Download - Town Cape of
Univers
ity of
Cap
e Tow
n
Repositioning fusidic acid for tuberculosis: semi-
synthesis of analogues and impact of mycobacterial
biotransformation on antibiotic activity
Antonina Wasuna
Supervisor: Professor Kelly Chibale
Department of Chemistry, University of Cape Town
Co-Supervisor: Associate Professor Digby F. Warner
Department of Pathology & Institute of Infectious Disease and Molecular Medicine, University
of Cape Town
A thesis presented for the degree of Doctor of Philosophy in the Department of Chemistry,
University of Cape Town
March 2017
Univers
ity of
Cap
e Tow
n
The copyright of this thesis vests in the author. No quotation from it or information derived from it is to be published without full acknowledgement of the source. The thesis is to be used for private study or non-commercial research purposes only.
Published by the University of Cape Town (UCT) in terms of the non-exclusive license granted to UCT by the author.
i
Declaration
I, Antonina Wasuna, hereby declare that:
i. The above thesis is my own unaided work, both in concept and execution, and that apart from
the normal guidance of my supervisors, I have received no assistance apart from that
acknowledged.
ii. Neither the substance nor any part of this thesis has been in the past, or is being, or is to be
submitted for a degree in the University of Cape Town or any other University.
Signed 22nd March 2017
ii
Acknowledgements
To my supervisors, Professor Kelly Chibale and Associate Professor Digby F. Warner, thank you for taking
a chance on me and for the mentorship you have provided, beyond the enormous scientific knowledge
you have imparted upon me. You have redefined hard work for me, and your patience and guidance
through the constant challenges during this project have left an indelible mark.
I extend my gratitude to the Carnegie Corporation of New York and the Schlumberger Faculty for the
Future Foundation for financial support. I am grateful to Mrs. Elaine-Rutherfoord-Jones, Mrs. Deirdre
Brooks and Ms Saroja Naicker, whose formidable administrative capability made this journey smooth. I
would also like to thank Mr. Pete Roberts for the NMR training, support and recording of spectra. In
addition, I am grateful for the Mass Spectrometry analysis performed by Mr. Gianpiero Benincasa. I
thank Dr. Gurminder Kaur, Dr. Mathew Njoroge, Dr. Nigel Makoah and Ms Natasha Strydom for the
synthesis of several analogues evaluated in this project and provision of pharmacokinetic data. I also
thank Dr. Vinayak Singh for construction of the knockdown mutant strain, and Professors Tom Ioerger
and James Sacchettini (Texas A & M University, USA) for whole genome sequencing of my samples.
To the Medicinal chemistry research group and the MMRU, your generosity, problem-solving skills and
humour made the labs my home away from home. Thank you for the technical, scientific and moral
support, from bench to hospital bedside. Dr. Peter Njogu, Dr. Dennis Ongarora, Dr. Atica Moosa and Dr.
Krupa Naran, and Mr. Charles Omollo, thank you for your unrelenting patience in helping me to settle
into the labs without recourse to the first aid kit. To my friends scattered across the globe, including
many whom I have not mentioned here, your patience and generosity through my long silences and
absence over the years is truly humbling. Tamara Sutila, Gladwell Ng’ang’a, Miriam Maina, Claire Le
Manach, Christel Brunschwig, Teboho Nchaba, Hellen Mahlase, Karabo Kgoleng, Dorothy Semenya,
Tatenda Dinha, Nkulumo Zinyengere, Taigh Anderson, Rachel Piontak, Tewa Oduro, various members of
St. Michael’s Rondebosch community, Wiebke Ringel, Julia Baum, Arlindo Meque, and Natasha Strydom,
thank you for your encouragement to push on. Hvala, ahsante sana, merci, kea leboha, ndinotenda,
thank you, danke schön, obrigada, baie dankie. To the Kenyan “mafia”, ahsanteni sana, for making the
journey more bearable and improving my chapati-making skills. To my Joburg family, wat imedo gi osiep.
Ero kamano ahinya.
Mum and Dad, thank you for your support. I am because you are. Tony, Brian and Nikky Wasuna, you
can finally have “that your sister” back. To the Almighty God be all praise and honour.
iii
Abstract
Tuberculosis (TB), caused by Mycobacterium tuberculosis (Mtb), is one of the leading causes of death
globally, especially in low and middle-income countries. TB is primarily a curable disease, with
chemotherapy predicated on a combination of four drugs. The increase in multiple forms of drug-
resistant TB is a major cause for concern, underpinning the importance of a continuous pipeline of new
anti-TB agents. Drug repositioning – that is, the optimization of existing drugs for new therapeutic
indications – has shown promise in expanding the therapeutic options for TB chemotherapy. Fusidic acid
(FA), a natural product-derived antibiotic, has modest in vitro antimycobacterial activity. Through a
multi-disciplinary approach combining aspects of chemistry and biology, this study investigated the
pharmacological and physicochemical properties of FA that might be exploited for optimization of FA as
a lead compound for TB drug discovery.
FA is a weak carboxylic acid, and it was hypothesised that the carboxylic acid moiety limits its
permeation of the complex mycobacterial cell wall. Therefore, this study aimed to identify novel FA
analogues with improved permeation properties and designed to act as potential prodrugs. By
modifying the C-3 hydroxyl and the carboxylic acid moiety, alkyl and aminoquinoline derivatives were
covalently fused to FA through ester and amide coupling reactions to generate hybrids and/or potential
prodrugs (Figure 1).
Figure 1: Fusidic acid and representative ester and amide derivatives.
iv
Turbidimetric solubility assays revealed that most of the hybrids were 5- to 10-fold less soluble than FA.
Moreover, the resultant amides and esters were found to be less potent than FA. Through the testing of
1:1 physical molar mixtures of the constituent pharmacophores, the contribution of the individual
scaffolds to the antimycobacterial activity of the hybrids was evaluated. The aminoquinoline derivatives
were found to reduce the overall antimycobacterial activity of the FA-aminoquinoline hybrids. The poor
aqueous solubility of these compounds may have precluded the accurate determination of their
antimycobacterial activity, as some of the compounds precipitated out of the aqueous media used for
the drug susceptibility tests. The FA hybrids were also evaluated against two mammalian cell lines and
found to be cytotoxic at very low concentrations. 1:1 physical molar mixtures of the selected
aminoquinoline derivatives and FA revealed that the aminoquinoline scaffold contributed to the
cytotoxicity of the hybrids. This unsatisfactory cytotoxic profile was a basis for the discontinuation of
these hybrids and only the C-3 prodrugs were progressed to subsequent assays.
Mtb is an intracellular pathogen, and in vitro macrophage models of Mtb infection that attempt to
simulate host infection conditions are widely used to assess the efficacy of antimycobacterial
compounds in disease-relevant conditions. FA and selected analogues were evaluated for their
intracellular efficacy, and found to reduce bacterial burden in infected THP-1 cells at concentrations two
or five times higher than their inhibitory concentrations in broth cultures. FA and three ester analogues,
GKFA16, GKFA17 and GKFA61, as well as two amides, AW23 and AW25, were investigated for the role
of mycobacterial metabolism in their efficacy. In Mtb cultures, the two esters were hydrolysed to FA to
achieve a higher concentration of FA than that seen in incubations with FA, suggesting that they are
prodrugs. In contrast, GKFA61 and the two C-21 amides were not hydrolysed to FA in Mtb cultures.
Although the mode of action of FA in other organisms is well-established, there are no published reports
on its antimycobacterial target and mechanism(s) of resistance (MoR). Through the generation of
spontaneous resistant mutants, the target of FA and the corresponding MoR in Mtb were confirmed. A
substitution mutation (H462Y) in the fusA1-encoded Elongation Factor G (EF-G) conferred resistance to
FA and several derivatives. No cross-resistance was observed between FA and other standard anti-TB
drugs in vitro. Notably, the fusA1 mutation conferred slight hypersensitivity to streptomycin, another
v
protein synthesis inhibitor, indicating its potential exploitation as a synergistic partner in TB drug
combination therapy. Target-based whole cell screening was conducted using an anhydrotetracycline-
responsive knockdown strain of FA underexpressing EF-G, with consequent hypersensitivity observed for
FA and three analogues. This provided further confirmation of EF-G as the target of FA in Mtb.
In conclusion, these findings demonstrate that FA can be used as a template for repositioning in TB drug
discovery.
vi
List of abbreviations
ACN Acetonitrile
ADMET Absorption, Distribution, Metabolism, Excretion and Toxicity
ATc Anhydrotetracycline
BCG Bacille Calmette-Guérin
BDQ Bedaquiline
bp Base pair
CD3OD deuteromethanol
CEM Cryo-electron microscopy
CET Cryo-electron tomography
CFU Colony forming unit
CH2Cl2 dichloromethane
CHO Chinese hamster ovarian
CIP Ciprofloxacin
cKD conditional knockdown
CTAB N-cetyl-N, N, N-trimethyl ammonium bromide
DCC Dicyclohexyl carbodiimide
DCS D-cycloserine
DIPEA N, N-Diisopropylethylamine
DMF N, N-Dimethylformamide
vii
DMSO Dimethylsulphoxide
DNA Deoxyribonucleic acid
dNTP Deoxynucleotide triphosphate
DOTS Directly Observed Therapy – Short Course
EDCI 1-Ethyl-3-(3-dimethylaminopropyl) carbodiimide
EDTA Ethylenediaminetetraacetic acid
EF-G Elongation Factor G
EMB Ethambutol
EPI Efflux pump inhibitor
ERY Erythromycin
ETH Ethionamide
EtOAc Ethyl acetate
FA Fusidic acid
FBS Fetal bovine serum
FDA US Food and Drug Administration
g Gravitational force
GAST/Fe Glycerol Alanine Salts Tween80
GAT Gatifloxacin
GDP Guanosine 5’ diphosphate
viii
GEN Gentamycin
GTP Guanosine triphosphate
HCl Hydrochloric acid
HIV Human Immunodeficiency Virus
HLM Human liver microsomes
HOBt 1-Hydroxybenzotriazole hydrate
HPLC High Pressure Liquid Chromatography
HTS High throughput screening
Hz Hertz
Hyg Hygromycin
IC Inhibitory concentration
INH Isoniazid
KAN Kanamycin
LC-MS Liquid chromatography coupled mass spectrometry
LEV Levofloxacin
LRMS Low Resolution Mass Spectrometry
LTBI Latent tuberculosis infection
MABA Microplate alamar blue assay
MDR Multidrug resistant
ix
MeOH Methanol
MIC90 Minimum Inhibitory Concentration
MLM Mouse liver microsomes
MmpL3 Mycobacterial membrane protein Large 3
MoA Mechanism of action
MOX Moxifloxacin
M.p. Melting point
MS Mass Spectrometry
Msm Mycobacterium smegmatis
Mtb Mycobacterium tuberculosis
MTT 3-(4, 5-Dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide
NaCl Sodium chloride
NH4OAc Ammonium acetate
Nm Nano metre
NMR Nuclear Magnetic Resonance
OADC Oleic acid-albumin-dextrose-catalase
OFX Ofloxacin
PAS para-aminosalicylic acid
PBS Phosphate buffered saline
x
PBP Penicillin binding proteins
PCR Polymerase Chain Reaction
PD Pharmacodynamics
PK Pharmacokinetics
PMA Phorbol myristate acetate
Ppm parts per million
PZA Pyrazinamide
Rf Retardation factor
RLM Rat liver microsomes
RIF Rifampicin
RNS Reactive nitrogen species
ROS Reactive oxygen species
rpm rotations per minute
SAR Structure-activity relationship
sdH2O Sterile distilled water
SI Selectivity index
SNPs Single nucleotide polymorphisms
SPEC Spectinomycin
STM Streptomycin
xi
Tet Tetracycline
TB Tuberculosis
TLC Thin Layer Chromatography
TB-WCS Target-based whole-cell screening
TE Tris-EDTA
TMS Tetramethylsilane
UCT University of Cape Town
UV Ultraviolet
v/v Volume per volume
v/w Weight per volume
VER Verapamil
WGS Whole-genome sequencing
WHO World Health Organization
WT Wild-type
XDR Extensively Drug Resistant
xii
Contents Declaration ..................................................................................................................................................... i
Acknowledgements ....................................................................................................................................... ii
Abstract ........................................................................................................................................................ iii
List of abbreviations ..................................................................................................................................... vi
List of Appendices ....................................................................................................................................... xix
List of Figures ............................................................................................................................................... xx
List of Graphs ............................................................................................................................................. xxii
List of Schemes.......................................................................................................................................... xxiii
List of Tables ............................................................................................................................................. xxiv
List of publications arising from this thesis and conferences attended .................................................... xxv
Chapter 1 ...........................................................................................................................................1
Introduction and Literature Review ....................................................................................................1
1.1 Tuberculosis: Epidemiological burden, disease aetiology and management ..................................... 1
1.2 Antimycobacterial chemotherapy ...................................................................................................... 2
1.2.1 Drug-susceptible TB Therapy ....................................................................................................... 2
1.2.2 Management of Drug-resistant TB .............................................................................................. 5
1.3 Limitations of current chemotherapy ................................................................................................. 9
1.4 Advances in TB drug discovery: Opportunities and challenges .......................................................... 9
1.5 Drug repurposing and repositioning: recent additions to TB drug regimens ................................... 10
1.6 Current drug discovery paradigms .................................................................................................... 13
1.6.1 The challenges ............................................................................................................................ 14
1.7 Relevance of Natural products to drug discovery ............................................................................. 14
1.7.1 Nature’s toolbox: The role of natural products in drug discovery ............................................. 14
1.7.2 Nature’s suitability: The concept of privileged structures ......................................................... 17
xiii
1.7.3 Declining natural product-based drug discovery ....................................................................... 17
1.7.4 Saving graces: Advances from technology platforms and genomics ......................................... 18
1.7.5 Chemistry: Synthesis and semi-synthesis as a strategy in drug discovery ................................. 19
1.7.6 Semi-synthesis in TB drug discovery .......................................................................................... 20
1.8 Target identification and determination of mechanisms of resistance ............................................ 23
1.8.1 Target identification and Mechanism of Action determination ................................................ 23
1.8.2 The value of re-discovery: Polypharmacology ........................................................................... 26
1.8.3 Mechanisms of drug resistance ................................................................................................. 27
1.9 Mycobacterium tuberculosis: An intracellular pathogen ................................................................. 30
1.10 Absorption, Distribution, Metabolism and Excretion (ADME) ........................................................ 34
1.10.1 Drug Metabolism ..................................................................................................................... 35
1.11 Rationale ......................................................................................................................................... 41
1.12 Hypothesis....................................................................................................................................... 41
1.13 Aim .................................................................................................................................................. 42
1.14 Specific objectives: .......................................................................................................................... 42
1.15 References ...................................................................................................................................... 43
Chapter 2 ......................................................................................................................................... 62
Design, semi-synthesis and in vitro evaluation of pharmacological and physicochemical properties of
fusidic acid-aminoquinoline hybrids ................................................................................................. 62
Chapter overview ........................................................................................................................................ 62
2.1 Fusidic acid ........................................................................................................................................ 62
2.1.1 Unique structure of FA ............................................................................................................... 63
2.1.2 Antibacterial SAR........................................................................................................................ 63
2.2 Quinolines in drug discovery ............................................................................................................. 64
2.3 Hybrid drugs ...................................................................................................................................... 65
xiv
2.3.1 Classification of hybrid drugs ..................................................................................................... 65
2.4 Prodrugs: design and application in drug discovery ......................................................................... 66
2.4.1 Classification of prodrugs ........................................................................................................... 67
2.5 Rationale for fusidic acid-aminoquinoline hybrids and C-3 ester prodrugs ..................................... 70
2.6 Aims and objectives .......................................................................................................................... 71
2.7 Semi-synthesis of FA hybrids ............................................................................................................ 71
2.7.1 Retrosynthetic analysis of the FA amide and ester prodrugs based on aminoquinolines ........ 72
2.7.2 Synthesis of 4-aminoquinoline diamines and alcohols .............................................................. 73
2.7.3 Synthesis of FA amides............................................................................................................... 75
2.7.4 Synthesis of FA esters ................................................................................................................ 75
2.7.5 1H NMR characterisation: Key spectroscopic indicators of selected intermediates and target
compounds ......................................................................................................................................... 78
2.8 Physicochemical evaluation of the FA hybrids.................................................................................. 80
2.8.1 Experimental determination of solubility .................................................................................. 80
2.8.2 Results of solubility testing of the compounds .......................................................................... 80
2.9 Pharmacological evaluation of the FA analogues ............................................................................. 82
2.9.1 Antimycobacterial evaluation of the FA analogues ................................................................... 82
2.9.2 Results of antimycobacterial evaluation of FA-aminoquinoline hybrids ................................... 82
2.9.3 Evaluation of the contribution of the pharmacophoric units to the pharmacological activity of
the hybrids .......................................................................................................................................... 85
2.10 Summary ......................................................................................................................................... 87
2.11 References ...................................................................................................................................... 88
Chapter 3 ......................................................................................................................................... 92
Evaluation of cytotoxicity, intracellular efficacy and mycobacterial metabolism of Fusidic acid and
selected analogues ........................................................................................................................... 92
3.1 Introduction ...................................................................................................................................... 92
xv
3.2 Aims and objectives .......................................................................................................................... 93
3.3 Evaluation of cytotoxicity .................................................................................................................. 93
3.3.1 Evaluation of cytotoxicity of the FA-aminoquinoline hybrids in CHO cells................................ 93
3.3.2 Evaluation of cytotoxicity of the FA-aminoquinoline hybrids in THP-1 cells ............................. 94
3.3.3 Results: Cytotoxicity in CHO cells ............................................................................................... 94
3.3.4 Discussion ................................................................................................................................... 98
3.4 Evaluation of selected FA analogues for intracellular antimycobacterial efficacy in THP-1 ............. 98
3.4.1 Compound selection .................................................................................................................. 98
3.4.2 Intracellular infection ................................................................................................................. 99
3.4.3 Results of CFU log reduction for Mtb-infected THP-1 treated with FA ................................... 100
3.4.4 Results of CFU log reduction for Mtb-infected THP-1 treated with GKFA16 and GKFA17 ...... 100
3.4.5 Results of CFU log reduction for Mtb-infected THP-1 treated with GKFA37 ........................... 101
3.4.6 Discussion ................................................................................................................................. 102
3.5 In vitro Metabolism of FA and selected analogues ......................................................................... 104
3.5.1 Introduction ............................................................................................................................. 104
3.5.2 Metabolism of FA ..................................................................................................................... 104
3.5.3 Metabolism of selected FA analogues ..................................................................................... 107
3.6 Role of mycobacterial metabolism in bioactivation and biodegradation of drugs ........................ 108
3.7 Rationale ......................................................................................................................................... 108
3.8 Aim .................................................................................................................................................. 109
3.8.1 Incubation of compounds in Mtb ............................................................................................ 110
3.8.2 Results ...................................................................................................................................... 110
3.8.3 Discussion ................................................................................................................................. 113
3.9 Summary ......................................................................................................................................... 115
3.10 References .................................................................................................................................... 117
xvi
Chapter 4 ....................................................................................................................................... 120
Target Identification and Mechanism of Resistance of Fusidic Acid .................................................. 120
4.1 The identification of distinct modes of action for the same molecule in different organisms. ..... 120
4.2 Mechanism of action of fusidic acid (FA) ........................................................................................ 121
4.2.1 Antiprotozoal mode of action of FA ......................................................................................... 124
4.3 Elongation Factor G (EF-G): Function and structure ....................................................................... 125
4.3.1 Function ................................................................................................................................... 125
4.3.2 Structure .................................................................................................................................. 125
4.4 Resistance to FA .............................................................................................................................. 129
4.4.1 In vitro resistance ..................................................................................................................... 129
4.4.2 In vivo resistance ...................................................................................................................... 130
4.4.3 Evaluation of the fitness cost of FAR ........................................................................................ 132
4.5 Validation of targets using target-based whole cell screening ....................................................... 133
4.6 Aims and objectives ........................................................................................................................ 134
4.7 Identification of spontaneous resistant mutants and determination of frequency of mutation. .. 134
4.7.1 Results of MIC90 screening of putative FAR Msm mutants ....................................................... 134
4.8 Fitness cost of the FA resistance-conferring mutation in Mtb ....................................................... 136
4.9 Determination of the susceptibility of the GKFA isolate to selected FA analogues and
antituberculosis agents ......................................................................................................................... 137
4.10 Validation of EF-G as the target of FA in Mtb: Evaluation of the effect of transcriptional silencing
of fusA on susceptibility of Mtb to FA and selected analogues ............................................................ 138
4.10.1 Results of the effect of transcriptional silencing of fusA on susceptibility of Mtb to FA and
selected analogues ............................................................................................................................ 139
4.11 Discussion...................................................................................................................................... 140
4.11.1 Msm results ............................................................................................................................ 140
4.11.2 Mtb result .............................................................................................................................. 142
xvii
4.12 Summary ....................................................................................................................................... 143
4.13 References .................................................................................................................................... 144
Chapter 5 ....................................................................................................................................... 150
Conclusions and Recommendations for Future Work ...................................................................... 150
5.1 Conclusions ..................................................................................................................................... 150
5.2 Recommendations for future work ................................................................................................ 153
Chapter 6 ....................................................................................................................................... 155
Experimental ................................................................................................................................. 155
6.1 Chemistry ........................................................................................................................................ 155
6.1.1 Reagents and solvents ............................................................................................................. 155
6.1.2 Chromatography ...................................................................................................................... 155
6.1.3 Physical and spectroscopic characterization ........................................................................... 155
6.1.4 General synthetic procedure for 4-aminoquinoline derivatives .............................................. 158
6.1.5 General synthetic procedure for fusidic acid amides .............................................................. 160
6.1.6 General synthetic procedure for fusidic acid esters ................................................................ 165
6.2 Biology experimental section .......................................................................................................... 168
6.2.1 Turbidimetric Solubility ............................................................................................................ 168
6.2.2 Bacterial strains and growth conditions .................................................................................. 170
6.3 Assessment of the effect of transcriptional silencing of fusA1 on the susceptibility of Mtb to FA
and selected analogues using the checkerboard assay ....................................................................... 173
6.4 Generation of spontaneous resistant mutants ............................................................................... 174
6.4.1 Generation of FA-resistant mutant strains of Msm ................................................................. 174
6.4.2 Generation of FAR Mtb mutants .............................................................................................. 174
6.4.3 DNA extraction, purification and amplification ....................................................................... 175
6.4.4 PCR amplification of genomic DNA .......................................................................................... 177
xviii
6.4.5 Sequencing ............................................................................................................................... 177
6.4.6 Targeted sequencing of MsmfusA1 and fusA2 ........................................................................ 177
6.4.7 Targeted sequencing of Mtb fusA1 .......................................................................................... 178
6.5 Competition assay ........................................................................................................................... 178
6.5.1 Calculation of relative fitness ................................................................................................... 179
6.6 Cytotoxicity assays .......................................................................................................................... 179
6.6.1 Cytotoxicity assay in CHO ......................................................................................................... 179
6.6.2 Cytotoxicity in THP-1 cells ........................................................................................................ 180
6.6.3 Macrophage cytotoxicity assay ................................................................................................ 181
6.7 Macrophage efficacy assay ............................................................................................................. 181
6.7.1 Infection of THP-1 with Mtb .................................................................................................... 181
6.8 Evaluation of mycobacterial metabolism of FA and selected FA analogues .................................. 182
6.9 References ...................................................................................................................................... 184
Appendix 1: genomic DNA amplified from the FAR Mtb mutant strain GKFA .......................................... 185
Appendix 2: Primers used for targeted sequencing of PCR amplicons ..................................................... 186
Appendix 3: Checkerboard assay plate of FA tested against the Mtb fusA knockdown strain ................ 188
Appendix 4: COSY NMR spectrum of AW23 ............................................................................................. 189
xix
List of Appendices
Appendix 1: genomic DNA amplified from the FAR Mtb mutant strain GKFA 185
Appendix 2: Primers used for targeted sequencing of PCR amplicons 186
Appendix 3: Checkerboard assay plate of FA tested against the Mtb fusA knockdown
strain 188
Appendix 4: COSY NMR spectrum of AW23 189
xx
List of Figures
Figure 1.1: First-line anti-TB drugs 3
Figure 1.2: Examples of second-line anti-TB drugs 7
Figure 1.3: Examples of anti-TB agents developed by repurposing and repositioning 11
Figure 1.4: Examples of natural product-derived clinical drugs 14
Figure 1.5: The percentage of natural product-derived small molecule approved
drugs in the years 1981-2010 15
Figure 1.6: Proportion of drugs developed from natural products 16
Figure 1.7: Examples clinical drugs containing privileged scaffolds 18
Figure 1.8: Semi-synthesis of rifampicin 21
Figure 1.9: Spectinomycin and representative spectinamides 22
Figure 1.10: Causes of compound attrition in drug discovery 35
Figure 1.11: Examples of active metabolites developed into clinical drugs 39
Figure 1.12: Morphine and its metabolites in man 40
Figure 2.1: Fusidanes with their respective carbon atom numbering indicated 62
Figure 2.2: Cyclopentanoperhydrophenanthrene with a trans-syn-trans arrangement 63
Figure 2.3: A summary of FA antibacterial SAR 64
Figure 2.4: Examples of quinolines with antimycobacterial activity 65
Figure 2.5: Classification of hybrids, adapted from Srivastava and Lee 66
Figure 2.6: Illustration of the prodrug concept 67
Figure 2.7: Fusidic acid amide and ester aminoquinoline hybrids 71
Figure 2.8a: Canonical structures for the inductive and mesomeric effects of the
quinoline nitrogen 74
Figure 2.8b: Mechanism of formation of 7-chloroquoniline-4-amine derivatives 74
Figure 2.9: Spectrum of AW21 illustrating the aliphatic protons of the C-4 side chain 78
Figure 2.10: Spectrum of AW23 illustrating the aromatic protons of the quinoline
ring and identifiable FA protons 79
Figure 3.1: FA and analogues selected for evaluation of intracellular efficacy in THP- 99
xxi
1
Figure 3.2: FA metabolites in man 104
Figure 3.3: Postulated conversion of FA to 3-epiFA 105
Figure 3.4: C-16 hydrolysis of FA 105
Figure 3.5: Examples of aryl and alkyl esters evaluated for metabolic stability in
microsomes 106
Figure 3.6: Structures of FA analogues for evaluation of mycobacterial metabolism 108
Figure 4.1: Structure of cyclomarin A 120
Figure 4.2: Antibiotic target sites during bacterial protein synthesis 122
Figure 4.3: Crystal structure of T. thermophilus EF-G from Margus et al. 125
Figure 4.4: Translocation on the ribosome and the inhibitory effect of FA 126
Figure 4.5: Schematic of the proposed mechanism of FA resistance mediated by
FusB-type proteins 130
Figure 4.6: Structures of selected FA analogues tested against putative Mtb FAR
mutants 137
Figure 4.7: Sequence alignment of EF-G and EF-G2 from Mtb and Msm 140
Figure 4.8: Domain conservation comparison between EF-G and EF-G2 141
Figure 6.1: Layout of turbidimetric solubility assay compound pre-dilution plate 167
Figure 6.2: Turbidimetric solubility assay plate layout 168
Figure 6.3: Layout of checkerboard assay 96-well microtitre plate 172
Figure 6.4: Structure of ME-29 181
xxii
List of Graphs
Graph 3.1: Log reduction of CFU in THP-1 infected Mtb treated with FA 100
Graph 3.2: Log reduction of CFU in THP-1 infected Mtb treated with GKFA16 101
Graph 3.3: Log reduction of CFU in THP-1 infected Mtb treated with GKFA17 101
Graph 3.4: Log reduction of CFU in THP-1 infected Mtb treated with GKFA37 102
Graph 3.5: Ratio of FA to internal standard in live and heat-killed Mtb cultures over
time 109
Graph 3.6: Ratio of FA and GKFA16 to internal standard in live and heat-killed Mtb
cultures over time 110
Graph 3.7: Ratio of FA and GKFA17 to internal standard in live and heat-killed Mtb
cultures over time 110
Graph 3.8: Ratio of GKFA61 to internal standard in live and heat-killed Mtb
cultures over time 111
Graph 3.9: Ratio of AW23 to internal standard in live and heat-killed Mtb cultures
over time 111
Graph 3.10: Ratio of AW25 to internal standard in live and heat-killed Mtb cultures
over time 112
Graph 4.1: Growth curve of wild-type Mtb and FA-resistant mutant strain Mtb
GKFA 135
xxiii
List of Schemes
Scheme 2.1: Retrosynthetic analysis of FA amide and ester derivatives 72
Scheme 2.2: Synthesis of 4-aminoquinoline diamines and alcohols 73
Scheme 2.3: Synthesis of FA amide derivatives 75
Scheme 2.4: Synthesis of FA ester derivatives 76
xxiv
List of Tables
Table 1.1: Advantages and disadvantages of natural products in drug discovery 19
Table 1.2: Examples of non-CYP450 enzymes involved in metabolism of xenobiotics 37
Table 2.1: Examples of prodrugs with improved lipophilicity or permeability 69
Table 2.2: Yields of 4-aminoquinoline alcohols and diamines 74
Table 2.3: Yields of FA amides and esters 76
Table 2.4: Results of turbidimetric solubility evaluation of the FA-aminoquinoline
hybrids 81
Table 2.5: Results of antimycobacterial testing of FA–aminoquinoline hybrids 83
Table 2.6: Results of MIC of selected individual aminoquinoline derivatives and their
mixtures with FA 86
Table 3.1: Results of IC90 determinations of individual aminoquinoline derivatives
and their mixtures with FA in CHO 95
Table 3.2: Results of evaluation of cytotoxicity of the FA-aminoquinoline hybrids 96
Table 3.3: FA and analogues evaluated for intracellular efficacy in THP-1 99
Table 4.1: Sequence homology between EF-G and EF-G2 among several species 127
Table 4.2: Results of MIC90 screening of putative FAR Mtb mutants 134
Table 4.3: Results of selected MIC90 screening of FA against colonies isolated during
resistant mutant generation 136
Table 4.4: MIC90 of FA, selected analogues and anti-TB drugs in fusA conditional
knockdown strain 138
Table 6.1: Gradients used for investigation of the purity of compounds with
preparatory HPLC 155
Table 6.2: Gradient used for investigation of the purity and mass of compounds
using LC-MS 155
Table 6.3: Bacterial strains used in this study 169
xxv
List of publications arising from this thesis and conferences attended
Publications
Review:
Kigondu E. M., Wasuna A., Warner, D. F., Chibale K. Pharmacologically active metabolites, combination
screening and target identification-driven drug repositioning in antituberculosis drug discovery.
