 OR resid 45 OR resid 44 ) and name O ) ( ( resid 66 OR resid 67 OR resid 68 OR resid 71 OR resid 70 OR resid 69 ) and name N ) 2.8 0.8 0.2 assign ( ( resid 41 OR resid 42 OR resid 43 OR resid 45 OR resid 44 ) and name N ) ( ( resid 48 OR resid 49 ) and name O ) 2.8 0.8 0.2 assign ( ( resid 41 OR resid 42 OR resid 43 OR resid 45 OR resid 44 ) and name O ) ( ( resid 48 OR resid 49 ) and name N ) 2.8 0.8 0.2
24 possible arrangements of beta-strands into a beta-sheets via XPLOR ambiguous restraints Example:
RMSD = 0.6A Convergence ~ 20%
![Page 44: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/44.jpg)
Fragment-based modelling
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR
Torsion angle restraints
Distance restraints
CS23D SFAssembler
Homodeller
Starting model pool
Ubiquitin from 2FAZA 4.86A
![Page 45: Protein structure determinationand our software tools](https://reader031.vdocument.in/reader031/viewer/2022020301/58705a8e1a28aba2118b65d9/html5/thumbnails/45.jpg)
Template-derived distance restraints
82 N-O restraints
1UBQ GAMDy model0.6A
Ubiquitin from 2FAZA 4.86A
82 N-O restraints
GAMDy model 4.8A
GAMDy model 2A