Bioorganic and Medicinal Chemistry, 2014, 15; 22(16):4453-61.
Manuscripts in preparation:
Kaur G., Makoah N., Njoroge M., Strydom S., Wasuna A., Warner, D. F., Wiesner L., Chibale K. Synthesis
and biological characterization of fusidic acid C-3 esters.
Wasuna A., Moosa A., Kaur G., Singh, V., Ioerger T. R., Chibale K., Warner D. F. Fusidic acid inhibits
Elongation Factor G in Mycobacterium tuberculosis.
Conferences and Training courses attended
Keystone conference, Novel Therapeutic Approaches to Tuberculosis, Keystone, Colorado, 30th March-
4th April 2014. Poster presentation: Fusidic acid is bacteriostatic against Mycobacterium smegmatis.
H3D symposium, Innovative Approaches to Tuberculosis therapy, Victoria Falls, Zambia, 27th - 30th
August 2014. Poster presentation: Mutation in fusA1 causes in vitro resistance of Mycobacterium
tuberculosis to Fusidic acid.
Novartis Next Generation Scientist Program (June - August 2015), Novartis Pharma AG, Basel,
Switzerland.
1
Chapter 1
Introduction and Literature Review
Chapter overview
This chapter provides an overview of the current Tuberculosis (TB) chemotherapy and its limitations.
Additions to the existing anti-TB agents are highlighted in the context of current drug discovery
paradigms, with a focus on the example of several old drugs that have been repositioned in recent
efforts to expand the TB drug pipeline. The relevance of natural products in drug discovery is discussed,
arguing its continued relevance using current examples of antimycobacterial compounds derived from
natural products. The importance of drug target identification earlier in the discovery process is
discussed, with highlights of the widely used methods. The major classes of drug metabolising enzymes
and the systems used in the study of metabolism are also outlined, highlighting the value of
incorporating drug metabolism studies in the optimization of compounds at various stages of discovery
and development. Finally, the justification and aim of this work are provided.
1.1 Tuberculosis: Epidemiological burden, disease aetiology and management
It is estimated that up to one third of the world’s population is infected with Mycobacterium
tuberculosis (Mtb).1 Of these, about 10% progress to active tuberculosis (TB) disease in their lifetime.2
Consequently, TB is a major cause of morbidity and mortality. The World Health Organization (WHO)
estimates that, in 2015, there were 10.4 million new cases of infection and that the disease claimed the
lives of 1.4 million people. Of major concern is the heavy burden of the disease in sub-Saharan Africa
and parts of Asia.3 The alarming rise in the emergence of drug-resistant forms of TB has compounded
global efforts to control this scourge. In sub-Saharan Africa, this is exacerbated by the Human
Immunodeficiency Virus (HIV) pandemic, which synergizes with TB in debilitating the host immune
response. HIV has been shown to increase the risk of activating latent TB infection (LTBI) to active
disease, and to accelerate progression to active TB.4,5 South Africa provides a stark example of this co-
epidemic: almost 70% of TB-related deaths are HIV-associated.1
Mtb is a Gram positive, intracellular pathogen infecting humans as obligate host. Transmission of Mtb
occurs via aerosol and, upon inhalation, the innate immune response is activated. Bacilli are
phagocytosed by immune cells, chiefly alveolar macrophages. Phagocytosis in turn stimulates a pro-
2
inflammatory response, and other immune cells such as lymphocytes, monocytes and fibroblasts are
recruited, culminating in the formation of a granuloma, the hallmark of TB infection.6 Infection is
contained through the activation of innate and adaptive immune responses that create a hostile
environment for Mtb. However, through several mechanisms, the bacilli evade host elimination,
resulting in productive infection.7 These include inhibition of phagosome-lysosome maturation,
cytokine-mediated host defences and resistance to host bactericidal mechanisms.6,8,9 The bacilli not only
succeed in evading elimination, but have been shown to replicate within the host.10 TB is primarily a
pulmonary disease, although dissemination to other body organs occurs in some cases6, especially in HIV
co-infected individuals.
The existing measures for TB prophylaxis and cure are vaccination and chemotherapy respectively. In
most countries, the public health sector has implemented vaccination programmes as well as the
detection and treatment of confirmed TB cases. The only available vaccine, Bacille Calmette-Guérin
(BCG), is administered to infants at birth. However, it confers protection against disseminated TB only in
infancy, with highly variable protection against pulmonary disease in adolescents and adults.11 To date,
efforts to create an alternative, more effective TB vaccine have been unsuccessful. Recently, MVA85A, a
vaccine candidate that reached phase IIb trials in South Africa, demonstrated no protection against TB in
infants.12 There are, however, several vaccine candidates at various stages of clinical trials which offer
hope for a TB vaccine in the future.11 Although prevention is ultimately cheaper and better than cure,
chemotherapy remains the mainstay in the management of TB.………………………………………………….
1.2 Antimycobacterial chemotherapy
In 1882, Robert Koch identified Mtb as the causative agent of TB. However, streptomycin (STM), the first
anti-TB antibiotic, was only developed in 1944 by Waksman and co-workers.13–15 Three decades
thereafter, during the “Golden era” of antibiotic discovery, TB chemotherapy evolved to the current
first-line multidrug regimen. The past 5 years have seen the addition of several new drugs to the
therapeutic options, but these are reserved for the management of drug-resistant forms of TB.16
1.2.1 Drug-susceptible TB Therapy
Pulmonary TB is a curable disease, with figures varying between 80-95% of the cases reported classified
as drug-susceptible.17,18 At programmatic level, this is implemented through the Directly Observed
Therapy, Short course (DOTS), using a combination of 4 drugs administered in 2 phases. The initial phase
3
of 4 months involves treatment with isoniazid (INH), rifampicin (RIF), pyrazinamide (PZA) and
ethambutol (EMB), followed by a 2-month continuation phase with INH and RIF. However, the 6-month
multidrug regimen required to achieve cure has certain limitations: (1) toxicity and intolerance, which
necessitate treatment interruption and regimen changes, (2) drug-drug interactions, especially with
antiretrovirals in HIV co-infected patients, (3) and thus poor patient adherence, which have contributed
to the development of drug resistance.17 The first line drugs used in the management of drug-
susceptible TB are discussed briefly below.
Rifamycins
The rifamycins (Figure 1.1) are a class of antibiotics derived as a biosynthetic metabolite of the
bacterium Amycolaptosis mediterranei and consist of drugs such as rifampicin (RIF), rifabutin, and
rifapentine. Introduced in 1963, RIF is the most commonly used member of this class, while rifabutin
and rifapentine are newer generation derivatives. Rifamycins have a unique mechanism of action
amongst the clinically used antibiotics; they inhibit RNA synthesis through the formation of a stable
complex with RNA polymerase binding with the -subunit (encoded by rpoB). This leads to alterations in
RNA transcription and, consequently, nucleic acid metabolism, resulting in cell death. Widespread
resistance to RIF has been reported, known to be the result of single point mutations in rpoB, which
inspired the development of Gene Xpert, a diagnostic tool for the detection of RIF-resistant TB.16,19–21
Figure 1.1: First-line anti-TB drugs
4
Isoniazid
Isonicotinylhydrazine, more commonly known as isoniazid (INH), is a prodrug that was introduced in
1952. INH causes cell death through inhibition of enoyl-[acyl-carrier-protein] reductase, an enzyme
involved in the synthesis of mycolic acids that are a critical component of the mycobacterial cell wall.22,23
Its bioactivation from a prodrug relies on KatG, a mycobacterial catalase-peroxidase enzyme that
couples INH to NADH to achieve inhibition. Most cases of clinical resistance to INH have been mapped to
mutations in the katG gene, which reduces the catalytic activity of the peroxidase and thus markedly
reduces activity of the drug. In a few cases, mutations occur in either inhA or the promoter region of the
mabA-inhA operon; the former results in decreased affinity of the catalase enzyme for NADH, while the
latter causes over-expression of the wild-type enzyme and thus effective titration of the drug, resulting
in defective INH activation.24,25
Pyrazinamide
Like INH, pyrazinamide (PZA) is a prodrug. It requires bioactivation by mycobacterial pyrazinamidase
(encoded by pncA) to yield pyrazinoic acid (POA) which is pharmacologically active.26,27 Its mode of
action has been elusive, although it has been implicated in disruption of protein translation by targeting
a ribosomal protein, RpsA.28–30 PZA is characterized by differential kill kinetics, possessing bactericidal
activity against slow and non-replicating bacilli, whereas against fast-replicating bacteria, it is
bacteriostatic.31 Clinical resistance to PZA is associated with mutations in the pncA gene.26 Initially
thought to be activated exclusively by mycobacterial deamidase, Via and co-workers have recently
established that host amidases contribute to its hydrolysis and overall efficacy.32 PZA is unique in that its
development followed an unconventional path; it lacks activity against most strains of mycobacteria in
the conventional in vitro drug susceptibility assays. At acidic pH (often 5.5), however, it is active against
Mtb in vitro. A likely reason for its efficacy in vivo is that environment inside the macrophage is acidic.
PZA contributes to treatment shortening when added to drug regimens.33
Ethambutol
Ethambutol (EMB) was introduced into clinical use in 1961, and has several attractive features. It is
cheap, with low toxicity and consequently better patient tolerability than the other anti-TB drugs. Along
with PZA, it is used as adjunct therapy in treatment of MDR-TB.33 EMB inhibits arabinosyl transferases
5
essential for mycobacterial cell wall biosynthesis, resulting in cell death.34–36 Resistance to EMB is most
commonly associated with point mutations in the embBC operon while, in some cases, multi-step
mutations in genes encoding cell wall precursors precede embBC mutations, with varying degrees of
EMB resistance.37
1.2.2 Management of Drug-resistant TB
Resistance to STM was reported within 2 years of its initial use in TB treatment. Over the years, in the
estimated 5-20% of drug-resistant cases of TB patients, the emergence of drug resistance has taken on
multiple forms.15,16 These are classified as follows: (1) mono-resistance (resistance to a single agent); (2)
multi-drug resistant TB (MDR-TB), that is, resistance to INH and RIF; (3) extensively drug-resistant TB
(XDR-TB), that is, MDR plus resistance to two classes of the second-line drugs, fluoroquinolones and the
injectable drugs, and (4) totally drug resistant TB (TDR-TB) which is not officially defined but is ascribed
to forms of TB that are resistant to all first and second line drugs18. Drug-resistant forms of TB pose
additional challenges to drug-susceptible TB: therapy is longer, ranging from 18-24 months. In addition,
the drugs are costlier and more toxic. Some of the drugs are injectable and, together, these factors
further reduce patient adherence. Some of the second-line drugs are briefly discussed below.
Aminoglycosides
Aminoglycosides form a critical component of MDR and XDR TB management. They include STM,
kanamycin (KAN) and amikacin (AMK). The first of these, STM, was isolated from an actinobacterium,
Streptomyces griseus, and introduced clinically in 1944.13 Aminoglycosides are protein synthesis
inhibitors that act by binding irreversibly to the bacterial 30S ribosomal subunit. Resistance to
aminoglycosides is mostly associated with changes in the ribosomal drug binding site, specifically,
mutations in rpsL, the gene which encodes S12, an essential ribosomal protein. Mutations in this gene
account for approximately half of all STM-resistant clinical isolates reported. Fewer cases of resistance
are the result of mutations in the rrs gene.38,39 In addition, enzyme-mediated drug modification is also
associated with resistance to KAN. A mycobacterial acetyltransferase, enhanced intracellular survival
(Eis), has been shown to carry out multiple acetylations on KAN, rendering Mtb resistant to the drug.
Supporting evidence is the upregulation of mycobacterial Eis observed in KAN-resistant clinical
isolates.40,41 Aminoglycosides are formulated as injectables, requiring daily administration of painful
6
injections to patients. Another major drawback is their side-effect profile, with ototoxicity and
nephrotoxicity reported in a proportion of patients.42,43
Fluoroquinolones
These are an established class of broad spectrum antibiotics that have been developed from the first
member, nalidixic acid, that was used to treat urinary tract infections.44 The second generation agents
include levofloxacin and sparfloxacin, while the third generation consists of moxifloxacin (MOX) and
gatifloxacin (GAT). The latter two are a critical component of MDR-TB treatment. Their molecular target
is DNA gyrase, an enzyme that causes relaxation of supercoiled DNA strands. They inhibit DNA
replication by intercalating into DNA to form a drug-enzyme-DNA complex, which causes breaks in the
DNA strand.45 Recently, three landmark phase III studies investigated treatment shortening in drug-
susceptible TB using modified regimens incorporating the fluoroquinolones, MOX and GAT. Despite
evidence of treatment shortening in mouse efficacy studies, all three regimens failed to show superiority
over the existing first-line regimen.46–48
Macrolides
This class of antibiotics includes erythromycin, clarithromycin and azithromycin. They inhibit protein
synthesis by binding to 23S rRNA and thus prevent peptide bond formation. Mechanisms implicated in
the resistance to macrolides include drug efflux and mutations in the ribosomal drug binding site.44
7
Figure 1.2: Examples of second-line anti-TB drugs
Capreomycin
Capreomycin, an antibiotic isolated from Streptomyces capreolus, is a cyclic polypeptide used to treat
MDR-TB. It targets the mycobacterial ribosome at the interface of the small and large subunits and
requires ribosomal rRNA methylation for optimal binding, which in turn inhibits ribosome function.
Resistance in Mtb arises from mutations in tlyA, which encodes a methyltransferase which is also known
to be a virulence factor in Mtb.49 Mtb resistance is also attributed to mutations in the rrs gene that
encodes 16S rRNA.19,50
8
Thioamides
The main members of this class are ethionamide and protionamide, with the former more commonly
used to treat MDR-TB. As structural analogues of INH, they are also prodrugs (activated by EthA) and, in
addition, share a molecular target with INH. Thus, cross-resistance with INH has been reported.51–55
Thioamides also inhibit mycolic acid biosynthesis, resulting in cell death. In addition to mutations in
inhA, mutations in ethA have been associated with resistance to ethionamide.52 As might be expected,
resistance to these two drugs develops rapidly due to their cross-resistance.33 Based on a study of of
inhA and ethA drug resistance mutation patterns, Müller et al proposed alternative guidelines for the
individualised treatment of TB patients, which, if implemented, could potentially reduce the loss of INH
and ethionamide as chemotherapeutics for MDR-TB.56
para-Aminosalicylic acid (PAS)
An analogue of aspirin, the popular anti-inflammatory drug, PAS is a prodrug that was developed in
1948. It is activated by dihydropteroate synthase (DHPS) and dihydrofolate synthase (DHFS) to the active
moiety, a hydroxyl dihydrofolate which inhibits folic acid biosynthesis.57 Resistance is associated with
mutations in DHPS and DHFS, preventing its activation to the active dihydroxyl metabolite.57,58 It is a last-
choice drug among the second-line agents, due to its lower efficacy, poor gastric tolerability, and
requirement of cold chain storage (the less efficacious sodium salt does not, however, require this).33
D-cycloserine
Introduced in 1955, it is a D-alanine analogue that is a cornerstone of MDR-TB treatment whose major
drawback is its short shelf-life of 2 years.33 It is bacteriostatic, inhibiting D-alanine racemase and ligase,
enzymes essential for the synthesis of the peptidoglycan precursor UDP-muramyl pentapeptide.59 A
recent study by Desjardins et al in which whole genome sequence data from a diverse collection of
clinical isolates was analysed, revealed that resistance to D-cycloserine was associated with loss of
function mutations in ald and alr which encode D-alanine ligase and racemase respectively. Amongst the
anti-TB drugs, a remarkable feature of D-cycloserine is its central nervous system (CNS) effects which
make it ideal for TB management in psychiatric patients.60
9
1.3 Limitations of current chemotherapy
As highlighted above, the lengthy duration of treatment, toxicity and relatively poor efficacy of some of
the drugs demonstrate the need for new and better drugs for TB management. Inherent properties of
the bacillus are a huge contributor to these outcomes, and cannot be overlooked. In the face of host-
induced stresses to Mtb infection, mainly nitrosative, acidic, hypoxic and nutritional, the bacillus is able
to alter and down-regulate its metabolism. This metabolic shift allows it to enter a state of non-
replication and, consequently, emergence of sub- populations of cells. These include persister cells,
which are refractive to anti-TB drugs, necessitating alternative and longer periods of chemotherapy.61,62
The microenvironments in the caseous lesions in which Mtb reside during infection also require
differential drug pharmacokinetic considerations to achieve sterilization.9,63–65
The spectrum of Mtb disease, from latent to active disease and cases of relapse, has spurred a re-
thinking in the diagnosis and monitoring of TB in high-burden settings, especially in low- and middle-
income countries. Logistical challenges in drug access, diagnosis and drug susceptibility testing and
administration at the point of care also play a role16. Cases of short supply of some anti-TB drugs, and
the associated toxicities which necessitate drug interruption or withdrawal of specific agents, create
windows of monotherapy which, in turn, accelerate progression of resistance to some of the drugs66,67.
In all countries surveyed, resistance has emerged against all the clinically used drugs, attesting to the
survival capability of Mtb68. For most of the drugs discussed above, chromosomal mutations (single or
step-wise), cause changes in the molecular drug targets or auxiliary changes in the bacillus which inhibit
or greatly reduce pharmacological activity of the drugs69. The challenges posed by drug-resistant forms
of TB cannot be underestimated, with subsequently grave increases in morbidity and mortality
worldwide. In 2006, an outbreak of drug-resistant TB in Tugela Ferry, a small town in rural South Africa,
resulted in the death of 52 out of 53 patients with MDR-TB68.
1.4 Advances in TB drug discovery: Opportunities and challenges
As highlighted in section 1.4 above, the shortcomings of the current chemotherapy necessitate the
expansion of chemotherapeutic agents to treat both drug-susceptible and drug-resistant forms of TB.
Some of the goals include identification of: (1) Agents with novel mechanisms of action to overcome the
resistance observed in the current drugs; (2) Sterilizing drugs that eradicate the different sub-
populations of bacilli; (3) Treatment shortening agents, which can be incorporated into the existing drug
10
regimens; (4) The optimal pharmacokinetic parameters required to eliminate bacilli in macrophages and
caseous lesions that have variable susceptibility to the current drugs.70
Global efforts to these ends are variably structured, with private-public partnerships, and partnerships
between pharmaceutical companies and academia as some of the existing models. These include,
among others, the TB Alliance, Stop TB Partnership Working Group on New TB Drugs, and the TB Drug
Accelerator (TBDA) programme.71 The approval in 2012 of bedaquiline (BDQ), a diarylquinoline (Figure
1.3), was a milestone in TB drug discovery as this was the first novel drug with a novel mechanism of
action in over 4 decades.72 Subsequent trials have, however, elicited safety concerns owing to its
cardiotoxicity. In addition, soon after these trials, cases of resistance to BDQ emerged.
1.5 Drug repurposing and repositioning: recent additions to TB drug regimens
An approach that is increasingly applied to accelerate the drug development process is called drug
repurposing or repositioning.73,74 Previously, these two terms were used interchangeably; however, it is
now acknowledged that their individual meanings are different. Drug repurposing refers to the
application of an existing drug for a new indication, without any chemical modification. Such a drug only
requires dose optimization during preclinical and clinical development, since prior knowledge of its
safety and pharmacokinetic profiles are available. Consequently, this reduces the cost and shortens the
duration of drug development. On the contrary, drug repositioning is ascribed to the chemical
modification of a pre-existing drug for a new indication. This term can also be applied to drugs which
have been rescued from phase III or IV clinical stages, often due to poor safety or efficacy. Repurposed
or repositioned drugs may have similar, or, in some cases, additional targets in the new indications. In
the search for new TB drugs, drug repurposing and drug repositioning have seen several drugs progress
to various stages of clinical development. Drug repurposing and repositioning have expanded the
therapeutic options for TB, ameliorating morbidity and mortality associated especially with MDR- and
XDR-TB. A few examples are discussed below.
Nitroimidazoles
These drugs were based on the modest antimycobacterial activity of metronidazole, a nitroimidazole
used to treat protozoal and anaerobic bacterial infections.75,76 Structural modifications led to the
11
nitroimidazo-oxazines, with PA-824 and OPC-67683, now known as pretomanid and delamanid,
respectively.70,75,77 They are active against both replicating and hypoxic, non-replicating bacilli, and
possess a complex mechanism of action resulting in inhibition of cell wall mycolic acid biosynthesis and
respiratory poisoning.76 They are prodrugs, requiring bio-activation by the enzyme deazaflavin (cofactor
F420) -dependent nitroreductase (Ddn).78,79 Reports of resistance to delamanid have already emerged,
with most mutations mapped to fgd1, the gene encoding the nitroreductase responsible for its
bioactivation. Mutations have also been mapped to fbiA, which encodes an enzyme required for
generation of the co-factor F420, with depletion of this co-factor resulting in decreased bioactivation of
delamanid.80,81
Figure 1.3: Examples of anti-TB agents developed by repurposing and repositioning
12
Oxazolidinones
The oxazolidinones include linezolid (Lzd), the first member of this class, with sutezolid and tedizolid as
newer generation agents. A landmark study by Barry et al, in which Lzd was added to a failing regimen,
showed efficacy in 35% of XDR patients within 2 months, and 87% within 6 months.82,83 Oxazolidinones
act by binding to the 50S subunit of 23S rRNA, blocking the translation step of protein synthesis. A major
drawback of Lzd is its toxicity which, unfortunately, is linked to its mechanism of action. In addition to
inhibiting bacterial protein synthesis, it also inhibits mammalian mitochondrial protein synthesis,
resulting in adverse events such as myelosuppression and neuropathy.70,84 Because the toxicity is dose-
dependent, ongoing studies to determine efficacious but less toxic dose ranges are underway.
Derivatives tedizolid, sutezolid and AZD-5847 with better safety profiles have advanced to phase II
clinical trials. Tedizolid is clinically approved, while sutezolid is currently in phase II clinical trials. 70,85,86
Mutations in rplC, which encodes the 50S ribosomal protein, were identified in vitro in spontaneous
resistance, while clinical Lzd-resistant isolates with no corresponding mutations led Richter and co-
workers to the postulation of efflux as a mechanism of resistance.87,88
Riminophenazines
Clofazimine is the first-in-class among the riminophenazines, and was developed as an anti-TB drug, but
repurposed for treatment of leprosy.89 In cases of MDR and XDR-TB, clofazimine has shown efficacy and
relatively low toxicity.90–92 Its major drawbacks, the discolouration of skin, along with central nervous
system effects, have been a deterrent to its second entry as a repurposed anti-TB agent. It has shown
activity against slow-replicating bacilli, which are implicated in the formation of biofilm in vitro (in the
streptomycin–resistant strain SS18B) model of non-replication and in granuloma in vivo, and is thus an
attractive chemotherapeutic option for non-replicating forms of Mtb. Although there is contention on
the exact mechanisms of action of clofazimine, it has been shown to inhibit Mtb growth by intracellular
redox recycling and membrane disruption; consequently, there is a low frequency of resistance to
clofazimine.89 Less lipophilic analogues with improved efficacy and lower side effect profiles are in the
early stage of pre-clinical development.93,94
13
Ethylenediamines
These are structural analogues of EMB, with SQ109 as the front-runner in phase II clinical trials. Despite
their structural similarity to EMB, they are cell wall inhibitors with a different mechanism of action, with
polypharmacological effects on fungi and bacteria that lack the mycolic acids found in Mtb. They target a
mycobacterial cell wall protein, Mycobacterial membrane protein Large 3, (MmpL3), which has garnered
interest as a novel target of several new antimycobacterial agents.70,95–97 In addition, SQ109 inhibits
menaquinone synthesis, cellular respiration and ATP synthesis. These multiple mechanisms of action
suggest limited development of resistance, making it suitable for MDR-TB treatment.70
Drug repurposing has lent a new lease on life to TB drug discovery, with other established drug classes
such as the -lactams, rifamycins, carbapenems, macrolides and sulfonamides in ongoing pre-clinical
and clinical development.47,70,84,98,99
1.6 Current drug discovery paradigms
The most common approaches to drug discovery are either phenotypic or target based. The former
involves the use of whole cells to determine the minimum inhibitory concentration (MIC) of compounds.
Compound libraries are screened for in vitro activity against Mtb or, in some cases, such as in that of the
initial identification of BDQ, Mycobacterium smegmatis (Msm), a non-pathogenic surrogate of Mtb.
With the technological advancements over the last few decades, this is done at a high-throughput scale,
allowing thousands of compounds to be tested rapidly. Once hits are identified, their mechanisms of
action and resistance are investigated, typically through the identification of spontaneous resistant
mutants. Chemical synthesis is usually employed to generate structural analogues to develop Structure-
Activity Relationships (SAR) to allow optimization of pharmacological and pharmacokinetic properties of
the molecules that can be progressed to in vivo animal studies as a prelude to pre-clinical development.
Following the publication of the Mtb genome in 1998, a landmark study by Sassetti et al identifying a list
of essential genes has provided a useful tool for the unravelling of novel drug targets.100,101 Target-based
approaches begin with structural information on a target, which enables the high-throughput screening
(HTS) of compounds using computational (in silico) tools to identify small molecule inhibitors. The drug
targets, often enzymes, are then heterologously expressed and, using in vitro assays, enzyme inhibitors
are identified. A major drawback of this approach is often the lack of correlation between (often active)
enzyme inhibition in biochemical assays in vitro and lack of potency in whole-cell phenotypic screening.
14
This is attributed to factors such as compound permeability and, in the case of Mtb, the unusually thick
mycobacterial cell wall acts as a barrier to drug penetration.102,103
1.6.1 The challenges
Current drug discovery paradigms are hampered by several challenges: (1) in vitro to in vivo transition of
identified leads; (2) mitigation of off-target pharmacology, since most of these drugs have a background
in other disease indications; (3) repeated discovery of compounds that target the same enzymes, mostly
cell wall inhibitors102; (4) frequent discovery of prodrug-activated electrophiles, which raise concerns if
targeted by the human drug metabolism systems, and (5) the length and complexity associated with
target identification for the hits identified through phenotypic screening.70,102
1.7 Relevance of Natural products to drug discovery
1.7.1 Nature’s toolbox: The role of natural products in drug discovery
Figure 1.4: Examples of natural product-derived clinical drugs
15
Throughout history, natural products and their derivatives have played a key role as a source of
therapeutic agents. Chemical substances derived from plants, animals and microbes have been used to
treat disease since the dawn of medicine.104–106 Figure 1.4 above provides examples of some
pharmaceutical drugs that were derived from nature, spanning different therapeutic areas: artemisinin
(antimalarial), digoxin (heart failure), paclitaxel (anticancer), STM (antibiotic).
Natural products continue to play a key role in the drug discovery and development process, as
demonstrated in a review of all new chemical entities (NCEs) by Newman and Cragg covering the years
1981-2010, which showed that natural products contributed up to 50% of all small molecule approved
drugs in 2010. Figure 1.5 below demonstrates this.105
Their usefulness as pharmaceuticals comes in several forms: as natural products, as semi-synthetic
natural product analogues or as synthetic compounds based on natural product pharmacophores. A
pharmacophore is described as the ensemble of steric and electronic features that is necessary to
ensure optimal interactions with a specific biological target structure and to trigger (or to block) its
biological response.104
Figure 1.5: The percentage of natural product-derived small molecule approved drugs in the years
1981-2010 105
25.6
38.5
23.6
34.9
46.7
32.7
46.4
36.7
31.6
28.2
20
41.7 40 39.5
28.9
21.1
12.2
27.3
38.9
35.1
45.5
35.3
33.3
38.9 39.4
23.8
42.3
37.5
20.8
50
0
10
20
30
40
50
60
1980 1985 1990 1995 2000 2005 2010
Per
cen
tage
Year
16
Salient points in this comprehensive review conducted by Newman and Cragg include:
As shown in Figure 1.6 below, a considerable proportion of NCEs that are considered synthetic have
their origins in natural products. This may be in several forms: natural product mimetics, that is,
molecules that mimic the biological activity of natural products [synthetic drug (SD) mimicking a natural
product (NP), SD mimicking NP]; those that mimic natural product pharmacophores, and those based on
natural product pharmacophores.
Notably, of all the therapeutic areas that have benefited from natural product-based drug discovery in
the last thirty years, anti-infectives took the lion’s share, with antiviral vaccines topping the list. Thus,
infectious diseases continue to depend heavily on natural products and their structures for
replenishment of the drug discovery pipeline.
A novel designation, natural product botanicals (NB), has emerged to cover botanical defined mixtures,
which have gained recognition by the Food and Drug Administration (FDA) and other regulatory
authorities. This is a welcome change to the single drug-single target paradigm of modern day drug
discovery, and acknowledges Nature’s approach where a desirable phenotype may be the result of the
interaction of multiple targets, be they receptors or enzymes. This also implies that these desirable
phenotypes can be targeted by mixtures of natural products, as opposed to single or pure chemicals.
Figure 1.6: Proportion of drugs developed from natural products105
17
1.7.2 Nature’s suitability: The concept of privileged structures
Nature has been shown to provide natural ligands that have an affinity for a wide variety of receptors.
The concept of privileged structures was introduced by Evans et al in 1988, when they deduced that
certain “privileged structures” are capable of providing useful ligands for more than one receptor, and
that judicious modification of such structures could be a viable alternative in the search for new
receptor agonists and antagonists.107 These privileged structures are presumed to have undergone
evolutionary selection over time to allow optimal bioactivities and bioavailabilities. The exploitation of
these scaffolds to treat disease offers the strategic advantage of Nature targeting Nature, causing
natural products to be touted as keys whose locks remain to be uncovered in biological systems.104 As a
consequence, natural products have been extensively used to elucidate complex cellular mechanisms,
including signal transduction and cell cycle regulation leading to the identification of important targets
for therapeutic intervention.108
Structurally, privileged scaffolds are characterized as typically rigid, polycyclic heteroaromatic systems
capable of orienting varied substituent patterns in a well-defined 3-D space.108 In the quest for novel
drugs, medicinal chemistry has applied several strategies to incorporate these scaffolds of biological
relevance to small-molecule libraries. Figure 1.7 illustrates examples of privileged scaffolds found in
nature alongside clinical drugs that contain them. Among these, the quinoline and steroid scaffolds are
relevant in TB drug discovery and to the work reported in this project. Other scaffolds that present
opportunities for the field of TB include the chalcones, flavonoids, polyketides, steroids and peptides.109
As the field of natural product research is inexhaustible, no comprehensive list of privileged scaffolds is
achievable.
1.7.3 Declining natural product-based drug discovery
Despite this, in the 50 odd years that have been widely regarded as the ‘Golden era’ of antibiotic drug
discovery, there has been a decline in natural products-based drug discovery globally, attributable to
several reasons including but not limited to104:
1. The emergence of high throughput screening, resulting in a shift to chemical libraries of smaller,
‘screen-friendly’ molecules with defined molecular targets.
18
2. The evolution in the 1990’s of combinatorial chemistry, which promised chemically diverse, drug-like
screening libraries.
3. Major advances in molecular biology, cellular biology and genomics that have elucidated molecular
targets, presenting the tempting option of shorter drug discovery timelines.
4. A general decline in research on infectious diseases which has, until recently, relied heavily on natural
products as the source of new scaffolds.
Figure 1.7: Examples clinical drugs containing privileged scaffolds
1.7.4 Saving graces: Advances from technology platforms and genomics
Two major obstacles to advancing a natural product medicinal chemistry program are compound supply
and the ease of diversification strategies. Most natural products are sourced from plants, or from the
fermentation of microorganisms. Over the years, advances in chromatography that enable rapid, high
resolution refining steps to obtain pure products, coupled with powerful spectroscopic techniques that
allow characterization of the most complex natural products, have made what was a daunting
endeavour, a routine task in chemistry laboratories across the world. Grzelak et al have demonstrated
this by developing a platform consisting of microbiological, chromatographic and spectrometric
techniques, allowing the early identification of antimycobacterial compounds early in the isolation
process.110 Coupled to this, genomic tools have revolutionized this field of research by enabling
19
scientists to provide alternative ways of efficient compound supply. An example of this is the successful
probing of biosynthetic pathways to create strains that yield single components of interest. Doramectin,
a superior analogue of avermectin, has been successfully produced after gene knockout of aveC in
Streptomyces avermitilis, affecting the ratio of avermectin to doramectin.111 Another example is that of
genetic engineering of natural biosynthetic pathways to produce ‘unnatural’ natural products, especially
in the field of polyketide synthesis.111–113 These, among other numerous examples of bioorganic
chemistry and chemical biology, provide evidence that natural products remain a viable option as a
sustainable source of new molecules for the drug discovery pipeline.
Table 1.1: Advantages and disadvantages of natural products in drug discovery105,106
Natural products Synthetic molecules
Great structural diversity. Less structural diversity.
“Privileged” structures for optimal biological
interaction.
Structures have lower optimal suitability for
biological activity.
Tendency to possess multiple modes of action/
biological targets.
Less diversity in modes of action/biological
targets.
Multidisciplinary expertise is required for processing
of samples from the source.
Comparatively less multidisciplinary expertise
required.
Complex mixtures that require lengthy isolation,
purification and characterization.
Shorter timelines for isolation, purification and
characterization.
Low concentrations of compound and difficulty in
scale-up and limited supply.
Large quantities can be synthesised and supply
issues avoided.
1.7.5 Chemistry: Synthesis and semi-synthesis as a strategy in drug discovery
Natural products identified in screening campaigns can either be used as new molecules in their own
right, or can serve as the starting point for medicinal chemistry programs aimed at enhancing their
biological and other profiles.108 Thus, apart from ensuring a sustainable supply, diversification of natural
products is a key component of any natural products-based drug discovery programme. Organic
synthesis is a useful tool for both of these ends; de novo (total) synthesis of a compound aims to address
20
the drawback of supply. It is, however, labour- intensive and time-consuming, thus hardly pragmatic for
large-scale, pharmaceutical manufacturing of drugs. The other approach, chemical semi-synthesis,
involves the modification of an existing scaffold, and usually aims at improving biological properties such
as potency, or altering other physicochemical properties such as solubility, lipophilicity, or to improve
the toxicity profile by making a molecule more selective for the intended drug target.
The effort to incorporate privileged scaffolds from Nature in small-molecule libraries as starting points
for medicinal chemistry programs inspired advancements in synthetic chemistry. These include
combinatorial chemistry, diversity-oriented synthesis (DOS) and privileged substructure-based diversity-
oriented synthesis (pDOS), which resulted in the generation of molecularly diverse, large, natural
product-like libraries efficiently, expediently and at a fraction of the cost of conventional synthetic
methods.82,108,114,115
1.7.6 Semi-synthesis in TB drug discovery
The existing TB regimens are composed of drugs that fall into three categories: totally synthetic
molecules, unaltered natural products and semi-synthetic derivatives of natural products. INH and PZA
are purely synthetic, small molecules in the first line TB chemotherapy regimen. Unaltered natural
products include STM, while a pertinent example of a semi-synthetic derivative of a natural product is
RIF, the 3-(4-methylpiperazinoiminomethyl) derivative of 3-formylrifamycin SV, a member of the
rifamycins.116 As illustrated in Figure 1.8 below, through several enzymatic modifications, rifamycin B,
the primary product of fermentation of Nocardia mediterranei, yields precursors of the key intermediate
rifamycin SV, which is subsequently chemically derivatized to RIF.
21
Figure 1.8: Semi-synthesis of rifampicin
22
Recently, Lee and co-workers synthesised spectinamides (Figure 1.9), amide derivatives of the old
antibiotic, spectinomycin (SPEC), a protein synthesis inhibitor. The spectinamides are a promising new
class of amide derivatives of SPEC with potent antimycobacterial activity. They were designed to
overcome the poor antimycobacterial activity of SPEC.117 These examples illustrate the continued
relevance of semi-synthetic modification of natural products in the expanding the panel of
antimycobacterial agents for TB drug discovery.
Figure 1.9: Spectinomycin and representative spectinamides
Other examples include griselimycin, a cyclic peptide isolated from Streptomyces species in the 1960s
that has garnered renewed interest recently. It has a novel mechanism of action, and is active in vitro
and in vivo against both drug-sensitive and drug-resistant forms of Mtb. Its excellent pharmacological
profile has been followed up with medicinal chemistry efforts which have identified derivatives with
improved pharmacokinetic properties, with one progressing to late pre-clinical studies.118–120
23
1.8 Target identification and determination of mechanisms of resistance
Target identification and mechanism of action studies are useful in the drug discovery process, as they
provide valuable information that enables faster, optimal design of inhibitors by guiding SAR studies.
Furthermore, they provide an understanding of off-target effects that may be responsible for drug
toxicity, thus facilitating the optimisation of selectivity through appropriate chemical modification
earlier in the drug discovery/development cascade.103 An additional outcome of target identification is
the potential for drug repurposing, as exemplified in section 1.1.4 above by the antibacterial agents that
have been repurposed for Mtb based on their mode of action. In some cases, drugs have been
repurposed as a result of the discovery of novel modes of action applicable to other indications
Following recent insights into host-pathogen interactions, pathogenesis, inflammatory pathways, and
the host’s innate and acquired immune responses to TB infection, a wide range of host-directed
therapies (HDTs) with different mechanisms of action have been identified. Some of the HDTs identified
are drugs that have been repurposed from the treatment of non-communicable diseases. Statins
(cholesterol lowering agents), metformin (an oral hypoglycaemic agent), valproic acid (an anti-epileptic),
and imatinib (an anticancer drug), have demonstrated a role in the induction of autophagy and
phagosome maturation. The use of HDTs as adjuncts to existing TB treatment regimens could potentially
shorten the duration of treatment or improve clinical outcomes in patients infected with both drug-
susceptible and drug-resistant TB.121,122 Ongoing preclinical and clinical studies to evaluate the efficacy of
several repurposed drugs are underway. There are ongoing pre-clinical and clinical studies evaluating
the efficacy of several repurposed drugs as HDTs.121,123,124
1.8.1 Target identification and Mechanism of Action determination
Target identification is an upstream process independent of drugs that involves identifying pathways or
components thereof that are critical to survival of an organism or pathogenesis. Subsequent
characterization of these essential enzymes or proteins can facilitate drug discovery efforts to identify
suitable chemical inhibitors. Part of the challenge of identifying new classes of anti-TB drugs is the
paucity of novel chemically and biologically validated targets. The genome of Mtb H37Rv was
sequenced in 1998 and reannotated in 2002, providing the sequences of all genes and the function of
most.125,126The accompanying challenge is the identification of ‘druggable’ targets in the genome;
24
properties such as essentiality, susceptibility to inhibition, lack of human homologues or the lowest
possible homology to human counterparts are difficult to achieve in a single molecule or class of
molecules.77
Mechanism of action, on the other hand, is a drug-dependent downstream process that involves the
elucidation of the specific way or ways in which a drug elicits the desired inhibitory biological effect.
Many of the drug discovery tools available today were not in existence in the ‘golden era’ of antibiotic
discovery, and thus most of the anti-TB drugs in use were developed through phenotypic screening.
Moreover, very few clinical trials were conducted, therefore very few of the drugs entered clinical use
with a priori knowledge of their mechanisms of action; RIF and PZA had their mechanisms of action
established almost a decade after the onset of clinical use127 while that of INH was explained until >30
years after introduction.128
Approaches to target identification can be broadly classified into genomic, biochemical and
computational methods. Due to their complementarity, often more than one approach is employed to
uncover the targets of successful hit compounds from phenotypic screens.
1.8.1.1 Biochemical approach: proteomics
The classical biochemical approach is based on the interaction between a small molecule or natural
product and a protein target, which is broadly referred to as proteomics.129 It relies largely on the use of
drug-affinity chromatography techniques - more commonly, the use of a labelled ligand or small
molecule suspected to have affinity for a particular protein target.130–132 This is referred to as chemical
proteomics, and is useful for obtaining powerful and precise information on the modes, affinity and
kinetics of the binding of molecules to their targets103,133–136. Proteomics has been successfully used to
complement the phenotypic approach in identification of targets of several drugs.137–139
1.8.1.2 Genomic approach
The genomic approach has been the mainstay of target identification for new drugs.140,141 Present-day
technology has enabled the relative ease of small and large-scale modifications of DNA and RNA, and
advancements in parallel sequencing technology have made it relatively inexpensive and fast.141 Genes
25
with previously unknown and essential functions have been uncovered in this way, as demonstrated by
the seminal work of Sassetti et al who used Transposon site hybridization (TraSH) mutagenesis to
comprehensively identify genes required for optimal growth, the so-called “survivasome” of Mtb. This
was a milestone in unraveling the functions of Mtb genes, consequently expanding the panel of
potential drug targets.100,101
In one study, Boshoff et al characterised the gene expression profiles of Mtb when subjected to 75
different growth and environmental conditions. These included growth on alternative carbon sources,
starvation states, and treatment with different classes of anti-TB drugs.142 In addition, the ability to
modulate pathways using gene knockdowns, knock-ins and knockouts has facilitated drug target
identification at a high-throughput scale. A landmark study by Abrahams et al demonstrated the power
of target-based whole cell screening (TB-WCS) as a tool for drug discovery. These researchers designed
and generated conditional mutants that underexpress essential genes, consequently identifying
inhibitors of pantothenate synthetase (PanC), an enzyme considered essential in Mtb.143 A recent review
by Evans and Mizrahi highlighted the strengths and limitations of this approach in subsequent validation
of identified targets.144
1.8.1.3 Computational tools
It is not feasible to identify the targets and mechanisms of action of each compound or class in drug
discovery; the financial and time costs are massive, with high attrition rates for individual compounds.145
Computational methods offer an expedient complementary tool for drug target identification and,
subsequently, can be exploited in improving the efficiency of their binding to the target, reducing
potential on or off-target toxicity, and even by designing multi-targeting compounds. Various
computational tools have been used with varying levels of success in target identification, and the
success of these methods depends on the choice of screening tools and their implementation in each
phase of the drug discovery process.146,147
Computer-aided drug design uses chemistry to predict whether molecules bind to a target and, if so,
how strongly. Several in silico methods such as homology modelling, molecular docking, similarity
searches, and others are used in computational approaches to target identification.146–148 They can be
broadly categorised into structure-based and ligand-based methods. A third method, the use of
26
bioinformatics tools, is based on genomic, proteomic and statistical data and has gained traction in
recent years with the development of powerful computational systems. Much like in vitro experiments,
these are screening platforms that allow the reduction of enormous libraries of compounds to more
manageable numbers, to filter the number of drug candidates that can be progressed to each stage of
the process.
1.8.2 The value of re-discovery: Polypharmacology
The single drug-single target paradigm that was widely held in drug discovery has been challenged in
recent years as further research on established drugs with apparently singular known modes of action
has revealed additional targets. This has led drug discovery scientists to the knowledge that efficacy and
toxicity (on- and off-target effects) are often the result of modulation of multiple targets.149 This
phenomenon, known as polypharmacology, can be exploited in several ways. Multiple drug targets can
be harnessed for potential synergistic effects, enhancing the desired phenotype. Secondly, knowledge of
off-target pharmacological effects can be used to mitigate off-target toxicity through the design of more
selective drug molecules. Thirdly, uncovering additional targets of drugs or compounds can lead to the
repositioning of de-prioritised hit or lead compounds for different disease indications. In addition,
polypharmacological prediction can unravel new molecular targets for existing drugs, expanding their
scope of clinical benefit at a lower cost for the preclinical phase in comparison to a de novo drug
discovery project.150
A greater challenge in polypharmacology is the deliberate design of multi-targeted compounds or drugs,
demonstrated by Apsel and co-workers who rationally designed small molecule inhibitors targeting two
different protein families that are popular targets in cancer chemotherapy.151 A plausible benefit of this
approach is decreased likelihood of resistance to the drug by compensatory mechanisms, as two
different targets are inhibited simultaneously: the development of resistance by compensatory
mechanisms is therefore theoretically more difficult.
27
1.8.3 Mechanisms of drug resistance
Exposure to a drug induces mycobacterial stress responses that favour both genetic and physiological
survival mechanisms.70 Mechanisms of drug resistance can be broadly classified as intrinsic and
acquired.
1.8.3.1 Intrinsic drug resistance
Intrinsic resistance refers to the innate ability of a bacterium to resist the activity of a particular
antimicrobial agent through its inherent structural or functional characteristics.19 Intrinsic factors
include the cell wall as a permeability barrier, transcriptional regulation of drug resistance, drug
modification, mycothiol-mediated protection, and drug efflux. Efflux is responsible for both intrinsic and
acquired drug resistance, and will be discussed under acquired drug resistance mechanisms.
The mycobacterial cell wall as a permeability barrier
The architecture, molecular composition and structural complexity of the mycobacterial cell wall
distinguish it from that of all other microorganisms. Rich in mycolic acids, these characteristics enable it
to present a barrier to permeability to both hydrophobic and hydrophilic molecules, antibiotics included.
The cell envelope of mycobacteria is notorious for being several-fold less permeable to
chemotherapeutic agents when compared to functionally similar cell walls of other bacteria.152 Apart
from impeding entry to antibiotics, this multi-layered barrier enables the organism to survive under
harsh conditions by resisting chemical injury and dehydration through the various roles played by each
of the components of the cell envelope.153–155 Thus, it is not surprising that since the advent of TB
chemotherapy, inhibition of mycolic acid biosynthesis has been one of the most widely exploited and
successful drug targets. Disruption of the mycolic acid biosynthetic pathway is a well proven and
effective therapeutic target of several anti-TB drugs such as INH and EMB. Interestingly, these two anti-
TB agents were developed without prior knowledge of their ultimate molecular targets.
28
Transcriptional regulation of drug resistance
During infection and consequent antimicrobial treatment, Mtb undergoes various environmental
stresses such as hypoxia, genotoxic stress, and nutrient starvation. Mtb generates a coordinated,
specific response to antimicrobial treatment. A number of drug-induced transcriptional changes are
activated that lead to antimicrobial tolerance or intrinsic drug resistance. For example, Colangeli et al
demonstrated that antibiotic-induced expression of an MDR efflux pump operon was associated with
resistance to INH and EMB.156 Understanding the essentiality of the roles of these transcriptional factors
in mycobacteria would reap the benefit of expanding the potential drug targets for TB drug discovery.
Drug modification/degradation
Mycobacteria are able to inactivate xenobiotics such as antimicrobials through enzyme-mediated
chemical modification, resulting in drug resistance. In addition to the example of KAN in section Error!
Reference source not found. above, there are several other examples of antimicrobials degraded by
Mtb. Intrinsic resistance of Mtb to -lactams arises through two major mechanisms: poor outer
membrane permeability and drug modification.157 Mtb is resistant to -lactams through the constitutive
expression of -lactamase (encoded by blac), which inactivates -lactams through hydrolysis of the -
lactam ring.158 There are two widely-used approaches to circumvent this; co-formulation of -lactams
with -lactamase inhibitors such as clavulanic acid, and the development of carbapenems, which are
resistant to -lactamase.159 In a recent study, Warrier et al reported N-methylation as a mechanism of
Mtb resistance in vitro. These researchers demonstrated that a novel bactericidal compound was
inactivated through methylation by a previously uncharacterized methyltransferase, Rv0560c.160
Mycothiol-mediated protection
In the case of pathogenic organisms like Mtb, toxic oxidants from the host phagocytic response impose
oxidative stress, resulting in the alteration and corruption of lipids, carbohydrates and nucleic acids in
the mycobacterial cell wall and consequent death. Bacterial thiols play several roles in microorganisms.
They act as redox co-factors, redox buffers (important in the management of oxidative stress) and in the
detoxification of xenobiotics. Mycothiol (MSH), the predominant thiol in mycobacteria, has analogous
functions to Glutathione (GSH), an antioxidant in other bacteria, and functions to mop up free radicals
29
such as reactive oxygen species (ROS) and reactive nitrogen species (RNS).161,162 Decreased levels of MSH
have been associated with increased susceptibility of Mtb to RIF, STR and erythromycin, and even Mtb
resistance to the pro-drugs INH and ETH have been associated with decreased levels of MSH. The role of
xenobiotic detoxification is dependent on a number of enzymes, which have been discussed in a review
by Jothivasan and Hamilton.163
1.8.3.2 Acquired drug resistance
Acquired drug resistance occurs when a microorganism obtains the ability to resist the activity of a
particular antimicrobial agent to which it was previously susceptible. Acquired drug resistance in Mtb is
caused mainly by spontaneous mutations in chromosomal genes, and the selective growth of such drug-
resistant mutants may be promoted during suboptimal drug therapy.19
Spontaneous mutations
In Mtb, the evolution of resistant strains is driven mainly by the sequential acquisition and accumulation
of spontaneous mutations in chromosomal genes, with several physiological consequences that
manifest phenotypically as drug resistance. These mutations result in the alteration of the drug targets
in several ways such as: (1) over-expression of the drug target, as in the case of INH; (2) alteration of the
drug-binding site, consequently decreasing its affinity for the drug in the case of RIF, the
aminoglycosides and macrolides; and (3) partial or complete inhibition of prodrug activation in the case
of INH and PZA, among others.69,164 Spontaneous mutations may arise in genes that encode drug-
modifying enzymes, as is the case for the aminoglycoside KAN. Mtb evolves to MDR and XDR through a
step-wise accumulation of chromosomal mutations, each of which confers resistance to individual
drugs.165
In addition to mutations within single genes, drug resistance is also influenced by phenomena such as
epistasis – the interaction of additional genetic mutations, where the phenotypic effect of one mutation
is determined by the presence of one or more other mutations – and bacterial fitness – that is, where
mutation(s) may impact the level of resistance, growth rate, virulence, and transmissibility of a resistant
strain of Mtb.20,69
30
Drug Efflux
Efflux is a ubiquitous mechanism responsible for intrinsic and acquired drug resistance in prokaryotic
and eukaryotic organisms. Mtb presents one of the largest numbers of putative efflux pumps (EPs)
compared with its genome size. Consequently, active drug efflux systems have been shown to be
present in mycobacteria, extruding structurally and functionally unrelated compounds, including drugs.
This results in drug tolerance, as reported by Adams et al, who demonstrated the acquisition of drug-
tolerance during bacterial residence in macrophage as a result of efflux.166 Efflux pumps may select for a
single substrate or may be non-selective, conferring a multidrug resistant (MDR) phenotype.167
There are several clinical implications of the MDR efflux pumps; they have been implicated in the efflux
of a wide variety of substrates, among them -lactam antibiotics, which are being explored as a
therapeutic option for MDR-TB, ethionamide, the aminoglycosides, fluoroquinolones and macrolides, all
of which are part of the MDR-TB treatment regimen.167,168
Several strategies to counter the clinical impact of EPs are being explored. These include the use of
efflux pump inhibitors (EPIs) or efflux inhibitors (EI) such as thioridazine, verapamil, reserpine, and
omeprazole, all of which are clinically used drugs, albeit for non-infectious diseases.15,169–171 Medicinal
chemistry approaches have been employed to improve the design of existing EPIs and EIs and also to
design novel antimicrobials that are not substrates of the efflux pumps.117,172 These different strategies
have had varying levels of success at the in vitro and in vivo stages of testing and will hopefully form the
basis of adjunctive therapy or offer novel anti-TB drugs with less potential for efflux-mediated
resistance.173
1.9 Mycobacterium tuberculosis: An intracellular pathogen
As mentioned in section Error! Reference source not found. above, following inhalation of bacilli,
activation of innate and adaptive immune responses in the host contains the infection.174 Phagocytosis
by alveolar macrophages is followed by the recruitment of other immune cells such as neutrophils to the
site of infection, forming the granuloma, the primary structure that contains Mtb in the host. Within the
granuloma, several stress responses are activated during host infection, briefly summarized as:(1)
reactive intermediates, which cause oxidative and nitrosative stress; (2) acidification of the
phagolysosome; (3) nutritional starvation and (4) hypoxia.8,175
31
Through a range of host and bacterial-mediated mechanisms, the bacilli are able not only to survive, but
to replicate within the intracellular environment, consequently bursting out of the macrophages and
causing necrosis of the granulomatous lesions. Some of the mechanisms employed are: (1) inhibition of
phagosomal maturation; (2) production of radical scavengers that can process/convert reactive oxygen
species; (3) use of pH as an environmental cue, releasing chloride ions to counter the proton influx in the
phagosome; (4) synthesis of mycothiol, which serves as an antioxidant, maintaining intrabacterial
homeostasis; (5) induction of a ‘foamy macrophage’ phenotype in which lipid bodies may shelter
bacteria. The bacilli within, having undergone a metabolic shift, scavenge lipids such as triacylglycerides
(TAG) and cholesterol from the host as a nutrient source.8,9,176
These lesions lead to the destruction of surrounding tissue, encasing the lesion in a fibrotic capsule
consisting of a collagen rim. The resultant structure, the caseum, has been shown to have distinct
microenvironments within, adding heterogeneity to the outcome of infection and variability in the
response to drug therapy. In some cases, the caseum liquefies, resulting in cavitary disease, which is
associated with poor clinical outcomes, the development of drug resistance, and relapse. The widely-
held paradigm of TB as a binary disease (either active or latent) was first challenged by Barry et al, who
proposed a spectrum of disease; from those who have cleared infection with no future risk of active
disease, to those who incubate actively replicating bacilli without clinical symptoms177. This was
corroborated by Lenaerts and colleagues, who demonstrated the dynamic nature of TB lesions in human
infection, contrary to the assumption that they are stable and unchanging, due to the long duration of
time between infection and symptomatic disease.9 Furthermore, these researchers found that,
compared to individuals who have cleared infection, asymptomatic individuals infected with actively
replicating bacilli are at a higher risk of developing active disease.177
The outcome of lesions is dependent on the interplay of bacterial and host factors. In some cases, the
failure of the adaptive arm of immunity leads to liquefaction and necrosis. Moreover, recent studies
have shown the involvement of lipid mediators such as eicosanoids in the regulation of pro- and anti-
inflammatory responses associated with cytokines such as IL-1, leukotrienes and Tumour Necrosis
Factor (TNF).9,178 The mouse model has been most commonly used in studies of host infection, with the
limitation that mice do not form granulomas upon Mtb infection. These fail to capture several features
highly relevant to human Mtb pathology: the development of caseous necrosis and subsequent fibrosis,
which may limit drug penetration; hypoxia, which affects metabolic state of the bacilli; intra and extra
32
cellular bacterial populations, which cause variability in drug efficacy; and liquefaction and cavity
formation, which affect clinical outcome, drug resistance, and relapse. The recently developed Kramnik
mouse model is promising since it is characterized by granuloma formation in some mice, and so has
gained popularity in in vivo studies.179 However, non-human primates best simulate the full spectrum of
human infection.9
The relevance of macrophages in the overall course of infection has been challenged in recent years.
Although bacilli survive and disseminate from the phagolysosome of activated macrophages, sputum
and bronchoalveolar lavage (BAL) samples from infected patients have revealed a larger proportion of
bacilli contained within neutrophils than in macrophages.180 The “life cycle” of Mtb has also been
disputed; some researchers argue that the bacillus spends most of its life extracellularly, with the
intracellular stage as a brief interlude following infection. Nevertheless, intracellular bacilli create an
additional hurdle on the path of TB drugs from the blood compartment to their molecular targets. A
drug must permeate the granuloma to reach the bacilli. Using MOX, Prideaux et al demonstrated that
the lack of correlation between its excellent in vitro activity and poor efficacy in eradicating bacilli in
caseum was due to its failure to reach cidal concentrations.64 Furthermore, the microenvironment of the
phagolysosome contributes to decreased drug action, leading to heterogeneity in response to drug
treatment.9,64
Macrophages are among the first cells that Mtb encounters, and play a continued role in the outcome of
infection8. Furthermore, in a recent review, Tan and Russell argue that, in contrast to neutrophils, which
elicit a highly aggressive but short-lived response to Mtb, macrophages generate a longer, more
regulated antimicrobial response.8 It is therefore important to understand how Mtb survives under the
hostile intracellular environment. In vitro models of macrophage infection represent a powerful tool for
studying the host-pathogen interaction.181–183 Moreover, given the limitations of both target-based and
in vitro phenotypic screens, ex vivo screens employing Mtb-infected macrophages have been integrated
into the screening cascade in most drug discovery programs.184 These offer several advantages: they
provide information about uptake and cellular activity of compounds, and allow the identification of
cytotoxic compounds earlier in the screening cascade.184 In addition, these studies offer insights into the
bacterial mechanisms essential for intracellular survival that can be explored as part of host-directed
therapies.184 In a landmark study by VanderVen and colleagues, 340 000 compounds were screened and
found to have differential antimycobacterial activity, with a subset that were only active
33
intracellularly.185 These researchers further delineated the activity of these compounds, revealing a
smaller subset that inhibited intracellular Mtb growth by blocking Mtb catabolism of cholesterol, which
the bacilli scavenge from the host as a source of carbon due to the nutritional starvation induced by host
immune responses. In addition, these researchers developed fluorescent reporter strains of Mtb with
wide applicability in studying host-pathogen interactions at individual bacterium level when coupled
with confocal microscopy and other techniques; the heterogeneity in intracellular bacterial populations
in response to the intracellular environment, and its consequent impact on the outcome of infection and
treatment.185
In another landmark study, Brodin and colleagues used high-content imaging to screen a library of small
molecules, identifying inhibitors of a well-established drug target, decaprenylphosphoribosyl-ß-D-ribose
2’-epimerase 1 (DprE1), and reported that RIF and INH mitigate the cytopathogenic effects of Mtb
infection on macrophages.186 This study also reported 100-fold less activity of RIF intracellularly,
corroborating previous claims by other researchers.187 In recent years, macrophage models of infection
have evolved, and have even been coupled with imaging. This is exemplified by Stanley and co-workers,
who used high-content, high-throughput imaging to screen a library of clinical drugs, with the aim of
identifying those that target host pathways and consequently inhibit intracellular growth of Mtb.188
This study identified two broad categories; inhibitors of host pathways exploited by Mtb for virulence;
and those that activate immune responses targeting intracellular bacteria. Fluoxetine, an
antidepressant, was found to induce autophagy, while gefitinib, an anticancer drug, demonstrated ex
vivo and in vivo antimycobacterial efficacy in vitro and in mice infected with Mtb.188
Studies by Christophe et al showed that unstimulated human macrophages can restrict Mtb growth and
elicit both slow and fast replication phenotypes187. These authors demonstrated that bacterial
replication rates are dependent on bacterial burden, supporting the findings of Welin and co-workers,
who showed that, in low bacterial burden in macrophages, bacterial death is due to phagosomal
acidification, while in higher bacterial burden, necrosis is the main cause of bacterial death.189,190 In
addition, the findings of Christophe and colleagues challenged the widely held notion that bacterial
replication rates determine antibiotic susceptibility. This was corroborated by Raffetseder et al, who also
showed that drug susceptibility is not affected by the multiplicity of infection (MOI). MOI of 1 bacilli: 1
macrophage and 10 bacilli: 1 macrophage showed no differences in MIC values for INH, RIF and EMB.191
34
1.10 Absorption, Distribution, Metabolism and Excretion (ADME)
The activity of a drug in vivo is dependent not only on its action at the intended target, but also on the
concentration and duration of action of the drug at the target site.192 When administered orally, a drug
dissolves in the gastrointestinal tract, is absorbed through the walls of the intestine either passively or
actively, before its distribution to various compartments within the body, after which it undergoes
metabolism and is eventually excreted. These aspects are measured by the parameters, absorption,
distribution, metabolism and excretion, which collectively form the acronym ADME. The interplay of
these parameters affects the overall fate of a drug in the body, commonly referred to as the
pharmacokinetics (PK). Toxicity, which is considered along with ADME properties, has in recent years
extended the acronym to ADMET193. Due to its implications for the safety and efficacy of a drug, PK
optimisation is a key component of the drug discovery and development process.193 As can be seen from
Figure 1.10, after the year 2000, compound attrition rates dropped significantly after the integration of
PK earlier in the drug discovery and development cascade194.
Figure 1.10: Causes of compound attrition in drug discovery adapted from Kola and Landis, 2004194
35
1.10.1 Drug Metabolism
As part of their survival mechanism, living organisms eliminate foreign compounds (xenobiotics) that
pose a threat to their survival.195 Xenobiotics include environmental pollutants and toxins, food and the
chemicals present therein. Chemical modification facilitates the elimination process by making
xenobiotics amenable to excretion. Drugs are treated as xenobiotics, therefore the primary function of
drug metabolism is to make a lipophilic molecule more hydrophilic to enable conjugation and/or
excretion from the body.195–197
Metabolism involves a wide array of chemical modifications carried out by a variety of enzymes. In
addition to metabolising xenobiotics, these enzymes are also involved in the transformation of
endogenous substrates such as hormones, steroids and neurotransmitters.197,198 The liver is the main
organ involved in drug metabolism, although the skin, lungs, blood cells and plasma also contribute to
the biotransformation of certain drugs.
1.10.1.1 Drug metabolising enzymes
An array of enzymes is involved in the metabolism of drugs, and a review by Testa et al of more than
1000 xenobiotics found that cytochrome P450 (CYP450) enzymes account for up to 40% of the resultant
metabolites.199 CYP450 enzymes are encoded by 57 genes and 58 pseudogenes in man, pointing to their
significance in drug metabolism.200 Specifically, five major isoforms, namely CYP1A2, 2C9, 2C19, 2D6 and
3A4, are responsible for the metabolism of about 75% of clinically used drugs.201 This superfamily of
haem-containing enzymes is a class of oxidoreductases, specifically monooxygenases, which catalyse the
chemical addition of a single oxygen atom to substrates in a general reaction:
R-H + O2 + NADPH + H+ R-OH + NADP+ + H2O
Highest concentrations of CYP450 enzymes are expressed in the liver, with lower concentrations of
specific isoforms occurring in almost all body tissues, significantly in the respiratory tract, the kidneys,
gastrointestinal tract, the heart and skin.202
In addition to the CYP450 superfamily, other enzymes such as uridine diphosphate-glucuronyl
transferases (UGTs), esterases, dehydrogenases, among others also metabolise drugs, albeit to a lesser
extent.199 Table 1.2 below summarises some of the more common examples of non-CYP450 enzymes.199
36
Table 1.2: Examples of non-CYP450 enzymes involved in metabolism of xenobiotics
Enzyme class Function
Phase I
Flavin-containing monooxygenases
Oxygenation of highly polarisable
nucleophilic heteroatom-containing
drugs203
Monoamine oxidases Metabolism of catecholamines 204–
206
Esterases Activation of amide, ester and
thioesters prodrugs
Alcohol and aldehyde dehydrogenases Oxidative metabolism of alcohols
and aldehydes207
Aldo-keto reductases
Detoxification of reactive aldehydes
and unsaturated carbonyl
compounds208–210
Phase II
Glutathione-S-transferases Conjugative enzymes that couple
xenobiotics or phase I metabolites
to endogenous substrates to
facilitate excretion211–221
Uridine glucuronosyl transferases
Sulfotransferases
Methyl transferases
N-acetyl transferases
1.10.1.2 Classification of drug metabolism
In the past, drug metabolism was traditionally categorised into phase I and phase II. Phase I reactions
involve oxidoreductive and hydrolytic reactions that unmask reactive functional groups such as thiols,
amines, and carboxylic acids among others. These reactions include hydroxylation (aliphatic and
aromatic), epoxidation, dealkylation (N-, S- , and O) and oxidation (N-, S- , P-). Given the prevalence of
oxidoreductases, between 60 and 75% of phase I reactions are catalysed by CYP450 enzymes.199,222
Other enzymes involved in phase I metabolism include the flavin-containing monooxygenases (FMOs)
and monoamine oxidase (MAO) which metabolise endogenously produced neurotransmitters known as
catecholamines.203,223 In some cases, phase I metabolism products are marginally more hydrophilic.
37
Phase II reactions, in turn, typically involve conjugation of the phase I metabolites to more polar
endogenous molecules which facilitate excretion. In certain cases, they play a role in inactivation and
detoxification and, in even fewer, bioactivation of drugs.224 The enzymes involved include, among
others, uridine glucuronosyl transferases, sulfotransferases and methyl transferases.211 In a few cases,
phase I and II metabolism do not occur sequentially, as the substrates of conjugation are not always
products of phase I metabolism. This, in part, prompted Testa et al, who challenged this classification
through an extensive review of reactions and enzymes involved in metabolism of xenobiotics. These
researchers pointed out the importance of conjugation reactions before the phase I-associated redox
reactions.199,225
1.10.1.3 Classification of metabolites
Irrespective of the routes of metabolism, the resultant metabolites can be broadly classified into stable
and unstable, as discussed in the following sections.
Biologically inactive stable metabolites
The chemical modifications that occur during metabolism alter the chemical properties and,
consequently, the interaction between drugs and their target sites. Thus, in many instances, metabolism
leads to the significant or total loss of pharmacological activity. Knowledge of drug metabolism has been
exploited in the design of new drugs, with metabolic stability as one of the criteria for advancing a
compound or series of compounds. This is done with the aim of ensuring predictable optimal dosing
after metabolism, which has implications on efficacy. In some cases, a drug can be intentionally
designed to undergo metabolism within a time frame that allows it to achieve pharmacological activity
at the site of action. This approach is known as “soft drug” design, and has been used as a strategy to
mitigate on-target or, in the case of multiple metabolic products, off-target toxicity elicited by certain
metabolites.226
Biologically stable active metabolites
In some cases, the products of metabolism can result in metabolites with pharmacological activity that is
less, comparable to, or greater than, the parent molecule. This may be because some of the chemical
38
modifications due to metabolism do not alter the pharmacophore, and thus the drugs or compounds
retain activity. In such instances, other physicochemical properties such as aqueous solubility,
permeability, and chemical stability are altered, either to the benefit or detriment of overall drug
efficacy.227–230 Such metabolites are termed metabolic products of biotransformation, and examples
include marketed drugs such as acetaminophen, cetirizine and desloratidine. Figure 1.11.228,231 With
regards to definition, a minor contention exists, as they can be strictly defined as metabolites that share
a pharmacological target with the parent molecule, as described by Fura et al228. In contrast, other
scientists have widened the term to include prodrugs, which are devoid of activity by design, requiring
enzymatic modification (usually hydrolytic biotransformation) to elicit pharmacological activity.228,232,233
Figure 1.11: Examples of active metabolites developed into clinical drugs
Although most active metabolites stem from phase I metabolism, some phase II metabolites are known
to be active. Morphine is one such example, with two products of phase II metabolism, one active and
the other inactive (Figure 1.12). Morphine-6-glucuronide has superior analgesic activity to its parent
39
morphine, whereas morphine-3-glucuronide has been shown to be a potent opioid antagonist in animal
models and, paradoxically, has been reported to enhance pain through unknown mechanisms.234,235
Figure 1.12: Morphine and its metabolites in man
Reactive metabolites
Although metabolism is primarily a detoxification process, exceptions exist. In certain cases, drug
metabolism results in the formation of unstable and chemically reactive metabolites which result in
adverse drug reactions. Such metabolites are termed reactive metabolites. Their reactivity often occurs
through covalent binding to endogenous macromolecules in their immediate environment, which may
even involve the enzymes responsible for their formation. Other macromolecules they commonly bind
to are DNA, RNA and membrane proteins, resulting in long term carcinogenic or teratogenic effects.236–
241 Certain chemical functional groups are implicated in these reactions, and thus the term ‘structural
alerts’ was coined as a result of the existing evidence supporting their involvement in reactive
metabolite formation.242
40
1.10.1.4 Systems for drug metabolism studies
Various in vivo and in vitro systems have been developed to study drug metabolism for drug discovery
purposes. Mice and rats are the most commonly used animal models while, in certain cases, depending
on cost, throughput and the relevance to the disease under investigation, larger animals such as guinea
pigs and dogs are used. While animal models undoubtedly offer the most optimal biological complexity
and relevance to human disease, the cost and ethical implications have necessitated in vitro models as a
first step in screening compounds for later stages. In vitro systems are used in the early stages as a
preliminary means not only to prioritise the large number of compounds in the hit confirmation stage,
but also as a predictive tool for suitable dosage determination for pre-clinical in vivo studies.
Due to its central role as the major drug metabolising organ, the frequently used in vitro models are
hepatic. In decreasing order of biological complexity, the systems include: (1) whole perfused liver (2)
liver slices (3) hepatocytes (4) s9 fractions and (5) microsomes. S9 are sub-cellular liver fractions that
contain a complement of most phase I and II enzymes and are, as far as enzyme activity is concerned,
therefore the most complete sub-cellular fraction.243 Microsomes are the most commonly used model,
since they contain a complement of most CYP450 enzymes which, in turn, are of great relevance in the
metabolism of clinically used drugs.244 In the last two decades, recombinant expression of specific CYP
450 isoforms have become a household tool in biotransformation studies.201,222,237
1.10.1.5 Relevance of metabolism and metabolites in drug discovery and development
As mentioned in section 1.9 above, ADME properties have implications on the safety and efficacy of
drugs. Regulatory requirements for drug approval include characterisation of the metabolites of drug
candidates. It is therefore important to understand the contribution of metabolites to the activity of
compounds early in order to:
(1) Anticipate and incorporate strategies to mitigate toxicity of compounds in pre-clinical drug
discovery in order to minimise compound attrition rates downstream.
(2) Optimise PK properties of compounds, through for instance, the design of prodrugs.
Exploit potentially beneficial pharmacological effects of active metabolites in the design of
novel compounds.
41
1.11 Rationale
The literature reviewed above highlights the need for novel anti-TB agents with improved safety and
efficacy profiles; more potent agents with novel mechanisms of action, and activity against both drug-
sensitive and drug-resistant strains of Mtb. The past decade has seen massive gains in TB drug discovery,
with several new drugs approved and others in various stages of clinical development. However, the
sobering reality of ever emerging resistance even to the new drugs, coupled with the high attrition rates
along the chain, underscore the need to constantly replenish the pipeline. Notably, drug repurposing
and repositioning have provided a significant proportion of the novel agents in clinical use. Furthermore,
several of these molecules are derivatives of natural products, subsequently sparking renewed interest
in old drugs and natural products as starting points for new leads.
Evidence from the foregoing literature also emphasizes the value of in vitro assays such as target
identification, intracellular efficacy evaluation and drug metabolism; if conducted upstream, they
provide valuable insights into the pharmacokinetic and pharmacological properties of compounds. In
turn, these can be exploited to streamline the drug discovery process in two ways: optimization or,
alternatively, de-prioritization of compounds earlier in the process.
1.12 Hypothesis
Natural products can serve as a template for new molecules with potential as antimycobacterial agents.
This project explores the repositioning of fusidic acid, a natural product-derived antibiotic for
antituberculosis drug discovery. Through a combination of chemistry and biology, this study entails the
in vitro characterization of pharmacological and pharmacokinetic properties of fusidic acid and several
derivatives.
42
1.13 Aim
The overall aim of this study was two-fold:
a) To identify novel analogues of fusidic acid with improved potency and pharmacokinetic
properties.
b) To carry out in vitro characterization of the pharmacological and pharmacokinetic properties of
fusidic acid and several derivatives.
1.14 Specific objectives:
i. Design and perform chemical semi-synthesis of fusidic acid derivatives.
ii. Conduct in vitro pharmacological evaluation of the fusidic acid derivatives.
iii. Determine the solubility of the derivatives.
iv. Evaluate the cytotoxicity of fusidic acid and derivatives.
v. Evaluate the intracellular efficacy of fusidic acid and selected derivatives in THP-1 cells.
vi. Perform in vitro pharmacokinetic evaluation of fusidic acid and selected derivatives.
vii. Identify the target of, and mechanisms of resistance to, fusidic acid in Mycobacterium
tuberculosis.
43
1.15 References
(1) Rockwood, N.; Wilkinson, R. J. Clin. Med. 2015, 15 Suppl 6, s43-9.
(2) Zumla, A.; George, A.; Sharma, V.; Herbert, N.; Baroness Masham of Ilton. Lancet 2013, 382
(9907), 1765–1767.
(3) World Health Organization. Global Tuberculosis Report; 2016.
(4) Sharma, S. K.; Mohan, A.; Kadhiravan, T. Indian J. Med. Res. 2005, 121 (4), 550–567.
(5) Ayles, H. M.; Godfrey-Faussett, P. Int. J. Tuberc. Lung Dis. 2009, 13 (12), 1450–1455.
(6) Stallings, C. L.; Glickman, M. S. Microbes Infect. 2010, 12 (14–15), 1091–1101.
(7) Diedrich, C. R.; Flynn, J. L. Infect. Immun. 2011, 79 (4), 1407–1417.
(8) Tan, S.; Russell, D. G. Immunol. Rev. 2015, 264 (1), 233–248.
(9) Lenaerts, A.; Barry, C. E.; Dartois, V. Immunol. Rev. 2015, 264 (1), 288–307.
(10) Russell, D. G. Immunol. Rev. 2011, 240 (1), 252–268.
(11) Kaufmann, S. H. E.; Weiner, J.; von Reyn, C. F. Int. J. Infect. Dis. 2017, 56, 263–267.
(12) Tameris, M. D.; Hatherill, M.; Landry, B. S.; Scriba, T. J.; Snowden, M. A.; Lockhart, S.; Shea, J. E.;
McClain, J. B.; Hussey, G. D.; Hanekom, W. A.; Mahomed, H.; McShane, H. Lancet 2013, 381
(9871), 1021–1028.
(13) Waksman, S. A.; Reilly, H. C.; Johnstone, D. B. J. Bacteriol. 1946, 52 (3), 393–397.
(14) Janin, Y. L. Bioorg. Med. Chem. 2007, 15 (7), 2479–2513.
(15) da Silva, P. E. A.; Von Groll, A.; Martin, A.; Palomino, J. C. FEMS Immunol. Med. Microbiol. 2011,
63 (1), 1–9.
(16) Schito, M.; Migliori, G. B.; Fletcher, H. A.; McNerney, R.; Centis, R.; D’Ambrosio, L.; Bates, M.;
Kibiki, G.; Kapata, N.; Corrah, T.; Bomanji, J.; Vilaplana, C.; Johnson, D.; Mwaba, P.; Maeurer, M.;
Zumla, A. Clin. Infect. Dis. 2015, 61 (suppl 3), S102–S118.
44
(17) Zumla, A.; Nahid, P.; Cole, S. T. Nat. Rev. Drug Discov. 2013, 12 (5), 388–404.
(18) Pai, M.; Behr, M. A.; Dowdy, D.; Dheda, K.; Divangahi, M.; Boehme, C. C.; Ginsberg, A.;
Swaminathan, S.; Spigelman, M.; Getahun, H.; Menzies, D.; Raviglione, M. Nat. Rev. Dis. Prim.
2016, 2, 16076.
(19) Kolyva, A. S.; Karakousis, P. C. In Understanding Tuberculosis – New Approaches to Fighting
Against Drug Resistance; Cardona, P.-J., Ed.; 2012.
(20) Koch, A.; Mizrahi, V.; Warner, D. F. Emerg. Microbes Infect. 2014, 3 (3), 17.
(21) Campbell, E. A.; Korzheva, N.; Mustaev, A.; Murakami, K.; Nair, S.; Goldfarb, A.; Darst, S. A. Cell
2001, 104 (6), 901–912.
(22) Takayama, K.; Wang, C.; Besra, G. S. Clin. Microbiol. Rev. 2005, 18 (1), 81–101.
(23) Lei, B.; Wei, C. J.; Tu, S. C. J. Biol. Chem. 2000, 275 (4), 2520–2526.
(24) Musser, J. M.; Kapur, V.; Williams, D. L.; Kreiswirth, B. N.; van Soolingen, D.; van Embden, J. D. J.
Infect. Dis. 1996, 173 (1), 196–202.
(25) Basso, L. A.; Zheng, R.; Musser, J. M.; Jacobs, W. R.; Blanchard, J. S. J. Infect. Dis. 1998, 178 (3),
769–775.
(26) Scorpio, A.; Zhang, Y. Nat. Med. 1996, 2 (6), 662–667.
(27) Zhang, Y.; Scorpio, A.; Nikaido, H.; Sun, Z. J. Bacteriol. 1999, 181 (7), 2044–2049.
(28) Shi, W.; Zhang, X.; Jiang, X.; Yuan, H.; Lee, J. S.; Barry, C. E.; Wang, H.; Zhang, W.; Zhang, Y. Science
(80-. ). 2011, 333 (6049), 1630–1632.
(29) Dillon, N. A.; Peterson, N. D.; Feaga, H. A.; Keiler, K. C.; Baughn, A. D. Sci. Rep. 2017, 7 (1), 6135.
(30) Gopal, P.; Nartey, W.; Ragunathan, P.; Sarathy, J.; Kaya, F.; Yee, M.; Setzer, C.; Manimekalai, M. S.
S.; Dartois, V.; Grüber, G.; Dick, T. ACS Infect. Dis. 2017, 3 (11), 807–819.
(31) Goldberg, D. E.; Siliciano, R. F.; Jacobs, W. R. Cell 2012, 148 (6), 1271–1283.
45
(32) Via, L. E.; Savic, R.; Weiner, D. M.; Zimmerman, M. D.; Prideaux, B.; Irwin, S. M.; Lyon, E.; O’Brien,
P.; Gopal, P.; Eum, S.; Lee, M.; Lanoix, J.-P.; Dutta, N. K.; Shim, T.; Cho, J. S.; Kim, W.; Karakousis,
P. C.; Lenaerts, A.; Nuermberger, E.; Barry, C. E.; Dartois, V. ACS Infect. Dis. 2015, 1 (5), 203–214.
(33) Caminero, J. A.; Sotgiu, G.; Zumla, A.; Migliori, G. B. Lancet Infect. Dis. 2010, 10 (9), 621–629.
(34) Belanger, A. E.; Besra, G. S.; Ford, M. E.; Mikusová, K.; Belisle, J. T.; Brennan, P. J.; Inamine, J. M.
Proc. Natl. Acad. Sci. U. S. A. 1996, 93 (21), 11919–11924.
(35) Korkegian, A.; Roberts, D. M.; Blair, R.; Parish, T. J. Biol. Chem. 2014, 289 (51), 35172–35181.
(36) He, L.; Wang, X.; Cui, P.; Jin, J.; Chen, J.; Zhang, W.; Zhang, Y. Tuberculosis 2015, 95 (2), 149–154.
(37) Telenti, A.; Philipp, W. J.; Sreevatsan, S.; Bernasconi, C.; Stockbauer, K. E.; Wieles, B.; Musser, J.
M.; Jacobs, W. R. Nat. Med. 1997, 3 (5), 567–570.
(38) Kim, K. H.; An, D. R.; Song, J.; Yoon, J. Y.; Kim, H. S.; Yoon, H. J.; Im, H. N.; Kim, J.; Kim, D. J.; Lee, S.
J.; Kim, K.-H.; Lee, H.-M.; Kim, H.-J.; Jo, E.-K.; Lee, J. Y.; Suh, S. W. Proc. Natl. Acad. Sci. 2012, 109
(20), 7729–7734.
(39) Alangaden, G. J.; Kreiswirth, B. N.; Aouad, A.; Khetarpal, M.; Igno, F. R.; Moghazeh, S. L.;
Manavathu, E. K.; Lerner, S. A. Antimicrob. Agents Chemother. 1998, 42 (5), 1295–1297.
(40) Zaunbrecher, M. A.; Sikes, R. D.; Metchock, B.; Shinnick, T. M.; Posey, J. E. Proc. Natl. Acad. Sci.
2009, 106 (47), 20004–20009.
(41) Chen, W.; Biswas, T.; Porter, V. R.; Tsodikov, O. V; Garneau-Tsodikova, S. Proc. Natl. Acad. Sci.
2011, 108 (24), 9804–9808.
(42) Mingeot-Leclercq, M. P.; Tulkens, P. M. Antimicrob. Agents Chemother. 1999, 43 (5), 1003–1012.
(43) Selimoglu, E. Curr. Pharm. Des. 2007, 13 (1), 119–126.
(44) Basic and Clinical Pharmacology, 12th ed.; Katzung, B. G., Masters, S. B., Trevor, A. J., Eds.;
McGraw-Hill, 2012.
(45) Drlica, K.; Mustaev, A.; Towle, T. R.; Luan, G.; Kerns, R. J.; Berger, J. M. ACS Chem. Biol. 2014, 9
46
(12), 2895–2904.
(46) Gillespie, S. H.; Crook, A. M.; McHugh, T. D.; Mendel, C. M.; Meredith, S. K.; Murray, S. R.; Pappas,
F.; Phillips, P. P. J.; Nunn, A. J. N. Engl. J. Med. 2014, 371 (17), 1577–1587.
(47) Jindani, A.; Harrison, T. S.; Nunn, A. J.; Phillips, P. P. J.; Churchyard, G. J.; Charalambous, S.;
Hatherill, M.; Geldenhuys, H.; McIlleron, H. M.; Zvada, S. P.; Mungofa, S.; Shah, N. A.; Zizhou, S.;
Magweta, L.; Shepherd, J.; Nyirenda, S.; van Dijk, J. H.; Clouting, H. E.; Coleman, D.; Bateson, A. L.
E.; McHugh, T. D.; Butcher, P. D.; Mitchison, D. A. N. Engl. J. Med. 2014, 371 (17), 1599–1608.
(48) Merle, C. S.; Fielding, K.; Sow, O. B.; Gninafon, M.; Lo, M. B.; Mthiyane, T.; Odhiambo, J.;
Amukoye, E.; Bah, B.; Kassa, F.; N’Diaye, A.; Rustomjee, R.; de Jong, B. C.; Horton, J.; Perronne, C.;
Sismanidis, C.; Lapujade, O.; Olliaro, P. L.; Lienhardt, C. N. Engl. J. Med. 2014, 371 (17), 1588–
1598.
(49) Witek, M. A.; Kuiper, E. G.; Minten, E.; Crispell, E. K.; Conn, G. L. J. Biol. Chem. 2017, 292 (5),
1977–1987.
(50) Johansen, S. K.; Maus, C. E.; Plikaytis, B. B.; Douthwaite, S. Mol. Cell 2006, 23 (2), 173–182.
(51) Banerjee, A.; Dubnau, E.; Quemard, A.; Balasubramanian, V.; Um, K. S.; Wilson, T.; Collins, D.; de
Lisle, G.; Jacobs, W. R. Science 1994, 263 (5144), 227–230.
(52) Vilchèze, C.; Jacobs JR., W. R. Microbiol. Spectr. 2014, 2 (4).
(53) Vannelli, T. A.; Dykman, A.; Ortiz de Montellano, P. R. J. Biol. Chem. 2002, 277 (15), 12824–12829.
(54) Vilchèze, C.; Av-Gay, Y.; Attarian, R.; Liu, Z.; Hazbón, M. H.; Colangeli, R.; Chen, B.; Liu, W.; Alland,
D.; Sacchettini, J. C.; Jacobs Jr, W. R. Mol. Microbiol. 2008, 69 (5), 1316–1329.
(55) Ang, M. L. T.; Siti, Z. Z. R.; Shui, G.; Diani kova, P.; Madacki, J.; Lin, W.; Koh, V. H. Q.; Martinez
Gomez, J. M.; Sudarkodi, S.; Bendt, A.; Wenk, M.; Miku ova, K.; Kordulakova, J.; Pethe, K.; Alonso,
S. Infect. Immun. 2014, 82 (5), 1850–1859.
(56) Müller, B.; Streicher, E. M.; Hoek, K. G. P.; Tait, M.; Trollip, A.; Bosman, M. E.; Coetzee, G. J.;
Chabula-Nxiweni, E. M.; Hoosain, E.; Gey van Pittius, N. C.; Victor, T. C.; van Helden, P. D.;
47
Warren, R. M. Int. J. Tuberc. Lung Dis. 2011, 15 (3), 344–351.
(57) Chakraborty, S.; Gruber, T.; Barry, C. E.; Boshoff, H. I.; Rhee, K. Y. Science 2013, 339 (6115), 88–
91.
(58) Zheng, J.; Rubin, E. J.; Bifani, P.; Mathys, V.; Lim, V.; Au, M.; Jang, J.; Nam, J.; Dick, T.; Walker, J.
R.; Pethe, K.; Camacho, L. R. J. Biol. Chem. 2013, 288 (32), 23447–23456.
(59) Cáceres, N. E.; Harris, N. B.; Wellehan, J. F.; Feng, Z.; Kapur, V.; Barletta, R. G. J. Bacteriol. 1997,
179 (16), 5046–5055.
(60) Nitsche, M. A.; Jaussi, W.; Liebetanz, D.; Lang, N.; Tergau, F.; Paulus, W.
Neuropsychopharmacology 2004, 29 (8), 1573–1578.
(61) Balaban, N. Q.; Gerdes, K.; Lewis, K.; McKinney, J. D. Nat. Rev. Microbiol. 2013, 11 (8), 587–591.
(62) Chao, M. C.; Rubin, E. J. Annu. Rev. Microbiol. 2010, 64 (1), 293–311.
(63) Barry, C. E.; Boshoff, H. I.; Dartois, V.; Dick, T.; Ehrt, S.; Flynn, J.; Schnappinger, D.; Wilkinson, R. J.;
Young, D. Nat. Rev. Microbiol. 2009.
(64) Prideaux, B.; Via, L. E.; Zimmerman, M. D.; Eum, S.; Sarathy, J.; O’Brien, P.; Chen, C.; Kaya, F.;
Weiner, D. M.; Chen, P.-Y.; Song, T.; Lee, M.; Shim, T. S.; Cho, J. S.; Kim, W.; Cho, S. N.; Olivier, K.
N.; Barry, C. E.; Dartois, V. Nat. Med. 2015, 21 (10), 1223–1227.
(65) Sarathy, J. P.; Zuccotto, F.; Hsinpin, H.; Sandberg, L.; Via, L. E.; Marriner, G. A.; Masquelin, T.;
Wyatt, P.; Ray, P.; Dartois, V. ACS Infect. Dis. 2016, 2 (8), 552–563.
(66) van Helden, P. D.; Möller, M.; Babb, C.; Warren, R.; Walzl, G.; Uys, P.; Hoal, E. Novartis Found.
Symp. 2006, 279, 17-31-41, 216–219.
(67) Zhang, Y.; Yew, W.-W. Int. J. Tuberc. Lung Dis. 2015, 19 (11), 1276–1289.
(68) Mandavilli, A. Nat. Med. 2007, 13 (3), 271–271.
(69) Trauner, A.; Borrell, S.; Reither, K.; Gagneux, S. Drugs 2014, 74 (10), 1063–1072.
(70) Hoagland, D. T.; Liu, J.; Lee, R. B.; Lee, R. E. Adv. Drug Deliv. Rev. 2016, 102, 55–72.
48
(71) Cole, S. T. Drug Discov. Today 2017, 22 (3), 477–478.
(72) Palomino, J. C.; Martin, A. Future Microbiol. 2013, 8 (9), 1071–1080.
(73) Oprea, T. I.; Mestres, J. AAPS J. 2012, 14 (4), 759–763.
(74) Ashburn, T. T.; Thor, K. B. Nat. Rev. Drug Discov. 2004, 3 (8), 673–683.
(75) Kim, P.; Zhang, L.; Manjunatha, U. H.; Singh, R.; Patel, S.; Jiricek, J.; Keller, T. H.; Boshoff, H. I.;
Barry, C. E.; Dowd, C. S. J. Med. Chem. 2009, 52 (5), 1317–1328.
(76) Singh, R.; Manjunatha, U.; Boshoff, H. I. M.; Ha, Y. H.; Niyomrattanakit, P.; Ledwidge, R.; Dowd, C.
S.; Lee, I. Y.; Kim, P.; Zhang, L.; Kang, S.; Keller, T. H.; Jiricek, J.; Barry, C. E. Science 2008, 322
(5906), 1392–1395.
(77) Koul, A.; Arnoult, E.; Lounis, N.; Guillemont, J.; Andries, K. Nature 2011, 469 (7331), 483–490.
(78) Manjunatha, U. H.; Boshoff, H.; Dowd, C. S.; Zhang, L.; Albert, T. J.; Norton, J. E.; Daniels, L.; Dick,
T.; Pang, S. S.; Barry, C. E. Proc. Natl. Acad. Sci. U. S. A. 2006, 103 (2), 431–436.
(79) Matsumoto, M.; Hashizume, H.; Tomishige, T.; Kawasaki, M.; Tsubouchi, H.; Sasaki, H.;
Shimokawa, Y.; Komatsu, M. PLoS Med. 2006, 3 (11), e466.
(80) Haver, H. L.; Chua, A.; Ghode, P.; Lakshminarayana, S. B.; Singhal, A.; Mathema, B.; Wintjens, R.;
Bifani, P. Antimicrob. Agents Chemother. 2015, 59 (9), 5316–5323.
(81) Bloemberg, G. V.; Keller, P. M.; Stucki, D.; Trauner, A.; Borrell, S.; Latshang, T.; Coscolla, M.;
Rothe, T.; Hömke, R.; Ritter, C.; Feldmann, J.; Schulthess, B.; Gagneux, S.; Böttger, E. C. N. Engl. J.
Med. 2015, 373 (20), 1986–1988.
(82) Lee, M.; Lee, J.; Carroll, M. W.; Choi, H.; Min, S.; Song, T.; Via, L. E.; Goldfeder, L. C.; Kang, E.; Jin,
B.; Park, H.; Kwak, H.; Kim, H.; Jeon, H.-S.; Jeong, I.; Joh, J. S.; Chen, R. Y.; Olivier, K. N.; Shaw, P.
A.; Follmann, D.; Song, S. D.; Lee, J.-K.; Lee, D.; Kim, C. T.; Dartois, V.; Park, S.-K.; Cho, S.-N.; Barry,
C. E. N. Engl. J. Med. 2012, 367 (16), 1508–1518.
(83) Lee, M.; Song, T.; Kim, Y.; Jeong, I.; Cho, S. N.; Barry, C. E. N. Engl. J. Med. 2015, 373 (3), 290–291.
49
(84) Wallis, R. S.; Maeurer, M.; Mwaba, P.; Chakaya, J.; Rustomjee, R.; Migliori, G. B.; Marais, B.;
Schito, M.; Churchyard, G.; Swaminathan, S.; Hoelscher, M.; Zumla, A. Lancet Infect. Dis. 2016, 16
(4), e34–e46.
(85) Furin, J. J.; Du Bois, J.; van Brakel, E.; Chheng, P.; Venter, A.; Peloquin, C. A.; Alsultan, A.; Thiel, B.
A.; Debanne, S. M.; Boom, W. H.; Diacon, A. H.; Johnson, J. L. Antimicrob. Agents Chemother.
2016, 60 (11), 6591–6599.
(86) Balasubramanian, V.; Solapure, S.; Shandil, R.; Gaonkar, S.; Mahesh, K. N.; Reddy, J.; Deshpande,
A.; Bharath, S.; Kumar, N.; Wright, L.; Melnick, D.; Butler, S. L. Antimicrob. Agents Chemother.
2014, 58 (7), 4185–4190.
(87) Palomino, J.; Martin, A. Antibiotics 2014, 3 (3), 317–340.
(88) Richter, E.; Rüsch-Gerdes, S.; Hillemann, D.; Borstel, F. Antimicrob. Agents Chemother. 2007, 51
(4), 1534–1536.
(89) Cholo, M. C.; Mothiba, M. T.; Fourie, B.; Anderson, R. J. Antimicrob. Chemother. 2017, 72 (2),
338–353.
(90) Moodley, R.; Godec, T. R. Eur. Respir. Rev. 2016, 25 (139), 29–35.
(91) Nunn, A. J.; Rusen, I.; Van Deun, A.; Torrea, G.; Phillips, P. P.; Chiang, C.-Y.; Squire, S. B.; Madan,
J.; Meredith, S. K. Trials 2014, 15 (1), 353.
(92) Tang, S.; Yao, L.; Hao, X.; Liu, Y.; Zeng, L.; Liu, G.; Li, M.; Li, F.; Wu, M.; Zhu, Y.; Sun, H.; Gu, J.;
Wang, X.; Zhang, Z. Clin. Infect. Dis. 2015.
(93) Zhang, D.; Lu, Y.; Liu, K.; Liu, B.; Wang, J.; Zhang, G.; Zhang, H.; Liu, Y.; Wang, B.; Zheng, M.; Fu, L.;
Hou, Y.; Gong, N.; Lv, Y.; Li, C.; Cooper, C. B.; Upton, A. M.; Yin, D.; Ma, Z.; Huang, H. J. Med.
Chem. 2012, 55 (19), 8409–8417.
(94) Zhang, D.; Liu, Y.; Zhang, C.; Zhang, H.; Wang, B.; Xu, J.; Fu, L.; Yin, D.; Cooper, C.; Ma, Z.; Lu, Y.;
Huang, H. Molecules 2014, 19 (4), 4380–4394.
(95) Li, W.; Upadhyay, A.; Fontes, F. L.; North, E. J.; Wang, Y.; Crans, D. C.; Grzegorzewicz, A. E.; Jones,
50
V.; Franzblau, S. G.; Lee, R. E.; Crick, D. C.; Jackson, M. Antimicrob. Agents Chemother. 2014, 58
(11), 6413–6423.
(96) Belardinelli, J. M.; Yazidi, A.; Yang, L.; Fabre, L.; Li, W.; Jacques, B.; Angala, S. kumar; Rouiller, I.;
Zgurskaya, H. I.; Sygusch, J.; Jackson, M. ACS Infect. Dis. 2016, 2 (10), 702–713.
(97) Li, W.; Sanchez-Hidalgo, A.; Jones, V.; Calado Nogueira de Moura, V.; North, E. J.; Jackson, M.
Antimicrob. Agents Chemother. 2017, AAC.02399-16.
(98) Sotgiu, G.; D’Ambrosio, L.; Centis, R.; Tiberi, S.; Esposito, S.; Dore, S.; Spanevello, A.; Migliori, G.
Int. J. Mol. Sci. 2016, 17 (3), 373.
(99) Diacon, A. H.; van der Merwe, L.; Barnard, M.; von Groote-Bidlingmaier, F.; Lange, C.; García-
Basteiro, A. L.; Sevene, E.; Ballell, L.; Barros-Aguirre, D. N. Engl. J. Med. 2016, 375 (4), 393–394.
(100) Sassetti, C. M.; Boyd, D. H.; Rubin, E. J. Mol. Microbiol. 2003, 48 (1), 77–84.
(101) Sassetti, C. M.; Rubin, E. J. Proc. Natl. Acad. Sci. U. S. A. 2003, 100 (22), 12989–12994.
(102) Goldman, R. C. Tuberculosis 2013.
(103) Schenone, M.; Dančík, V.; Wagner, B. K.; Clemons, P. a. Nat. Chem. Biol. 2013, 9 (4), 232–240.
(104) Koehn, F. E.; Carter, G. T. Nat. Rev. Drug Discov. 2005, 4 (3), 206–220.
(105) Newman, D. J.; Cragg, G. M. J. Nat. Prod. 2012, 75 (3), 311–335.
(106) Cragg, G. M.; Newman, D. J. Biochem. Pharmacol. 2013, 1830 (6), 3670–3695.
(107) Evans, B. E.; Rittle, K. E.; Bock, M. G.; Dipardo, R. M.; Freidinger, R. M.; Whitter, W. L.; Lundell, G.
F.; Veber, D. F.; Anderson, P. S.; Chang, R. S. L.; Lotti, V. J.; Cerino, D. J.; Chen, T. B.; Kling, P. J.;
Kunkel, K. A.; Springer, J. P.; Hirshfieldt, J. J. Med. Chem 1988, 31 (12), 2235–2246.
(108) Nicolaou, K. C.; Pfefferkorn, J. A.; Roecker, A. J.; Cao, G.-Q.; Barluenga, S.; Mitchell, H. J. J. Am.
Chem. Soc. 2000, 122 (41), 9939–9953.
(109) Farah, S. I.; Abdelrahman, A. A.; North, E. J.; Chauhan, H. Assay Drug Dev. Technol. 2016, 14 (1),
29–38.
51
(110) Grzelak, E. M.; Hwang, C.; Cai, G.; Nam, J.-W.; Choules, M. P.; Gao, W.; Lankin, D. C.; McAlpine, J.
B.; Mulugeta, S. G.; Napolitano, J. G.; Suh, J.-W.; Yang, S. H.; Cheng, J.; Lee, H.; Kim, J.-Y.; Cho, S.-
H.; Pauli, G. F.; Franzblau, S. G.; Jaki, B. U. ACS Infect. Dis. 2016, 2 (4), 294–301.
(111) Carter, G. T. Nat. Prod. Rep. 2011, 28 (11), 1783.
(112) Jacobsen, J. R.; Keatinge-Clay, A. T.; Cane, D. E.; Khosla, C. Bioorg. Med. Chem. 1998, 6 (8), 1171–
1177.
(113) Jacobsen, J. R.; Khosla, C. Curr. Opin. Chem. Biol. 1998, 2 (1), 133–137.
(114) Schreiber, S. L. Sci. 2000, 287 (5460), 1964–1969.
(115) Welsch, M. E.; Snyder, S. A.; Stockwell, B. R. Curr. Opin. Chem. Biol. 2010, 14 (3), 347–361.
(116) Sensi, P. Rev. Infect. Dis. 1983, 5 Suppl 3, S402-6.
(117) Lee, R. E.; Hurdle, J. G.; Liu, J.; Bruhn, D. F.; Matt, T.; Scherman, M. S.; Vaddady, P. K.; Zheng, Z.;
Qi, J.; Akbergenov, R.; Das, S.; Madhura, D. B.; Rathi, C.; Trivedi, A.; Villellas, C.; Lee, R. B.; Rakesh;
Waidyarachchi, S. L.; Sun, D.; McNeil, M. R.; Ainsa, J. A.; Boshoff, H. I.; Gonzalez-Juarrero, M.;
Meibohm, B.; Böttger, E. C.; Lenaerts, A. J. Nat. Med. 2014, 20 (2), 152–158.
(118) Kling, A.; Lukat, P.; Almeida, D. V.; Bauer, A.; Fontaine, E.; Sordello, S.; Zaburannyi, N.; Herrmann,
J.; Wenzel, S. C.; Konig, C.; Ammerman, N. C.; Barrio, M. B.; Borchers, K.; Bordon-Pallier, F.;
Bronstrup, M.; Courtemanche, G.; Gerlitz, M.; Geslin, M.; Hammann, P.; Heinz, D. W.; Hoffmann,
H.; Klieber, S.; Kohlmann, M.; Kurz, M.; Lair, C.; Matter, H.; Nuermberger, E.; Tyagi, S.; Fraisse, L.;
Grosset, J. H.; Lagrange, S.; Muller, R. Science (80-. ). 2015, 348 (6239), 1106–1112.
(119) Bucci, M. Nat. Chem. Biol. 2015, 11 (8), 548–548.
(120) Holzgrabe, U. Chem. Biol. 2015, 22 (8), 981–982.
(121) Zumla, A.; Rao, M.; Wallis, R. S.; Kaufmann, S. H. E.; Rustomjee, R.; Mwaba, P.; Vilaplana, C.;
Yeboah-Manu, D.; Chakaya, J.; Ippolito, G.; Azhar, E.; Hoelscher, M.; Maeurer, M. Lancet Infect.
Dis. 2016, 16 (4), e47–e63.
(122) Parihar, S. P.; Guler, R.; Khutlang, R.; Lang, D. M.; Hurdayal, R.; Mhlanga, M. M.; Suzuki, H.;
52
Marais, A. D.; Brombacher, F. J. Infect. Dis. 2014, 209 (5), 754–763.
(123) Zumla, A.; Chakaya, J.; Hoelscher, M.; Ntoumi, F.; Rustomjee, R.; Vilaplana, C.; Yeboah-Manu, D.;
Rasolof, V.; Munderi, P.; Singh, N.; Aklillu, E.; Padayatchi, N.; Macete, E.; Kapata, N.; Mulenga, M.;
Kibiki, G.; Mfinanga, S.; Nyirenda, T.; Maboko, L.; Garcia-Basteiro, A.; Rakotosamimanana, N.;
Bates, M.; Mwaba, P.; Reither, K.; Gagneux, S.; Edwards, S.; Mfinanga, E.; Abdulla, S.; Cardona, P.-
J.; Russell, J. B. W.; Gant, V.; Noursadeghi, M.; Elkington, P.; Bonnet, M.; Menendez, C.; Dieye, T.
N.; Diarra, B.; Maiga, A.; Aseffa, A.; Parida, S.; Wejse, C.; Petersen, E.; Kaleebu, P.; Oliver, M.;
Craig, G.; Corrah, T.; Tientcheu, L.; Antonio, M.; Rao, M.; McHugh, T. D.; Sheikh, A.; Ippolito, G.;
Ramjee, G.; Kaufmann, S. H. E.; Churchyard, G.; Steyn, A.; Grobusch, M.; Sanne, I.; Martinson, N.;
Madansein, R.; Wilkinson, R. J.; Mayosi, B.; Schito, M.; Wallis, R. S.; Maeurer, M. Nat. Rev. Drug
Discov. 2015, 14 (8), 511–512.
(124) Zumla, A.; Maeurer, M. Clin. Infect. Dis. 2015, 61 (9), 1432–1438.
(125) Cole, S. T.; Brosch, R.; Parkhill, J.; Garnier, T.; Churcher, C.; Harris, D.; Gordon, S. V; Eiglmeier, K.;
Gas, S.; Barry, C. E.; Tekaia, F.; Badcock, K.; Basham, D.; Brown, D.; Chillingworth, T.; Connor, R.;
Davies, R.; Devlin, K.; Feltwell, T.; Gentles, S.; Hamlin, N.; Holroyd, S.; Hornsby, T.; Jagels, K.;
Krogh, A.; McLean, J.; Moule, S.; Murphy, L.; Oliver, K.; Osborne, J.; Quail, M. A.; Rajandream, M.
A.; Rogers, J.; Rutter, S.; Seeger, K.; Skelton, J.; Squares, R.; Squares, S.; Sulston, J. E.; Taylor, K.;
Whitehead, S.; Barrell, B. G. Nature 1998, 393 (6685), 537–544.
(126) Camus, J.-C.; Pryor, M. J.; Médigue, C.; Cole, S. T. Microbiology 2002, 148 (Pt 10), 2967–2973.
(127) Ramaswamy, S.; Musser, J. M. Tuber. Lung Dis. 1998, 79 (1), 3–29.
(128) Vilchèze, C.; Jacobs, Jr., W. R. Annu. Rev. Microbiol. 2007, 61 (1), 35–50.
(129) Graves, P. R.; Haystead, T. A. J. Microbiol. Mol. Biol. Rev. 2002, 66 (1), 39–63.
(130) Verhelst, S. H. L.; Bogyo, M. Biotechniques 2005, 38 (2), 175–177.
(131) Bantscheff, M.; Eberhard, D.; Abraham, Y.; Bastuck, S.; Boesche, M.; Hobson, S.; Mathieson, T.;
Perrin, J.; Raida, M.; Rau, C.; Reader, V.; Sweetman, G.; Bauer, A.; Bouwmeester, T.; Hopf, C.;
Kruse, U.; Neubauer, G.; Ramsden, N.; Rick, J.; Kuster, B.; Drewes, G. Nat. Biotechnol. 2007, 25
53
(9), 1035–1044.
(132) Rix, U.; Superti-Furga, G. Nat. Chem. Biol. 2009, 5 (9), 616–624.
(133) Gygi, S. P.; Rist, B.; Gerber, S. A.; Turecek, F.; Gelb, M. H.; Aebersold, R. Nat. Biotechnol. 1999, 17
(10), 994–999.
(134) Kani, K. Methods Mol. Biol. 2017, 1550, 171–184.
(135) Ross, P. L. Mol. Cell. Proteomics 2004, 3 (12), 1154–1169.
(136) Thompson, A.; Schäfer, J.; Kuhn, K.; Kienle, S.; Schwarz, J.; Schmidt, G.; Neumann, T.; Johnstone,
R.; Mohammed, A. K. A.; Hamon, C. Anal. Chem. 2003, 75 (8), 1895–1904.
(137) Winter, G. E.; Rix, U.; Carlson, S. M.; Gleixner, K. V; Grebien, F.; Gridling, M.; Müller, A. C.;
Breitwieser, F. P.; Bilban, M.; Colinge, J.; Valent, P.; Bennett, K. L.; White, F. M.; Superti-Furga, G.
Nat. Chem. Biol. 2012, 8 (11), 905–912.
(138) Ghidelli-Disse, S.; Lafuente-Monasterio, M.; Waterson, D.; Witty, M.; Younis, Y.; Paquet, T.;
Street, L. J.; Chibale, K.; Gamo-Benito, F.; Bantscheff, M.; Drewes, G. Malar. J. 2014, 13 (Suppl 1),
P38.
(139) Crispino, J., D.; Wen, Q.; Huang, Z.; Stern, Z.; Gould, R., J. Methods for inducing polyploidization
of megakaryocytes and for treating blood and bone marrow diseases and disorders: US Patent
US8933071, 2009.
(140) Warner, D. F.; Mizrahi, V. S. Afr. Med. J. 2012, 102 (6), 457–460.
(141) Sioud, M. In Methods in Molecular Biology; Sioud, M., Ed.; Humana Press: New Jersey, 2007; pp
1–12.
(142) Boshoff, H. I. M.; Myers, T. G.; Copp, B. R.; McNeil, M. R.; Wilson, M. A.; Barry, C. E. J. Biol. Chem.
2004, 279 (38), 40174–40184.
(143) Abrahams, G. L.; Kumar, A.; Savvi, S.; Hung, A. W.; Wen, S.; Abell, C.; Barry, C. E.; Sherman, D. R.;
Boshoff, H. I. M.; Mizrahi, V. Chem. Biol. 2012, 19 (7), 844–854.
54
(144) Evans, J. C.; Mizrahi, V. Front. Microbiol. 2015, 6, 812.
(145) Dai, Y.-F.; Zhao, X.-M. Biomed Res. Int. 2015, 2015, 239654.
(146) Ekins, S.; Mestres, J.; Testa, B. Br. J. Pharmacol. 2007, 152 (December 2006), 9–20.
(147) Ekins, S.; Mestres, J.; Testa, B. Br. J. Pharmacol. 2007, 152 (1), 21–37.
(148) Wadood, A.; Ahmed, N.; Shah, L.; Ahmad, A.; H, H.; Shams, S. open Access Drug Des. Deliv. 2013,
1 (3), 1–4.
(149) Brotzoesterhelt, H.; Brunner, N. Curr. Opin. Pharmacol. 2008, 8 (5), 564–573.
(150) Rastelli, G.; Pinzi, L. Front. Pharmacol. 2015, 6 (1), 6187–6194.
(151) Apsel, B.; Blair, J. A.; Gonzalez, B. Z.; Nazif, T. M.; Feldman, M. E.; Aizenstein, B.; Hoffman, R.;
Williams, R. L.; Shokat, K. M.; Knight, Z. A. Nat Chem Biol 2008, 4 (11), 691–699.
(152) Sarathy, J.; Dartois, V.; Lee, E. Pharmaceuticals 2012, 5 (12), 1210–1235.
(153) Niederweis, M.; Danilchanka, O.; Huff, J.; Hoffmann, C.; Engelhardt, H. Trends Microbiol. 2010, 18
(3), 109–116.
(154) Brennan, P. J. Tuberculosis (Edinb). 2003, 83 (1–3), 91–97.
(155) Jackson, M. Cold Spring Harb. Perspect. Med. 2014, 4 (10), a021105–a021105.
(156) Hazbón, M. H.; Bobadilla Del Valle, M.; Guerrero, M. I.; Varma-Basil, M.; Filliol, I.; Cavatore, M.;
Colangeli, R.; Safi, H.; Billman-Jacobe, H.; Lavender, C.; Fyfe, J.; García-García, L.; Davidow, A.;
Brimacombe, M.; León, C. I.; Porras, T.; Bose, M.; Chaves, F.; Eisenach, K. D.; Sifuentes-Osornio, J.;
Ponce De León, A.; Cave, M. D.; Alland, D. Antimicrob. Agents Chemother. 2005, 49 (9), 3794–
3802.
(157) Wivagg, C. N.; Bhattacharyya, R. P.; Hung, D. T. J. Antibiot. (Tokyo). 2014, 67 (9), 645–654.
(158) Hugonnet, J.-E.; Blanchard, J. S. Biochemistry 2007, 46 (43), 11998–12004.
(159) Hugonnet, J.-E.; Tremblay, L. W.; Boshoff, H. I.; Barry, C. E.; Blanchard, J. S. Science 2009, 323
55
(5918), 1215–1218.
(160) Warrier, T.; Kapilashrami, K.; Argyrou, A.; Ioerger, T. R.; Little, D.; Murphy, K. C.; Nandakumar, M.;
Park, S.; Gold, B.; Mi, J.; Zhang, T.; Meiler, E.; Rees, M.; Somersan-Karakaya, S.; Porras-De
Francisco, E.; Martinez-Hoyos, M.; Burns-Huang, K.; Roberts, J.; Ling, Y.; Rhee, K. Y.; Mendoza-
Losana, A.; Luo, M.; Nathan, C. F. Proc. Natl. Acad. Sci. 2016, 113 (31), E4523–E4530.
(161) Miller, C. C.; Rawat, M.; Johnson, T.; Av-Gay, Y.; Jothivasan, V. K.; Hamilton, C. J.; Rawat, M.; Av-
Gay, Y. Nat. Prod. Rep. 2007, 25 (3), 278–292.
(162) Miller, C. C.; Rawat, M.; Johnson, T.; Av-Gay, Y. Antimicrob. Agents Chemother. 2007, 51 (9),
3364–3366.
(163) Jothivasan, V. K.; Hamilton, C. J. Nat. Prod. Rep. 2008, 25 (6), 1091.
(164) Sandgren, A.; Strong, M.; Muthukrishnan, P.; Weiner, B. K.; Church, G. M.; Murray, M. B. PLoS
Med. 2009, 6 (2), e2.
(165) Motiwala, A. S.; Dai, Y.; Jones‐López, E. C.; Hwang, S.-H.; Lee, J. S.; Cho, S. N.; Via, L. E.; Barry, C.
E.; Alland, D. J. Infect. Dis. 2010, 201 (6), 881–888.
(166) Adams, K. N.; Takaki, K.; Connolly, L. E.; Wiedenhoft, H.; Winglee, K.; Humbert, O.; Edelstein, P.
H.; Cosma, C. L.; Ramakrishnan, L. Cell 2011, 145 (1), 39–53.
(167) Zechini, B.; Versace, I. Recent Pat. Antiinfect. Drug Discov. 2009, 4 (1), 37–50.
(168) Balganesh, M.; Kuruppath, S.; Marcel, N.; Sharma, S.; Nair, A.; Sharma, U. Antimicrob. Agents
Chemother. 2010, 54 (12), 5167–5172.
(169) Amaral, L.; Kristiansen, J. E.; Viveiros, M.; Atouguia, J. J. Antimicrob. Chemother. 2001, 47 (5),
505–511.
(170) Sharma, S.; Kumar, M.; Sharma, S.; Nargotra, A.; Koul, S.; Khan, I. A. J. Antimicrob. Chemother.
2010, 65 (8), 1694–1701.
(171) Adams, K. N.; Szumowski, J. D.; Ramakrishnan, L. J. Infect. Dis. 2014, 210 (3), 456–466.
56
(172) Singh, K.; Kumar, M.; Pavadai, E.; Naran, K.; Warner, D. F.; Ruminski, P. G.; Chibale, K. Bioorganic
Med. Chem. Lett. 2014, 24 (14).
(173) Gupta, S.; Cohen, K. A.; Winglee, K.; Maiga, M.; Diarra, B.; Bishai, W. R. Antimicrob. Agents
Chemother. 2014, 58 (1), 574–576.
(174) Flynn, J. L.; Chan, J.; Lin, P. L. Mucosal Immunol. 2011, 4 (3), 271–278.
(175) Harding, C. V; Boom, W. H. Nat. Rev. Microbiol. 2010, 8 (4), 296–307.
(176) Caire-Brandli, I.; Papadopoulos, A.; Malaga, W.; Marais, D.; Canaan, S.; Thilo, L.; de Chastellier, C.;
Flynn, J. L. Infect. Immun. 2014, 82 (2), 476–490.
(177) Barry, C. E.; Boshoff, H. I.; Dartois, V.; Dick, T.; Ehrt, S.; Flynn, J.; Schnappinger, D.; Wilkinson, R. J.;
Young, D. Nat. Rev. Microbiol. 2009, 7 (12), 845–855.
(178) Marakalala, M. J.; Raju, R. M.; Sharma, K.; Zhang, Y. J.; Eugenin, E. A.; Prideaux, B.; Daudelin, I. B.;
Chen, P.-Y.; Booty, M. G.; Kim, J. H.; Eum, S. Y.; Via, L. E.; Behar, S. M.; Barry, C. E.; Mann, M.;
Dartois, V.; Rubin, E. J. Nat. Med. 2016, 22 (5), 531–538.
(179) Kramnik, I.; Dietrich, W. F.; Demant, P.; Bloom, B. R. Proc. Natl. Acad. Sci. U. S. A. 2000, 97 (15),
8560–8565.
(180) Eum, S.-Y.; Kong, J.-H.; Hong, M.-S.; Lee, Y.-J.; Kim, J.-H.; Hwang, S.-H.; Cho, S.-N.; Via, L. E.; Barry,
C. E. Chest 2010, 137 (1), 122–128.
(181) Tezera, L. B.; Bielecka, M. K.; Chancellor, A.; Reichmann, M. T.; Shammari, B. Al; Brace, P.; Batty,
A.; Tocheva, A.; Jogai, S.; Marshall, B. G.; Tebruegge, M.; Jayasinghe, S. N.; Mansour, S.; Elkington,
P. T. Elife 2017, 6, 1–19.
(182) Bielecka, M. K.; Tezera, L. B.; Zmijan, R.; Drobniewski, F.; Zhang, X.; Jayasinghe, S.; Elkington, P.
MBio 2017, 8 (1), e02073-16.
(183) Nazarova, E. V; Russell, D. G. In Methods in Molecular Biology; 2017; Vol. 1519, pp 325–331.
(184) Cole, S. T. Philos. Trans. R. Soc. B Biol. Sci. 2016, 371 (1707), 20150506.
57
(185) VanderVen, B. C.; Fahey, R. J.; Lee, W.; Liu, Y.; Abramovitch, R. B.; Memmott, C.; Crowe, A. M.;
Eltis, L. D.; Perola, E.; Deininger, D. D.; Wang, T.; Locher, C. P.; Russell, D. G. PLOS Pathog. 2015,
11 (2), e1004679.
(186) Brodin, P.; Christophe, T. Curr. Opin. Chem. Biol. 2011, 15 (4), 534–539.
(187) Christophe, T.; Ewann, F.; Jeon, H. K.; Cechetto, J.; Brodin, P. Future Med. Chem. 2010, 2 (8),
1283–1293.
(188) Stanley, S. A.; Barczak, A. K.; Silvis, M. R.; Luo, S. S.; Sogi, K.; Vokes, M.; Bray, M.-A.; Carpenter, A.
E.; Moore, C. B.; Siddiqi, N.; Rubin, E. J.; Hung, D. T. PLoS Pathog. 2014, 10 (2), e1003946.
(189) Welin, A. Dissertation. Linköping University, 2011.
(190) Welin, A.; Eklund, D.; Stendahl, O.; Lerm, M. PLoS One 2011, 6 (5), e20302.
(191) Raffetseder, J.; Pienaar, E.; Blomgran, R.; Eklund, D.; Patcha Brodin, V.; Andersson, H.; Welin, A.;
Lerm, M. PLoS One 2014, 9 (11), e112426.
(192) Caldwell, J.; Gardner, I.; Swales, N. Toxicol. Pathol. 1995, 23 (2), 102–114.
(193) Gombar, V. K.; Silver, I. S.; Zhao, Z. Curr. Top. Med. Chem. 2003, 3 (11), 1205–1225.
(194) Kola, I.; Landis, J. Nat. Rev. Drug Discov. 2004, 3 (8), 711–716.
(195) Jakoby, W. B.; Ziegler, D. M. J. Biol. Chem. 1990, 265 (34), 20715–20718.
(196) Glue, P.; Clement, R. P. Cell. Mol. Neurobiol. 1999, 19 (3), 309–323.
(197) Meyer, U. A. Drug Metab. Rev. 2007, 39 (2–3), 639–646.
(198) Penner, N.; Woodward, C.; Prakash, C. In ADME-Enabling Technologies in Drug Design and
Development; Zhang, D., Surapaneni, S., Eds.; John Wiley & Sons, Inc.: Hoboken, NJ, USA; pp 545–
565.
(199) Testa, B.; Pedretti, A.; Vistoli, G. Drug Discov. Today 2012, 17 (11–12), 549–560.
(200) Nebert, D. W.; Russell, D. W. Lancet 2002, 360 (9340), 1155–1162.
58
(201) Lamb, D. C.; Waterman, M. R.; Kelly, S. L.; Guengerich, F. P. Curr. Opin. Biotechnol. 2007, 18 (6),
504–512.
(202) Ding, X.; Kaminsky, L. S. Annu. Rev. Pharmacol. Toxicol. 2003, 43 (1), 149–173.
(203) Cashman, J. R. Expert Opin. Drug Metab. Toxicol. 2008, 4 (12), 1507–1521.
(204) Jenner, P. Basal Ganglia 2012, 2 (4), S3–S7.
(205) Youdim, M. B. H.; Edmondson, D.; Tipton, K. F. Nat. Rev. Neurosci. 2006, 7 (4), 295–309.
(206) Strolin Benedetti, M.; Tipton, K. F.; Whomsley, R. Fundam. Clin. Pharmacol. 2007, 21 (5), 467–
479.
(207) Vasiliou, V.; Pappa, A.; Petersen, D. R. Chem. Biol. Interact. 2000, 129 (1–2), 1–19.
(208) Jin, Y.; Penning, T. M. Annu. Rev. Pharmacol. Toxicol. 2007, 47 (1), 263–292.
(209) Oppermann, U. Annu. Rev. Pharmacol. Toxicol. 2007, 47 (1), 293–322.
(210) Barski, O. A.; Tipparaju, S. M.; Bhatnagar, A. Drug Metab. Rev. 2008, 40 (4), 553–624.
(211) Jancova, P.; Anzenbacher, P.; Anzenbacherova, E. Biomed. Pap. Med. Fac. Univ. Palacky.
Olomouc. Czech. Repub. 2010, 154 (2), 103–116.
(212) Tukey, R. H.; Strassburg, C. P. Annu. Rev. Pharmacol. Toxicol. 2000, 40, 581–616.
(213) Bailey, M. J.; Dickinson, R. G. Chem. Biol. Interact. 2003, 145 (2), 117–137.
(214) Coughtrie, M. W. H. Pharmacogenomics J. 2002, 2 (5), 297–308.
(215) Gamage, N. Toxicol. Sci. 2005, 90 (1), 5–22.
(216) Glatt, H. Chem. Biol. Interact. 2000, 129 (1–2), 141–170.
(217) Sim, E.; Pinter, K.; Mushtaq, A.; Upton, A.; Sandy, J.; Bhakta, S.; Noble, M. Biochem. Soc. Trans.
2003, 31 (3), 615–619.
(218) Forman, H. J.; Zhang, H.; Rinna, A. Mol. Aspects Med. 2009, 30 (1–2), 1–12.
59
(219) Hayes, J. D.; Flanagan, J. U.; Jowsey, I. R. Annu. Rev. Pharmacol. Toxicol. 2005, 45 (1), 51–88.
(220) Männistö, P. T.; Kaakkola, S. Pharmacol. Rev. 1999, 51 (4), 593–628.
(221) Fontecave, M.; Atta, M.; Mulliez, E. Trends Biochem. Sci. 2004, 29 (5), 243–249.
(222) Guengerich, F. P.; Rendic, S. Curr. Drug Metab. 2010, 11 (1), 1–3.
(223) Cashman, J. R.; Zhang, J. Annu. Rev. Pharmacol. Toxicol. 2006, 46 (1), 65–100.
(224) Chen, Y.; Tang, Y.; Guo, C.; Wang, J.; Boral, D.; Nie, D. Biochem. Pharmacol. 2012, 83 (8), 1112–
1126.
(225) Wilkinson, G. R. N. Engl. J. Med. 2005, 352 (21), 2211–2221.
(226) Bodor, N.; Buchwald, P. Med. Res. Rev. 2000, 20 (1), 58–101.
(227) Stepan, A. F.; Walker, D. P.; Bauman, J.; Price, D. A.; Baillie, T. A.; Kalgutkar, A. S.; Aleo, M. D.
Chem. Res. Toxicol. 2011, 24 (9), 1345–1410.
(228) Fura, A.; Shu, Y.; Zhu, M.; Hanson, R. L.; Roongta, V.; Humphreys, W. G. J. Med. Chem. 2004, 47
(18), 4339–4351.
(229) Fura, A. Drug Discov. Today 2006, 11 (3–4), 133–142.
(230) Kang, M. J.; Song, W. H.; Shim, B. H.; Oh, S. Y.; Lee, H. Y.; Chung, E. Y.; Sohn, Y.; Lee, J. Yakugaku
Zasshi 2010, 130 (10), 1325–1337.
(231) Kigondu, E. M.; Njoroge, M.; Singh, K.; Njuguna, N.; Warner, D. F.; Chibale, K. Medchemcomm
2014, 5, 502–506.
(232) Huttunen, K. M.; Raunio, H.; Rautio, J. Pharmacol. Rev. 2011, 63 (3), 750–771.
(233) Rautio, J.; Kumpulainen, H.; Heimbach, T.; Oliyai, R.; Oh, D.; Järvinen, T.; Savolainen, J. Nat. Rev.
Drug Discov. 2008, 7 (3), 255–270.
(234) Osborne, R.; Thompson, P.; Joel, S.; Trew, D.; Patel, N.; Slevin, M. Br. J. Clin. Pharmacol. 1992, 34
(2), 130–138.
60
(235) Lewis, S. S.; Hutchinson, M. R.; Rezvani, N.; Loram, L. C.; Zhang, Y.; Maier, S. F.; Rice, K. C.;
Watkins, L. R. Neuroscience 2010, 165 (2), 569–583.
(236) Li, F.; Lu, J.; Ma, X. Chem. Res. Toxicol. 2011, 24 (5), 744–751.
(237) Guengerich, F. P. AAPS J. 2006, 8 (1), E101-11.
(238) Uetrecht, J.; Trager, W. Drug Metabolism: Chemical and Enzymatic Aspects; Uetrecht, J., Trager,
W., Eds.; Informa Healthcare USA, Inc.: New York, 2007.
(239) Park, B. K.; Boobis, A.; Clarke, S.; Goldring, C. E. P.; Jones, D.; Kenna, J. G.; Lambert, C.; Laverty, H.
G.; Naisbitt, D. J.; Nelson, S.; Nicoll-Griffith, D. a; Obach, R. S.; Routledge, P.; Smith, D. a; Tweedie,
D. J.; Vermeulen, N.; Williams, D. P.; Wilson, I. D.; Baillie, T. a. Nat. Rev. Drug Discov. 2011, 10 (4),
292–306.
(240) Guengerich, F. P. Arch. Biochem. Biophys. 2005, 433 (2), 369–378.
(241) Attia, S. M. Oxid. Med. Cell. Longev. 2010, 3 (4), 238–253.
(242) Fontana, E.; Dansette, P. M.; Poli, S. M. Curr. Drug Metab. 2005, 6 (5), 413–454.
(243) Dalvie, D.; Obach, R. S.; Kang, P.; Prakash, C.; Loi, C.-M.; Hurst, S.; Nedderman, A.; Goulet, L.;
Smith, E.; Bu, H.-Z.; Smith, D. a. Chem. Res. Toxicol. 2009, 22 (2), 357–368.
(244) Brandon, E. F. A.; Raap, C. D.; Meijerman, I.; Beijnen, J. H.; Schellens, J. H. M. Toxicol. Appl.
Pharmacol. 2003, 189 (3), 233–246.
62
Chapter 2
Design, semi-synthesis and in vitro evaluation of pharmacological and physicochemical properties
of fusidic acid-aminoquinoline hybrids
Chapter overview
In this chapter, a brief overview of hybrid drugs and prodrugs is outlined after which the design and
semi-synthesis of fusidic acid hybrids is then presented. The hybrids are subsequently evaluated for
antimycobacterial activity, and the contribution of the constituent pharmacophores to the activity of
the hybrids is investigated. In addition, the solubility of these hybrids is determined experimentally.
2.1 Fusidic acid
Fusidic acid (FA; Figure 2.1) is a natural product derived from Fusidium coccineum that was first
isolated in 1960. It possesses activity against gram positive bacteria and was developed by Leo
Laboratories as an antibiotic for the treatment of Methicillin-resistant Staphylococcus aureus (MRSA)
infections, especially in combination with rifampicin (RIF).1–4 It has shown moderate in vitro activity
against drug-susceptible Mtb and clinical isolates resistant to the first line anti-TB agents.5,6 Despite
this, it has shown in vivo inefficacy in a well-established mouse model of infection, with no decrease
in bacterial load in mice treated with FA up to 200 mg/kg (Lenaerts et al, unpublished results). Its
status as an established clinical drug attests to its optimal clinical pharmacokinetic profile,
motivating further studies into its optimization for anti-TB drug discovery.
Figure 2.1: Fusidanes with their respective carbon atom numbering indicated
63
2.1.1 Unique structure of FA
FA is the most potent of the fusidanes, a class of naturally occurring antibiotics, which include
helvolic acid and cephalosporin P1 (Figure 2.1). Fusidanes resemble steroids structurally, but are
devoid of any hormonal or anti-inflammatory activity due to a difference in stereochemistry that
distinguishes them from other tetracyclic triterpenes and sterols.7 FA is unique due to the unusual
stereochemistry of its tetracyclic ring system, where rings A, B and C are arranged in a trans-syn-
trans manner in contrast to the usual trans-anti-trans arrangement seen in tetracyclic triterpenes
and sterols. This forces ring B into a boat conformation, resulting in a chair-boat-chair conformation
of the cyclopentanoperhydrophenanthrene ring system (Figure 2.2). In addition, these compounds
have a common carboxylic acid-bearing side chain linked to the ring system at C-17 via a double
bond and an acetate group at C-16.8 It is weakly acidic (pKa of 5.7) and is mostly ionized in plasma
and tissue at the physiological pH of 7.4.
Figure 2.2: Cyclopentanoperhydrophenanthrene with a trans-syn-trans arrangement
2.1.2 Antibacterial SAR
The main aims of semi-synthetic modification of FA have been to improve potency and spectrum of
antibacterial activity, as well as improving physicochemical parameters such as solubility, due to its
highly hydrophobic nature. Extensive Structure-Activity Relationship (SAR) studies of FA have been
carried out with respect to its antibacterial activity outlined in Figure 2.3.8
64
Figure 2.3: A summary of FA antibacterial SAR adapted from Duvold et al, 20018
However, only a few of these analogues showed activities comparable to that of FA, while all have
shown a similar antibacterial spectrum to FA.9–11 In the search for analogues with improved aqueous
solubility, Koreeda et al synthesised C-3, C-24 and C-25 O-glycosylated analogues using various five-
and six-membered cyclic sugar moieties (glycals). The details of the activity and solubility of the
analogues are not discussed in the published patent.12 The antibacterial SAR can serve as a starting
point to guide the repositioning of FA through semi-synthesis for TB drug discovery.
2.2 Quinolines in drug discovery
As mentioned in Chapter 1, the quinoline scaffold is considered a privileged structure in drug
discovery. Compounds derived from nature containing this scaffold have been reported to have anti-
infective properties including antimalarial, antiviral, antileishmanial and antitubercular activity, as
well as anticancer and cardiovascular properties among others.13 Quinolines have a long-standing
history as antimalarial agents.14 Purely synthetic molecules based on quinolines have also been
developed successfully, as evidenced by bedaquiline (BDQ) and others (Figure 2.4), a novel drug
reserved for the treatment of MDR-TB. It is a diarylquinoline that inhibits mycobacterial Adenosine
Triphosphate (ATP) synthase.15,16
Among these sub-classes is primaquine, an 8-aminoquinoline used in the treatment of malaria
caused by Plasmodium vivax (P. vivax) and Plasmodium ovale (P. ovale) as well as transmission-
blocking of malaria caused by Plasmodium falciparum (P. falciparum). It was reported to have an
MIC of 5 M at 90% inhibition against Mtb H37Rv.17 Another example is mefloquine, a 4-substituted
quinoline also used in the prophylaxis and treatment of malaria, that showed moderate
antimycobacterial activity in the same assay.17 Due to its relevance in TB drug discovery, the
quinoline scaffold was chosen for the synthesis of hybrids in this project.
65
Figure 2.4: Examples of quinolines with antimycobacterial activity
2.3 Hybrid drugs
A hybrid compound is a chemical modification created by combining two or more chemical scaffolds,
either directly, or via a linker.18,19 Hybrids potentially offer several advantages over single molecules
and combination therapy. They have the potential to overcome the development of resistance to
therapy by combining two pharmacophores with different modes of action into a single entity. In
addition, this may lead to synergistic effects of the pharmacophores, and thus increased potency.20,21
Physicochemical parameters such as solubility and permeability can be improved by incorporating
moieties with desired properties. Paclitaxel, a highly hydrophobic anticancer drug, has been
successfully improved using this strategy.22 It is also possible to design selectivity for a drug target by
covalent attachment of moieties with affinity for specific receptors with proximity to the target
organ or tissue.23 Overcoming the additive toxic effects of the individual drugs may thus be avoided,
with the overall added convenience of a single formulation, improving overall patient adherence at a
potentially lower cost.
2.3.1 Classification of hybrid drugs
Hybrid molecules can be classified as cleavable, non-cleavable and merged (Figure 2.5).22 Cleavable
hybrids are covalently linked directly or indirectly through a spacer designed to be hydrolysed,
usually enzymatically. Esters, amides and carbamates are the most commonly used linkers. Upon
hydrolysis, the individual molecules are expected to elicit their pharmacological effects. Non-
cleavable hybrids are linked covalently, and are designed to retain the biological activities as a single
molecule. Merged or overlapping hybrids are obtained by overlapping common structural motifs of
two or more pharmacophores. The hybrid may retain the functional properties of the source
molecules or elicit a pharmacological effect distinct from the source molecules.
66
Figure 2.5: Classification of hybrids, adapted from Srivastava and Lee.22
2.4 Prodrugs: design and application in drug discovery
Prodrugs are bioreversible derivatives of drug molecules designed to undergo an enzymatic and/or
chemical transformation in vivo to release the parent drug, which then exerts the desired
pharmacological effect.24–27 Prodrugs have become a widely-used strategy for improving
physicochemical, pharmacokinetic or biopharmaceutical properties of pharmacologically active
agents in both drug discovery and development. In the last decade, between 5–7% of known clinical
drugs were classified as prodrugs, and the use of this approach in the early stages of drug discovery
is a growing trend; 15 % of all new drugs approved between 2001 and 2002 were prodrugs. Some of
the drawbacks which have been successfully addressed by prodrug design include challenges in
formulation and drug delivery such as aqueous solubility, poor oral absorption, rapid metabolism
and toxicity.28
67
2.4.1 Classification of prodrugs
In most cases, prodrugs only require one or two chemical steps (more commonly enzymatic
transformation) to yield the pharmacologically active compound as illustrated in Figure 2.628
Figure 2.6: Illustration of the prodrug concept, adapted from Rautio et al 200828
Prodrugs can be broadly classified into two categories: co-drugs or bioprecursor drugs. A third
category, referred to as soft drugs, does not conform to the classical definition of a prodrug. Co-
drugs refer to the case of two pharmacologically active drugs that are covalently fused into a single
molecule, in which each drug acts as a promoeity for the other.29 Bioprecursor drugs result from
modification of the active drug itself, resulting in the generation of a novel compound, which is
subsequently chemically or enzymatically converted to the active metabolite.28 Soft drugs, which are
designed to undergo predictable deactivation or metabolism in a controlled manner after achieving
therapeutic effect, are the opposite of prodrugs. They are typically used in the detoxification of
drugs with narrow therapeutic indices.30–32 A major factor to be considered in prodrug design is the
presence of functional groups in a molecule that are amenable to chemical prodrug derivatization.
Commonly used functional groups include hydroxyl, carboxylic acid, amine, and phosphonate
groups.28 Modification of these groups typically produces, among others, ester, amide, carbonate,
and phosphate group prodrugs.28
68
The use of amides as prodrugs is less common, due to their relative enzymatic stability in vivo.
Notwithstanding, a few examples exist. As highlighted in Chapter 1, the anti-TB agent pyrazinamide
(PZA) is an amide prodrug that undergoes enzymatic hydrolysis; it is a substrate of mycobacterial
and host amidases, which hydrolyse it to pyrazinoic acid, the pharmacologically active moiety.33
Esters are the most common prodrugs, and are estimated to constitute 49% of all marketed
prodrugs.25,34 By masking charged groups such as carboxylic acids and phosphates, they are often
used to enhance lipophilicity and consequently membrane permeability of hydrophilic drugs.28,35
Once administered, the ester bond is hydrolysed by ubiquitous esterases found in the blood, liver as
well as other organs and tissues. These include carboxylesterases, acetylcholinesterases,
arylesterases and paraoxonases.28 Examples of clinically used ester prodrugs are Angiotensin
converting enzyme (ACE) inhibitors and -lactam antibiotics, both of which improve bioavailability.28
Another successful example of the application of the prodrug strategy is that of the experimental
compound MGS0210, an alkyl ester of MGS0039- a glutamate receptor antagonist used for the
treatment of psychiatric disorders such as schizophrenia36,37( Table 2.1). MGS0039 has a carboxylic
acid group which limits its intestinal permeability, consequently reducing its bioavailability in rats
and monkeys. In separate clinical studies, administration of several ester prodrugs, among them
MGS0210, achieved a 31% increase in oral bioavailability of MGS0039 in monkeys following
esterase-mediated bioconversion by esterases.36,37 Table 2.1 illustrates examples of ester prodrugs.
69
Table 2.1: Examples of prodrugs with improved lipophilicity or permeability28
Prodrug name
(therapeutic
area)
Functional group Structure Pharmacologically active
metabolite/moiety
Enalapril
(Angiotensin-
converting
enzyme
inhibitor
Monoethyl ester of
enalaprilat
Pivampicillin
(-lactam
antibiotic)
Pivaloylmethylester
of ampicillin
MGS0210
(glutamate
receptor
(MGLUR2)
antagonist
n- heptyl ester of
MGS0039
70
2.5 Rationale for fusidic acid-aminoquinoline hybrids and C-3 ester prodrugs
Physicochemical parameters have a significant effect on drug efficacy, for instance, implications on
the extent and rate of drug absorption. These in turn, are dependent on the ability of a molecule to
permeate across the cell membrane of microorganisms. Lipophilicity and solubility are the two key
physicochemical factors that affect both the extent and rate of drug absorption.38 Increasing
lipophilicity generally enhances membrane permeability. In order for absorption to occur, orally
administered drugs must dissolve in the aqueous environment of the stomach and intestines before
they can be absorbed.38 In addition to crossing the pathogen’s membrane, these properties may
affect drug permeation across host membranes to the target organs and tissues. TB pathology is
encumbered with the added barrier of the caseum, a necrotic, hydrophobic ring that consists chiefly
of immune cells such as macrophages and neutrophils encasing bacilli.39,40 The added challenge of
drug penetration into the necrotic lesions where persistent bacilli reside requires a
hydrophobic/hydrophilic balance to achieve an effective concentration for antimycobacterial
activity.41–44
The carboxylic acid functional group is an important pharmacophore in certain classes of
compounds. It is also, however, responsible for certain drawbacks such as toxicity, limited passive
diffusion across membranes among others.45 It was hypothesised that in addition to the hydroxyl
groups at positions 3 and 11 of FA, the carboxylic side chain may limit its permeation of the thick
mycobacterial cell membrane, with consequent modest antimycobacterial activity in comparison to
other Gram positive organisms. As illustrated in Figure 2.3 above, the C-21 carboxylic acid group has
been shown to be essential for in vitro antibacterial activity. As such, the use of esters and amides
as potential prodrugs to mask the carboxylic acid group would retain its interaction with the
biological target while potentially improving its lipophilicity.
As discussed in Chapter 1, esters and amides have been shown to improve the antimycobacterial
activity of spectinomycin.46 We hypothesized that derivatization of the C-21 carboxylic acid group in
this manner through hybridization to quinoline moieties would enhance the permeability properties
of the hybrids required for improved activity against Mtb. Additionally, potential enzyme-mediated
hydrolysis would deliver the quinoline pharmacophore, which in itself is plausibly endowed with
antimycobacterial activity. The FA-aminoquinoline hybrids thus synthesised would fall under the
classification of cleavable hybrids (Figure 2.5). We also hypothesised that upon enzyme-mediated
hydrolysis, C-3 ester prodrugs of FA would increase the concentration of FA at the site of action as a
result of improved permeability. The C-3 ester prodrugs evaluated in this project were synthesised
by Dr. Gurminder Kaur at the University of Cape Town.
71
2.6 Aims and objectives The main aim of this chapter was to identify FA analogues with improved physicochemical and
pharmacodynamic properties through chemical semi-synthesis. The specific objectives were:
(1) Semi- synthesis of ester and amide FA-aminoquinoline hybrids and their characterisation
using spectroscopic techniques.
(2) Pharmacological evaluation of the synthesised hybrids.
(3) Evaluation of the contribution of the pharmacophoric units to the pharmacological
activity of the hybrids by screening appropriate intermediates as well as 1:1 mixtures of
the same intermediates.
(4) In vitro physicochemical profiling (solubility and permeability) of the FA-aminoquinoline
hybrids.
2.7 Semi-synthesis of FA hybrids
This work focuses on modification of the carboxylic acid group, exploring the effect of hydrophobic
substituents at this position on potency. To this end, aminoquinoline ester and amide hybrids of FA
shown in Figure 2.6 were synthesised. Selected 4-aminoquinolines and primaquine, an 8-
aminoquinoline, were selected due to their relevance in TB drug discovery as discussed in section
2.2.
Figure 2.7: Fusidic acid amide and ester aminoquinoline hybrids
72
2.7.1 Retrosynthetic analysis of the FA amide and ester prodrugs based on aminoquinolines
The amides were envisaged from coupling between the C-21 carboxylic acid of FA and the primary
amines shown in Figure 2.7 above. The esters were to be obtained by coupling of the acid to the
primary alcohols shown in Figure 2.7. A C-N disconnection was expected to furnish the
aminoquinoline alcohols and diamines, leading to the starting material, commercially available 4, 7-
dichloroquinoline, the corresponding diamines and amino alcohols (Scheme 2.1)
Scheme 2.1: Retrosynthetic analysis of FA amide and ester derivatives.
73
2.7.2 Synthesis of 4-aminoquinoline diamines and alcohols
The 1-(4’-amino-7’-chloroquinoline)- diamines and alcohols were synthesised using a modification of
the literature procedure described by de Souza et al.47 The quinoline diamine with the 2 and 4-
carbon methylene spacers as well as the N-methyl 3-carbon methylene spacer were readily
available, hence the only ones synthesised during this project were those containing the 3, 4 and 5-
carbon methylene spacers. All the quinoline amino alcohol analogues were synthesised. The
quinoline analogues were furnished by a nucleophilic substitution reaction between 4, 7-
dichloroquinoline and an excess (5 equivalents) of the appropriate diamines and alcohols. Since the
diamines and alcohols were liquid, the reactions were carried out by reflux in the neat, affording the
desired products in good yields (90–98%) without using column chromatography for purification.
They were characterized by NMR and Mass spectroscopy, and in their melting points compared with
values previously reported.48 The synthesis is depicted in the Scheme 2.2.
Scheme 2.2: Synthesis of 4-aminoquinoline diamines and alcohols
Reagents and conditions: (i) corresponding diamine, 80 oC 1 hr then 135oC, N2, 3hrs, 90–98%.
The nucleophilic substitution reaction is enabled by the reactivity of the quinoline ring (I), which is a
fused benzo[b]pyridine, therefore conferring upon it the capacity for both electrophilic and
nucleophilic reactivity. Through mesomeric and inductive effects, the nitrogen atom causes π-
electron deficiency at the neighbouring carbon atoms at position 2 and 4. The presence of the
electron-withdrawing chloro group at position 8 further enhances this electron deficiency, rendering
C-2 and C-4 prone to nucleophilic attack (Figure 2.8a). The regioselectivity observed is driven by the
ability of the nitrogen atom to act as an electron ‘sink’ through resonance, facilitating nucleophilic
attack by the amine as illustrated in Figure 2.8b.48,49
74
Figure 2.8a: Canonical structures for the inductive and mesomeric effects of the quinoline nitrogen
Figure 2.8b: Mechanism of formation of 7-chloroquoniline-4-amine derivatives
2.7.2.1 Results: Yields of aminoquinoline diamines and alcohols
Table 2.2: Yields of 4-aminoquinoline alcohols and diamines
Compound
code X n % yield
AW21 O 2 98
AW26 O 3 95
AW28 O 4 96
AW29 O 5 90
AW27 NH 3 90
AW18 NH 4 96
AW43 NH 5 98
75
2.7.3 Synthesis of FA amides
The synthesis of the amides employed carbodiimide chemistry, using a procedure described by
Gonzalez Cabrera et al.50 1-Ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDCI) was used in favour
of Dicyclohexyl carbodiimide (DCC) to activate the carboxylic acid, as it is a salt and therefore easily
removed by washing the crude reaction mixture with water or aqueous salts during work up.
Furthermore, attempts at coupling using DCC returned very low yields, prompting the use of an
alternative coupling method. Scheme 2.3 below summarizes the amide coupling procedure.
Racemic primaquine was sourced commercially as a diphosphate salt, therefore the first step
involved neutralization using 2 equivalents of N, N-Diisopropylethylamine (DIPEA). This is in contrast
to the coupling reactions involving the other amines, in which 1.2 equivalents of DIPEA was used.
The compounds were obtained in poor to moderate yields after purification using column
chromatography.
Scheme 2.3: Synthesis of FA amide derivatives.
Reagents and conditions: (i) appropriate amine, EDCI, HOBt, DIPEA, DMF, 25 oC, 16h, 25-90%.
2.7.4 Synthesis of FA esters
Similar carbodiimide chemistry as in amide coupling was employed, with N, N-dimethyl-4-
aminopyridine (DMAP) used as a nucleophilic base instead of (DIPEA). Optimal yields were obtained
when 2.5 equivalents were used, as opposed to the more common use of a catalytic amount.
Scheme 2.4 illustrates the procedure for the synthesis of the ester hybrids of FA.
76
Scheme 2.4: Synthesis of FA ester derivatives
Reagents and conditions: (i) appropriate alcohol, EDCI, DMAP, DMF, 25 oC, 16h, 69-85%.
2.7.4.1 Results: Yields of FA amide and ester aminoquinoline hybrids
Table 2.3: Yields of FA amides and esters
R Compound
code X n R1 % Yield
AW32 O 2 H 69
AW42 O 3 H 74
AW34 O 4 H 82
AW35 O 5 H 85
AW23 NH 2 H 80
AW31 NH 3 H 55
AW25 NH 4 H 50
AW45 NH 5 H 90
AW24 NH 3 CH3 25
77
R Compound
code X n R1 % Yield
AW33 NH 3 - 25
Except for AW45 with a 5-carbon methylene spacer, the longer chain amides were obtained in lower
yields than the amides with shorter methylene spacers. Moreover, the loss of material after
purification by column chromatography led to even lower yields of the final products. HPLC was
used to profile the compounds for purity, with all the target compounds showing ≥ 95% purity. The
FA-primaquine hybrid was obtained as a diastereomeric mixture, since FA is chirally pure while
primaquine was commercially sourced as a racemic mixture. This was evidenced by the overlapping
signals observed in the proton NMR spectrum. Separation of the diastereomers was not attempted
in this study.
In the case of the esters, good yields were obtained for the compounds, with column
chromatography affording the purified compounds in higher yields compared to the amides. This
was primarily due to relatively minimal material lost during purification by column chromatography.
Plausibly, unlike the amides the esters were less prone to the “tailing” effect caused by interaction
of the amines with silanol groups on the surface of the silica stationary phase during column
chromatography purification. In addition, higher yields were obtained for the esters with longer
chain methylene spacers. HPLC was used to profile the compounds for purity, with all the target
compounds showing ≥95% purity.
78
2.7.5 1H NMR characterisation: Key spectroscopic indicators of selected intermediates and target compounds
2.7.5.1 Substituted 7-chloroquoniline-4-amine derivatives
In the case of the 4-aminoquinoline derivatives, the success of the substitution reactions was
confirmed by the appearance of proton peaks upfield in the aliphatic region, which was consonant
with reports from the literature.51 Figure 2.9 indicates 1H NMR spectrum of the amino alcohol
derivative containing the 2-carbon methyelene spacer, AW21.
Figure 2.9: Spectrum of AW21 illustrating the aromatic ring and C-4 aliphatic side chain protons
2.7.5.2 FA amides and esters
FA is a relatively large molecule with many aliphatic protons and therefore very few assigned NMR
data have been published in the literature. This has been achieved through advanced 1D and 2D
spectroscopic techniques that have not been carried out so far in this project. However, several
identifiable proton signals were observed, and their chemical shift values in each of the target
molecules have been highlighted. The assignment of the remaining signals proved challenging and
the chemical shift values reported here correspond to various literature reports of FA NMR data,
79
corroborated by the proton-proton coupling observed in a 2D COSY NMR experiment of compound
AW23 (Appendix 4). Nevertheless, the success of the amide coupling and esterification with the
quinoline amides and esters respectively was confirmed by the well-resolved signals of the quinoline
ring system, with downfield proton peaks observed between 6.38 parts per million (ppm) and 8.40
ppm as indicated on the spectrum of amide AW23 shown in Figure 2.10.
Figure 2.10: Spectrum of AW23 illustrating the aromatic protons of the quinoline ring and
identifiable FA protons
Furthermore, evidence from mass spectroscopy was used to confirm the expected molecular mass
for each of the target compounds. For all target compounds, both low-resolution mass spectroscopy
(LRMS) and liquid chromatography-coupled mass spectroscopy (LC-MS) confirmed the expected
molecular mass in positive mode [M + H]. The NMR and MS spectroscopy data for the target
compounds are provided in Chapter 6.
80
2.8 Physicochemical evaluation of the FA hybrids
2.8.1 Experimental determination of solubility
The aqueous solubility was determined using a plate-based turbidimetric solubility assay previously
described by Bevan and Lloyd.52 This method measures the onset of precipitation of any given
compound by a change in absorbance. All the compounds synthesised were dissolved in DMSO to
prepare stock solutions for all downstream assays, while phosphate buffer saline (PBS) is the
aqueous medium used for solubility assays. Since most organic compounds are not freely soluble in
aqueous media, as the concentration of compound in PBS increases, precipitation occurs, resulting
in increased absorbance in the PBS-containing wells relative to the DMSO-containing wells. As the
maximum aqueous solubility level is reached, precipitation occurs when solute particles fail to
dissolve in the PBS. The absorbance due to the occlusion of light by the particles is measured using
UV spectrophotometry at 620 nm. The concentration at which the onset of increased absorbance is
observed is considered the upper limit of solubility.
10 mM stock solutions of test compounds were prepared in 100% DMSO, followed by dilution with
phosphate buffered saline (PBS) at pH 7.4, over a concentration range of 0 to 200 µM. The dilutions
were effected to a final DMSO concentration of 2.2% v/v. The assay plates were incubated for two
hours at ambient temperature before absorbance readings were taken. Reserpine and
hydrocortisone were used as the insoluble and highly soluble controls respectively.
2.8.2 Results of solubility testing of the compounds
As envisioned, all the analogues were significantly less soluble in comparison to FA, which is
regarded as highly soluble. There was no observable trend with respect to chain length, or
comparison between the ester and amide analogues, with low and partial solubility observed across
both series. AW34, the ester with a 4-carbon methylene spacer, was the least soluble at 5 µM, while
AW32, the ester with a 2-carbon methylene spacer was the most soluble compound, with maximum
solubility at 80 µM. Among the amides, AW45 and AW23 with a 5-and 2-carbon methylene spacer
respectively, were the least soluble at 10 µM.
The addition of the non-polar lipophilic aminoquinoline derivatives increased the molecular weight
of the FA analogues by a range of 204 to 247 atomic mass units from the least to the most bulky.
Since quinolines are aromatic in nature, π-stacking interactions may have played a role in the
average 10-fold lower solubility of the hybrids. Since the heteroatoms oxygen and nitrogen are
present in all the compounds, hydrogen bonding may have contributed to mitigating their overall
81
hydrophobicity, as in the case of AW32 whose maximum solubility was on the higher end of partial
solubility. The results are summarized in Table 2.4. The data are representative of two independent
experiments performed on different days.
Table 2.4: Results of turbidimetric solubility evaluation of the FA-aminoquinoline hybrids
R Compound
code X n R1
Solubility (µM)
AW32 O 2 H 80
AW42 O 3 H 10
AW34 O 4 H 5
AW35 O 5 H 20
AW23 NH 2 H 10
AW31 NH 3 H 10
AW25 NH 4 H 40
AW45 NH 5 H 10
AW24 NH 3 CH3 20
AW33 NH 3 - 40
The solubility of each compound was ranked according to the following criteria: <10 µM insoluble; 10-100
partially soluble; 100 µM = highly soluble. FA solubility: > 200 µM.
82
2.9 Pharmacological evaluation of the FA analogues
2.9.1 Antimycobacterial evaluation of the FA analogues
Evaluation of the antimycobacterial activity of the intermediates and FA analogues was conducted
by broth microdilution method, using the Microplate Alamar Blue Assay (MABA). The strain of Mtb
used was Mycobacterium tuberculosis H37Rv (MA), a virulent strain adapted for laboratory use.53
The broth microdilution method enables the determination of the minimum inhibitory
concentration (MIC) of compounds over a range of concentrations serially diluted (two-fold) on a
single 96-well microtitre plate.54,55 In the MABA assay, metabolic activity of the cell correlates with
the reduction of resazurin to resorufin, and the resulting change in colour from blue to pink and
fluorescent, allowing visual detection and fluorometric or colorimetric quantification. Wells with
non-viable cells thus remain blue while those with viable cells exhibit pink colouration. The results
reported herein relied on visual detection to assess growth and inhibition.
The assays were conducted in the routinely used enriched 7H9 medium supplemented with oleic
acid dextrose catalase (OADC), as well as glycine alanine salts supplemented with iron (GAST/Fe), a
relatively minimal medium. 10 mM stocks of each compound dissolved in DMSO were diluted to a
final concentration not exceeding 160 μM at the highest concentration at the onset of two-fold
serial dilution on the assay plates. The 14-day assay was conducted in duplicate for each compound,
with 3 biological replicates performed on different days. At day 7, the plates were inspected for the
formation of pellets, as an indicator of growth. Rifampicin (RIF), a potent first-line anti-TB drug, was
used as a control. Detailed experimental procedures of the assay are provided in Chapter 6.
2.9.2 Results of antimycobacterial evaluation of FA-aminoquinoline hybrids
Overall, the FA-aminoquinoline hybrids were less potent than FA (Table 2.5). This is not surprising
since these hybrids were hypothesized to undergo enzyme-mediated hydrolysis (plausibly by
mycobacterial esterases and amidases) to release FA and the quinoline component. There was no
observable trend in comparing the amide and the ester analogues. Among the esters, increase in
chain length of the methylene spacer correlated with decreased activity, although not to the extent
of the inactivity observed for the corresponding amide with a 5-carbon methylene spacer AW45.
Among the amides, the most potent compound, AW25 with a 4-carbon methylene spacer, had a MIC
2- and 4-fold lower than FA in the two types of medium used for the assay. With the exception of
this compound, activity decreased as the chain length of the methylene spacer increased, with very
poor activity observed for AW45 with a 5-carbon methylene spacer.
83
Table 2.5: Results of antimycobacterial testing of FA–aminoquinoline hybrids
R Compound
code X n R1
MIC90 7H9/OADC (µM) MIC90 GAST/Fe (µM)
Day 7 Day 14 Day 7 Day 14
AW32 O 2 H 10 10 5 10
AW42 O 3 H 40 40 20 40
AW34 O 4 H 40 40 20 40
AW35 O 5 H 40 40 20 40
AW23 NH 2 H 20 20 10 20
AW31 NH 3 H 20 20 20 20
AW25 NH 4 H 10 20 10 10
AW45 NH 5 H 160 160 40 160
AW24 NH 3 Me 20 20 10 20
84
R Compound
code X n R1
MIC90 7H9/OADC (µM) MIC90 GAST/Fe (µM)
Day 7 Day 14 Day 7 Day 14
AW33 NH 3 - 160 160 >160 >160
RIF MIC90 against Mtb was 0.01 µM. FA MIC90 against Mtb was 5 µM. Data are representative of 3 independent experiments.
.
85
The poor activity observed for AW45 may be partially attributed to its poor solubility. Evidence of
this was the significant difference between the MIC at day 7 and day 14. It was noted that in the
time frame between day 7 and 14, the compound precipitated in the growth medium at 40 µM. On
repeat experiments, precipitation was observed upon addition of the compound to the growth
medium, even before inoculation of the assay plates with Mtb culture. With respect to the growth
medium used, it was observed that FA had an 8-fold difference lower MIC in GAST/Fe compared to
7H9/OADC.
This may be attributed to protein binding by the albumin in OADC. Albumin is a weak base known to
bind to acidic and neutral drugs, and thus may bind FA, reducing the effective concentration
available to achieve maximum potency.56
2.9.3 Evaluation of the contribution of the pharmacophoric units to the pharmacological activity of the hybrids
Selected aminoquinoline derivatives were evaluated for antimycobacterial activity, as well as a 1:1
(molar ratio) mixture of FA and each intermediate. This was carried out in order to establish the
contribution of the aminoquinoline derivatives to the activity of the FA-aminoquinoline hybrids.
Moreover, this would also determine if there is benefit in covalent linkage of the two
pharmacophores as opposed to co-administration of the individual compounds. The latter is
beneficial in a clinical setting, as the added convenience of a single formulation of two compounds
or drugs improves patient compliance. Along with primaquine, the amine and aminoalcohol
derivatives with 2- and 5-carbon methylene spacer were selected for evaluation. The data are from
two independent assays performed on different days.
86
2.9.3.1 Results of evaluation of the contribution of the pharmacophoric units to the pharmacological activity of the hybrids
Table 2.6: Results of MIC of selected individual aminoquinoline derivatives and their mixtures with
FA
Compound
code n X
MIC90 in 7H9/OADC at day
14 (µM), singly
MIC90 in 7H9/OADC at
day 14 (µM), in
combination
AW21 2 O >160 5
AW28 4 O >160 5
AQ1 2 NH >160 5
AW18 4 NH >160 5
MIC90 of primaquine and FA singly were 160 µM and 5 µM respectively
The selected aminoquinoline derivatives all had poor activity, with MIC values greater than 160 µM.
These data correspond to reports published by De Souza et al, who reported similarly poor activity
of aminoquinoline derivatives.57 In 1:1 molar ratio mixture with FA, the MIC value observed
corresponded to that of FA on its own. It can be inferred from these data that the aminoquinoline
pharmacophore did not contribute to activity, but instead reduced the overall activity of the hybrids.
Surprisingly, primaquine, previously reported to have modest antimycobacterial activity (MIC90 5
µM) by Lougheed et al, was inactive in this study, with an MIC90 of 160 µM. In the study reported by
these authors, the drug susceptibility assays were conducted using a different growth medium
(Dubos medium supplemented with albumin and glycerol, with no addition of Tween80). This may
account for the significant variation in the MIC of this compound in the two assays.17
87
2.10 Summary
Several C-21 ester and amide hybrids of FA fused to aminoquinolines were successfully synthesised
in moderate to good yields. NMR and LC-MS spectroscopic data confirmed the structures of the
expected compounds.
Semi-quantitative determination of the aqueous solubility of the target compounds in aqueous
medium was conducted using an established turbidimetric assay as a means of anticipating potential
challenges in conducting subsequent in vitro assays in aqueous solutions. All the hybrids scored
poorly in the solubility scale, with the overall average solubility 10-fold lower than that of FA.
The compounds were evaluated for their in vitro activity against Mtb. Compared to FA, all the esters
and amides synthesised were less active, with MIC values ranging from 2- to 8-fold lower than that
of FA. The exception to this was AW45, the amide analogue with a 5-carbon methylene spacer, the
longest in the series. As a consequence of its poor aqueous solubility, its MIC value could not be
established, as the compound precipitated in the growth medium at concentrations below the
average MIC values observed in the series.
In order to establish the contribution of each pharmacophore to the activity of the hybrids, selected
constituents of the hybrid molecules were tested in a 1:1 molar ratio. In addition, the
aminoquinoline derivatives were also evaluated for their MIC. The MIC values of all the 1:1 mixtures
were similar that of FA, while the aminoquinoline derivatives proved inactive on their own. The
aminoquinoline scaffold was therefore not beneficial to the overall activity of the hybrids.
Conversely, covalent attachment of FA improved their antimycobacterial activity. These data
demonstrate that the use of aminoquinoline-based esters and amides to mask the carboxylic acid
was not tolerated. This result corroborates antibacterial SAR reported8–10, which showed that bulky
hydrophobic substituents at this position were not tolerated.
It is critical to note that the poor solubility of these hybrids was taken into consideration in the
selection of FA analogues to be evaluated in subsequent in vitro assays, which would be conducted
in aqueous media. Moreover, given their low potency, the series could not be progressed further,
save for evaluation of cytotoxicity and evaluation of mycobacterial-mediated hydrolysis, which are
presented in Chapter 3. Therefore, the FA-aminoquinoline hybrids were not assessed for membrane
permeability. The detailed experimental procedures for the synthesis, spectroscopic
characterization, biological evaluation and solubility assay are presented in Chapter 6.
88
2.11 References (1) Farber, B. F.; Yee, Y. C.; Karchmer3, A. W. Antimicrob. Agents Chemother. 1986, 174–175.
(2) Leclercq, R.; Bismuth, R.; Casin, I.; Cavallo, J. D.; Croize, J.; Felten, A.; Goldstein, F.; Monteil,
H.; Quentin-Noury, C.; Reverdy, M.; Vergnaud, M.; Roiron, R. J. Antimicrob. Chemother. 2000,
45, 27–29.
(3) Forrest, G. N.; Tamura, K. Clin. Microbiol. Rev. 2010, 23 (1), 14–34.
(4) O’Neill, A. J.; Cove, J. H.; Chopra, I. J. Antimicrob. Chemother. 2001, 47 (5), 647–650.
(5) Witzig, R. S.; Franzblau, S. G. Antimicrob. Agents Chemother. 1993, 37 (9), 1997–1999.
(6) Ramón-García, S.; Ng, C.; Anderson, H.; Chao, J. D.; Zheng, X.; Pfeifer, T.; Av-Gay, Y.; Roberge,
M.; Thompson, C. J. Antimicrob. Agents Chemother. 2011, 55 (8), 3861–3869.
(7) Finch, R. G.; Greenwood, D.; Whitley, R. J.; Norrby, S. R. In Elsevier Health Sciences; Finch, R.
G. (Roger G. ., Greenwood, D., Whitley, R. J., Norrby, S. R., Eds.; Elsevier Health Sciences:
London, 2010; pp 262–264.
(8) Duvold, T.; Sørensen, M. D.; Björkling, F.; Henriksen, A. S.; Rastrup-Andersen, N. J. Med.
Chem. 2001, 44 (19), 3125–3131.
(9) Godtfredsen, W. O.; von Daehne, W.; Tybring, L.; Vangedal, S. J. Med. Chem. 1966, 9 (1), 15–
22.
(10) Janssen, G.; Vanderhaeghe, H. J. Med. Chem. 1967, 10 (2), 205–208.
(11) von Daehne, W.; Godtfredsen, W. O.; Rasmussen, P. R. Adv. Appl. Microbiol. 1979, 25, 95–
146.
(12) Koreeda, M.; Tuinman, R.; Shull, B. K. United States Patent [ 19 ]. US006103884A, 2000.
(13) Encinas López, A. In Privileged scaffolds iin medicinal chemistry: Design, synthesis, evaluation;
Brase, S., Ed.; 2015; pp 132–146.
(14) Vandekerckhove, S.; D’Hooghe, M. Bioorganic Med. Chem. 2015, 23 (16), 5098–5119.
(15) Rustomjee, R.; Diacon, A. H.; Allen, J.; Venter, A.; Reddy, C.; Patientia, R. F.; Mthiyane, T. C. P.;
De Marez, T.; van Heeswijk, R.; Kerstens, R.; Koul, A.; De Beule, K.; Donald, P. R.; McNeeley, D.
89
F. Antimicrob. Agents Chemother. 2008, 52 (8), 2831–2835.
(16) Diacon, A. H.; Pym, A.; Grobusch, M.; Patientia, R.; Rustomjee, R.; Page-Shipp, L.; Pistorius, C.;
Krause, R.; Bogoshi, M.; Churchyard, G.; Venter, A.; Allen, J.; Palomino, J. C.; De Marez, T.; van
Heeswijk, R. P.; Meyvisch, P.; Verbeeck, J.; Parys, W.; de Beule, K.; Andries, K.; Neeley, D. F.
M. N. Engl. J. Med. 2009, 360 (23), 2397–2405.
(17) Lougheed, K. E. A.; Taylor, D. L.; Osborne, S. A.; Bryans, J. S.; Buxton, R. S. Tuberculosis 2009,
89 (5), 364–370.
(18) Muregi, F. W.; Ishih, A. Drug Dev. Res. 2010, 71 (1), 20–32.
(19) Fortin, S.; Bérubé, G. Expert Opin. Drug Discov. 2013, 8 (8), 1029–1047.
(20) Morphy, R.; Rankovic, Z. J. Med. Chem. 2005, 48 (21), 6523–6543.
(21) Walsh, J.; Bell, A. Curr. Pharm. Des. 2009, 15 (25), 2970–2985.
(22) Srivastava, V.; Lee, H. Eur. J. Pharmacol. 2015, 762, 472–486.
(23) Gediya, L. K.; Njar, V. C. Expert Opin. Drug Discov. 2009, 4 (11), 1099–1111.
(24) Testa, B. Biochem. Pharmacol. 2004, 68 (11), 2097–2106.
(25) Ettmayer, P.; Amidon, G. L.; Clement, B.; Testa, B. J. Med. Chem. 2004, 47 (10), 2393–2404.
(26) Stella, V. J. Expert Opin. Ther. Pat. 2004, 14 (3), 277–280.
(27) Stella, V. J. Prodrugs : challenges and rewards; Stella, V., Borchardt, R., Hageman, M., Oliyai,
R., Maag, H., Tilley, J., Eds.; Springer: New York, NY, 2007.
(28) Rautio, J.; Kumpulainen, H.; Heimbach, T.; Oliyai, R.; Oh, D.; Järvinen, T.; Savolainen, J. Nat.
Rev. Drug Discov. 2008, 7 (3), 255–270.
(29) Hamad, M. O.; Kiptoo, P. K.; Stinchcomb, A. L.; Crooks, P. A. Bioorg. Med. Chem. 2006, 14
(20), 7051–7061.
(30) Bodor, N.; Buchwald, P. Pharmacol. Ther. 1997, 76 (1–3), 1–27.
(31) Bodor, N.; Buchwald, P. Med. Res. Rev. 2000, 20 (1), 58–101.
90
(32) Thorsteinsson, T.; Loftsson, T.; Masson, M. Curr. Med. Chem. 2003, 10 (13), 1129–1136.
(33) Via, L. E.; Savic, R.; Weiner, D. M.; Zimmerman, M. D.; Prideaux, B.; Irwin, S. M.; Lyon, E.;
O’Brien, P.; Gopal, P.; Eum, S.; Lee, M.; Lanoix, J.-P.; Dutta, N. K.; Shim, T.; Cho, J. S.; Kim, W.;
Karakousis, P. C.; Lenaerts, A.; Nuermberger, E.; Barry, C. E.; Dartois, V. ACS Infect. Dis. 2015,
1 (5), 203–214.
(34) Zawilska, J.; Wojcieszak, J.; Olejniczak, A. B. Pharmacol. Rep. 2013, 65 , 1-14.
(35) Beaumont, K.; Webster, R.; Gardner, I.; Dack, K. Curr. Drug Metab. 2003, 4 (6), 461–485.
(36) Yasuhara, A.; Nakamura, M.; Sakagami, K.; Shimazaki, T.; Yoshikawa, R.; Chaki, S.; Ohta, H.;
Nakazato, A. Bioorg. Med. Chem. 2006, 14 (12), 4193–4207.
(37) Nakamura, M. Drug Metab. Dispos. 2005.
(38) Lin, J. H.; Lu, A. Y. H. Pharmacol. Rev. 1997, 49 (4), 403–449.
(39) Russell, D. G. Immunol. Rev. 2011, 240 (1), 252–268.
(40) Tan, S.; Russell, D. G. Immunol. Rev. 2015, 264 (1), 233–248.
(41) Dartois, V.; Barry, C. E. Bioorg. Med. Chem. Lett. 2013, 23 (17), 4741–4750.
(42) Dartois, V. Nat. Rev. Microbiol. 2014, 12 (3), 159–167.
(43) Sarathy, J.; Dartois, V.; Dick, T.; Gengenbacher, M. Antimicrob. Agents Chemother. 2013, 57
(4), 1648–1653.
(44) Prideaux, B.; Via, L. E.; Zimmerman, M. D.; Eum, S.; Sarathy, J.; O’Brien, P.; Chen, C.; Kaya, F.;
Weiner, D. M.; Chen, P.-Y.; Song, T.; Lee, M.; Shim, T. S.; Cho, J. S.; Kim, W.; Cho, S. N.; Olivier,
K. N.; Barry, C. E.; Dartois, V. Nat. Med. 2015, 21 (10), 1223–1227.
(45) Ballatore, C.; Huryn, D. M.; Smith, A. B. ChemMedChem 2013, 8 (3), 385–395.
(46) Lee, R. E.; Hurdle, J. G.; Liu, J.; Bruhn, D. F.; Matt, T.; Scherman, M. S.; Vaddady, P. K.; Zheng,
Z.; Qi, J.; Akbergenov, R.; Das, S.; Madhura, D. B.; Rathi, C.; Trivedi, A.; Villellas, C.; Lee, R. B.;
Rakesh; Waidyarachchi, S. L.; Sun, D.; McNeil, M. R.; Ainsa, J. A.; Boshoff, H. I.; Gonzalez-
Juarrero, M.; Meibohm, B.; Böttger, E. C.; Lenaerts, A. J. Nat. Med. 2014, 20 (2), 152–158.
91
(47) de Souza, M. V. N.; Pais, K. C.; Kaiser, C. R.; Peralta, M. a; de L. Ferreira, M.; Lourenço, M. C. S.
Bioorg. Med. Chem. 2009, 17 (4), 1474–1480.
(48) Tukulula, M. PhD Thesis, University of Cape Town,2012.
(49) Musonda, C.C. PhD Thesis, University of Cape Town, 2005.
(50) González Cabrera, D.; Douelle, F.; Feng, T.-S.; Nchinda, A. T.; Younis, Y.; White, K. L.; Wu, Q.;
Ryan, E.; Burrows, J. N.; Waterson, D.; Witty, M. J.; Wittlin, S.; Charman, S. A.; Chibale, K. J.
Med. Chem. 2011, 54 (21), 7713–7719.
(51) Chiyanzu, I.; Clarkson, C.; Smith, P. J.; Lehman, J.; Gut, J.; Rosenthal, P. J.; Chibale, K. Bioorg.
Med. Chem. 2005, 13 (9), 3249–3261.
(52) Bevan, C. D.; Lloyd, R. S. Anal. Chem. 2000, 72 (8), 1781–1787.
(53) Ioerger, T. R.; Feng, Y.; Ganesula, K.; Chen, X.; Dobos, K. M.; Fortune, S.; Jacobs Jr., W. R.;
Mizrahi, V.; Parish, T.; Rubin, E.; Sassetti, C.; Sacchettini, J. C. J. Bacteriol. 2010, 192 (14),
3645–3653.
(54) Collins, L. A.; Franzblau, S. G. Antimicrob. Agents Chemother. 1997, 41 (5), 1004–1009.
(55) Collins, L. A.; Torrero, M. N.; Franzblau, S. G. Antimicrob. Agents Chemother. 1998, 42 (2),
344–347.
(56) Shargel, L.; Wu-Pong, S.; Yu, A. B. C. Applied Biopharmaceuticals & Pharmacokinetics, 6th ed.;
Shargel, L., Yu, A. B. C., Wu-Pong, S., Eds.; McGraw-Hill: London, 2005.
(57) de Souza, M. V. N.; Pais, K. C.; Kaiser, C. R.; Peralta, M. A.; de L. Ferreira, M.; Lourenço, M. C.
S. Bioorg. Med. Chem. 2009, 17 (4), 1474–1480.
4
Chapter 3
Evaluation of cytotoxicity, intracellular efficacy and mycobacterial metabolism of Fusidic acid and
selected analogues
Chapter overview
In this chapter, the fusidic acid hybrids and several other analogues are evaluated for their
cytotoxicity. Subsequently, selected analogues are evaluated for their intracellular efficacy in THP-1
cells. Finally, the mycobacterial metabolism of several of the hybrids and analogues is investigated.
3.1 Introduction
A combination of bacterial and host-mediated factors enables Mtb not only to survive, but to
replicate, within macrophages.1 For this reason, macrophage models of infection have been useful
preclinically in evaluating the intracellular activities of compounds under different conditions.2
Efficacy against intracellular bacilli reflects physicochemical and pharmacodynamic properties of
compounds: permeability across the host membrane, avoidance of or activation by host metabolism
and additionally, the ability to inhibit an essential bacillary function despite the survival mechanisms
enlisted intracellularly. Therefore, the evaluation of intracellular efficacy of compounds has been
incorporated into the panel of most TB drug discovery assays. As a result, in vitro models of infection
have been developed to enable medium and high-throughput screening of compounds. An
additional consideration is that activity in macrophages is considered a prerequisite for mouse
efficacy studies, particularly given that TB in the mouse model is primarily macrophage driven.3 THP-
1 and J774 are the two most common cell lines used for the in vitro assessment of intracellular
efficacy of compounds owing to their ease of propagation and extensive literature describing the
activity of different anti-TB drugs in these models. THP-1 is a human monocytic cell line adapted to
mature into macrophages under laboratory conditions, thus enabling infection with Mtb and
consequently the evaluation of compound efficacy; these cells were used here to evaluate FA and
selected analogues.
In the absence of information on a compound’s mechanisms of action, general toxicity in an
intracellular infection model such as Mtb-infected macrophages cannot be ruled out as the cause of
inhibition. Since the ultimate goal of drug discovery is to develop safe and efficacious medicines, it is
equally important to establish the selectivity of compounds for microorganisms, and rule out their
inhibition of mammalian cells. As part of the broader goal of safety evaluation in any drug discovery
4
program, compounds are evaluated for in vitro cytotoxicity during the pre-clinical phase. A large
panel of cell lines, both animal and human, has been adapted for in vitro evaluation of cytotoxicity at
high-throughput scale. For this study, two mammalian cell lines were selected for use: Chinese
Hamster ovarian (CHO) cells, an epithelial cell line derived from the ovary of the Chinese hamster,
and THP-1 cells, the same human monocytic cell line used for intracellular infections, which is
derived from an acute monocytic leukaemia patient. The former is well-established for cytotoxicity
studies, while the latter was of relevance because of its use downstream in intracellular
antimycobacterial efficacy studies.
3.2 Aims and objectives
The aim in this first part of the chapter was to identify cytotoxic compounds as a prelude to
investigating the intracellular efficacy of FA and selected analogues. The specific objectives were:
(1) Evaluate the cytotoxicity of FA-aminoquinoline hybrids in CHO cells.
(2) Determine the contribution of the pharmacophoric units to the cytotoxicity of the FA-
aminoquinoline hybrids in CHO cells.
(3) Investigate the cytotoxicity of FA-aminoquinoline hybrids, selected C-3 FA esters and keto-
fusidic acid in THP-1 cells.
(4) Evaluate the intracellular activity of FA and selected analogues in THP-1 cells.
3.3 Evaluation of cytotoxicity
3.3.1 Evaluation of cytotoxicity of the FA-aminoquinoline hybrids in CHO cells
The compounds were screened for in vitro cytotoxicity using the 3-(4, 5-dimethylthiazol-2-yl)-2, 5-
diphenyltetrazolium bromide (MTT) assay, which compares well with other available assays.4,5 It is a
colorimetric assay routinely used to assess cellular growth and survival in the presence of
compounds over a range of concentrations and expressed as the concentration that inhibits growth
and survival by 50% (IC50). FA, selected aminoquinolines, and the FA-aminoquinoline hybrids were
screened. In addition, in order to establish the contribution of each pharmacophore to the
cytotoxicity of the hybrids, 1:1 molar mixtures of selected aminoquinoline derivatives and FA were
tested in combination. For this purpose, representative aminoquinoline alcohol and diamine
derivatives were selected, specifically: the 2-carbon methylene spacer-linked aminoalcohol and
diamine, alongside the 5 methylene carbon spacer-linked counterparts from the two series. The
assays were conducted at the Department of Pharmacology, University of Cape Town. The
experimental details are provided in Chapter 6.
4
3.3.2 Evaluation of cytotoxicity of the FA-aminoquinoline hybrids in THP-1 cells
Prior to carrying out antimycobacterial efficacy in THP-1 cells, the FA-aminoquinoline hybrids were
evaluated for cytotoxicity. For this assay, the 96-well plate format of the broth microdilution and
MABA assays were applied, allowing 2-fold serial dilutions of compound ranging from 1.56 µM to
200 µM. The THP-1 cells were incubated in the presence of the compounds for 3 days at 37oC with
5% CO2, after which alamar blue was added. Visual assessment was used to determine growth and
inhibition, expressed as IC90, defined as the lowest concentration that resulted in 90% inhibition of
cells.
3.3.3 Results: Cytotoxicity in CHO cells
3.3.3.1 Evaluation of the contribution of the pharmacophoric units to the cytotoxicity of the
hybrids
Table 3.1: Results of IC90 determinations of individual aminoquinoline derivatives and their mixtures
with FA in CHO
Compound
code n X
MIC90 in
7H9/OADC
at day 14 (µM),
singly
MIC90 in
7H9/OADC
at day 14 (µM),
in combination
IC90 in CHO
(µM), singly
IC90 in CHO
(µM), in
combination
AW21 2 O >160 5 47.1 >194
AW28 4 O >160 5 12.5 >194
AQ1 2 NH >160 5 >200 >194
AW18 4 NH >160 5 200 >194
FA - - 0.625 >194 -
primaquine - - >160 5 ND ND
ND- Not determined; Values for MIC90 represent screening against Mtb H37Rv, while those for IC90 represent
screening against the CHO cell-line.
At concentrations up to 200 µM, the aminoalcohol derivatives were not cytotoxic to the cells. In
contrast, the diamine derivatives were cytotoxic at very low concentrations. Furthermore, the
4
diamine with a 5 carbon methylene spacer was roughly 4-fold more cytotoxic than its 2 carbon
methylene-spaced counterpart. Primaquine, as expected of a clinically approved drug, was also
relatively non-cytotoxic. Calculation of selectivity indices would not be reflective of their cytotoxicity
in Mtb-infected cells, since the MIC values for antimycobacterial activity were based on 90 % and not
50% inhibition of growth. In all cases, the 1:1 molar mixtures matched that of FA.
3.3.3.2 Evaluation of cytotoxicity of the FA-aminoquinoline hybrids in CHO and THP-1
The FA hybrids were evaluated for cytotoxicity in both CHO and THP-1 cells. Relative to FA, all the
FA hybrids were cytotoxic, and at concentrations below 10 µM for the amides AW31 and AW25,
which had 3- and 4- carbon methylene spacers respectively.
It is noteworthy that the amides with the longest and shortest alkyl spacer - AW45 and AW23,
respectively - were equally cytotoxic. This suggests that factors other than increased molecular
weight or length of the alkyl spacer contributed to increased cytotoxicity. The primaquine hybrid,
AW33, was the least cytotoxic compound, and this correlates with the lack of cytotoxicity seen in
both pharmacophores.
Similarly, among the esters, there was no correlation between increased chain length and
cytotoxicity despite the non-cytotoxicity observed in the aminoalcohol derivatives that constitute
them. Calculation of selectivity indices would not be reflective of their cytotoxicity in Mtb, since the
MIC values for antimycobacterial activity were based on 90 % and not 50% inhibition of growth.
Table 3.2 summarises the results.
96
Table 3.2: Results of evaluation of cytotoxicity of the FA-aminoquinoline hybrids
R Compound
code X n R1
IC50 in CHO
(µM)
IC90 in
THP-1 (µM)
MIC90 in
7H9/OADC
(µM)
Selectivity
index
AW32 O 2 H 19.4 12.5 10 1.25
AW42 O 3 H 10.0 6.25 40 0.16
AW34 O 4 H ND* 6.25 40 0.16
AW35 O 5 H 13.1 6.25 40 0.16
AW23 NH 2 H 10.3 12.5 20 0.63
AW31 NH 3 H 2.75 6.25 20 0.31
AW25 NH 4 H 4.98 6.25 20
AW45 NH 5 H 10.0 ND* 160 0.31
AW24 NH 3 Me 17.5 6.25 20 0.31
97
R Compound
code X n R1
IC50 in CHO
(µM)
IC90 in
THP-1 (µM)
MIC90 in
7H9/OADC
(µM)
Selectivity
index
AW33 NH 3 - >220 12.5 >160 0.31
- FA - - - >194 200 5 40
- primaquine - - - 126.7 ND >160 -
- emetine - - - 0.104 - - -
ND- Not Determined (in the case of AW34, due to insufficient material, while AW45 precipitated in the cell culture medium at the lowest limit of concentration for testing.
Values for MIC90 represent screening against Mtb H37Rv, while IC50 and IC90 represent screening against CHO and THP-1 cells respectively. Selectivity index is expressed
relative to IC90 in THP-1.
98
3.3.4 Discussion
Relative to FA, the FA-aminoquinoline hybrids were cytotoxic to both CHO and THP-1 cells; although
by virtue of the different definitions of cytotoxicity (50% inhibition for CHO and 90% for THP-1), no
direct comparison of the absolute values could be made. Variations in the cytotoxicity profile of
compounds across different cell lines are an inherent limitation of these widely used in vitro
cytotoxicity assays. Differences in function and structure of the cell lines may have implications for
their sensitivities to compounds. In addition, as these cell lines are immortalised and adapted for in
vitro lab use, there is a limit to their correlation in vivo.
There was no clear trend with relation to the length of the alkyl spacer across the amide and ester
hybrids. In the THP-1 assay, the primaquine hybrid AW33 was the least cytotoxic of the hybrids.
The cytotoxicity observed for the diamine aminoquinoline derivatives in the MTT assay suggests that
the quinoline scaffold contributes to the cytotoxicity of the hybrids synthesised in this project. The
non-cytotoxicity observed for FA supports this and, in addition, the aminoquinoline scaffold has
been associated with cytotoxicity. For example, Andayi et al reported cytotoxic activity of
aminoquinoline hybrids with similar alkyl spacers at the 4-position.6
Given their low aqueous solubility, as can be seen in the case of AW45 that precipitated in the
culture medium used for the assay, this may have precluded the detection of the in vitro cytotoxicity
in the case of several of the hybrids which were found to be insoluble at 10 µM in the solubility
assay discussed in Chapter 2.
By virtue of their poor solubility in aqueous media, in vitro cytotoxicity and poor antimycobacterial
activity in comparison to FA, these compounds were not progressed to macrophage efficacy studies.
3.4 Evaluation of selected FA analogues for intracellular antimycobacterial efficacy in THP-1
3.4.1 Compound selection
As part of ongoing work aimed at the repositioning of FA for TB drug discovery, structure-activity
relationship (SAR) studies on this molecule have resulted in the synthesis of a wider panel of
analogues with variable antimycobacterial activity. Along with FA, two C-3 ester and 3-ketofusidic
acid (keto-FA) were selected based on their antimycobacterial activities, relatively low cytotoxicity to
THP-1 cells and their promising PK profiles from preliminary in vivo mouse studies. 3-ketoFA
(designated as GKFA37), has been reported as a metabolite in man with lower antibacterial activity
compared to the parent drug.7
The compounds were diluted to achieve 1X, 2X, and 5X MIC90 concentrations, with the exception of
GKFA16 which was used at 1X and 2X MIC90 due its lower selectivity index (Table 3.3). Isoniazid
(INH), a first-line anti-TB agent with in vitro intracellular efficacy, was used at 2X its MIC90 value.8
99
Figure 3.1: FA and analogues selected for evaluation of intracellular efficacy in THP-1
3.4.2 Intracellular infection
To assess the intracellular efficacy of the compounds, THP-1 cells were infected with approximately
1 x 105 colony forming units (CFU) per ml of Mtb H37Rv MA at a multiplicity of infection (MOI) of 10
bacilli: 1 macrophage. At 4 hours post-infection, extracellular bacteria were washed off and the cells
were treated with the compounds in triplicate at a range of concentrations (Table 3.3).The cells
were incubated for 6 days as the viability of THP-1 cells is known to decrease after this period.
Table 3.3: FA and analogues evaluated for intracellular efficacy in THP-1
Compound 7H9/OADC MIC90 in
(µM)
IC90 in THP-1 in
(µM)
Selectivity
index
Concentrations for
assay (µM)
FA 5 >200 >40 1x, 2x, and 5x MIC
GKFA16 20 100 5 1x and 2x MIC;
GKFA17 5 100 10 1x, 2x, and 5x MIC
GKFA37 2.5 >200 >80 1x, 2x, and 5x MIC;
The culture medium (with and without compound for the treated and untreated cells, respectively)
was replenished every two days (adding fresh medium to the untreated controls).
Concomitantly, cells in representative wells were lysed using distilled water with 0.05% Tween80
and the lysates serially diluted in standard 7H9 medium. Serial dilutions of the lysates were plated
on 7H10 agar plates and CFU were enumerated after incubation for 21-28 days. The post-
phagocytosis inoculum (untreated cells at the onset of infection) was used as a baseline to
determine the increase in CFU. Details of the experimental procedure are described in Chapter 6.
100
3.4.3 Results of CFU log reduction for Mtb-infected THP-1 treated with FA
At 1X MIC, there was no reduction in CFU, while at 2X and 5X MIC there was a 2-log reduction in CFU
by day 6. The 2-log reduction in CFU was more rapidly achieved at 5X its MIC. However, this is lower
than the activity observed for the control drug, INH at 2X MIC, which caused a 2-log reduction in CFU
by day 2 (Graph 3.1).
Graph 3.1: Log reduction of CFU in THP-1 treated with FA
3.4.4 Results of CFU log reduction for Mtb-infected THP-1 treated with GKFA16 and GKFA17
In comparison to FA, a more modest reduction in CFU was observed for GKFA16, with a 1-log
reduction achieved by day 6 at both 1X and 2X MIC (Graph 3.2). However, at 5X MIC, a 2-log
reduction was observed for GKFA17 over the 6 days, with earlier onset of log reduction in CFU by
day 2 (Graph 3.3).
101
Graph 3.2: Log reduction of CFU in THP-1 treated with GKFA16
Graph 3.3: Log reduction of CFU in THP-1 treated with GKFA17
3.4.5 Results of CFU log reduction for Mtb-infected THP-1 treated with GKFA37
At 1X and 2X MIC, a 1-log reduction in MIC was observed, while, at 5X MIC, a more rapid decline in
CFU similar to that of the control INH was achieved (Graph 3.4).
102
Graph 3.4: Log reduction of CFU in THP-1 treated with GKFA37
3.4.6 Discussion
FA, GKFA17 and GKFA37 were active against intracellular Mtb, effecting a 2-log reduction in CFU
over the course of 6 days. This was more rapidly achieved at the highest concentration for each of
these compounds. GKFA16 only caused a 1-log reduction, correlating with its lower potency in Mtb
broth cultures compared to FA and the other two analogues. In this macrophage model of infection,
GKFA37, which has been reported as a metabolite of FA in man with lower antibacterial activity than
the parent drug, showed a 1-fold higher difference in potency compared to FA. This was a similar
result to that observed in broth culture, where it showed a 1-fold higher difference in potency
compared to FA.
The intracellular efficacy observed for FA and the analogues in this study point to their ability to
accumulate within phagocytic cells, consistent with the findings of Lemaire et al who evaluated FA
for intracellular efficacy against several strains of Staphylococcus aureus. As part of their study,
Lemaire and co-workers evaluated FA accumulation in THP-1 cells, and found that increased
accumulation was not associated with better activity in broth. This led these authors to speculate
the involvement of other resistance mechanisms in the relatively lower intracellular efficacy of FA
compared to its activity in broth.9
As discussed in section 3.1, macrophage models of infection have proven to be useful in evaluating
the intracellular efficacy of compounds under different conditions.2 In a study by Vanderven et al,
from a high-throughput screen of 1,359 compounds with antimycobacterial activity ≤ 5 µM, only
10% inhibited growth of Mtb intracellularly.2 The results obtained for GKFA16, GKFA17 and GKFA37
103
give some measure of confidence in the antimycobacterial efficacy of these compounds, albeit
tempered by several factors: macrophages are part of a wider context of the granuloma in host
infection, thus excluding other mechanisms that play a role in the outcome of infection in host
disease. Cell lines adapted for in vitro lab use have limited predictive value for in vivo disease, and in
addition, different results are sometimes observed across various cell lines.
104
3.5 In vitro Metabolism of FA and selected analogues
3.5.1 Introduction
As discussed in Chapter 1, drug metabolism has implications for the efficacy and safety of a drug as a
consequence of the following: (1) enzymatic inactivation (detoxification); (2) biotransformation into
active metabolites; (3) enzymatic modification into reactive metabolites that cause toxicity. Because
of its status as an old drug, the in vivo metabolism of FA has been studied extensively, and more
recently by various members of our lab, using a variety of in vitro systems.
3.5.2 Metabolism of FA
3.5.2.1 Metabolism of FA in humans
In humans, FA is mainly cleared through hepatic metabolism, and to a lesser extent, through biliary
excretion. The C-21 glucuronide (2) is the major metabolite, while 3-keto FA (GKFA37), 27-carboxy
FA (4) and a ring hydroxylation (5) product are minor metabolites. (Figure 3.2 below).7,10,11
Interestingly, at high doses, FA has been reported to inhibit its own clearance; although the
mechanisms for this auto-inhibition are as yet unknown.7,12,13
105
Figure 3.2: FA metabolites in man
3.5.2.2 Metabolism in microsomes
Human, mouse and rat liver microsomes (denoted as HLM, MLM and RLM respectively) were used
for the evaluation of metabolic stability and metabolite identification. Overall, comparable
microsomal stability of 65% ± 5% was observed across the three species. With regards to specific
metabolites, differential metabolism was observed across the rodent and human species. FA was
shown to have a shorter half-life in rodent microsomes. In addition, one of the metabolites reported
in FA metabolism in man, carboxyfusidic acid, was absent in all the in vitro incubations.
106
The major metabolite detected in RLM and MLM was 3-epifusidic acid (3-epi-FA), which was
hypothesised to result from reversible oxidation at C-3, wherein the reverse reduction occurs in a
non-stereo selective manner, resulting in both FA and its C-3 epimer, 3-epiFA. In addition, 3-keto
fusidic acid (3-ketoFA) and a ring hydroxylation product were detected as minor metabolites (Figure
3.3). This epimerisation has also been reported for another steroid, cinobufagin.14, 15 Interestingly, in
cinobufagin, this reaction is also species-specific, reported only for in vitro and in vivo rat
metabolism, but not in mouse or humans. Conversely, in HLM, the major metabolite reported was 3-
ketoFA, with no 3-epiFA detected. Negligible traces of the ring hydroxylation metabolite were also
detected.
Figure 3.3: Postulated conversion of FA to 3-epiFA
3.5.2.3 Metabolism in mycobacterial lysates
FA was found to be metabolically stable in incubations of Mtb lysate, while in that of Msm, it was
unstable, with a half-life of 3 hours. This was found to be as a result of hydrolysis of the acetate at C-
16, with an unstable hydroxyl intermediate. The resultant metabolite, fusidic acid lactone, has been
reported as a metabolite with lower antibacterial activity compared to FA.10 Figure 3.4 below
illustrates the hydrolysis.
Figure 3.4 C-16 hydrolysis of FA
107
3.5.2.4 Metabolism in plasma
The stability in plasma varied as follows: mouse>>rat>man, which corresponds to the literature
reports of the hierarchy of hydrolase activity across these species.16 In rat and mouse plasma, the C-
16 hydrolysis reported in Msm lysate also occurred, resulting in formation of the lactone. In human
plasma, however, this modification did not take place.17
3.5.3 Metabolism of selected FA analogues
Previously, several aryl and alkyl esters of FA were evaluated for their metabolism in vitro in our lab,
and these are discussed briefly below due to their relevance to this project.17
3.5.3.1 C-3 esters
Metabolism in microsomes
In RLM, both aryl and alky esters exemplified by ME166, ME175, GKFA16 and GKFA17 (Figure 3.5)
were extensively metabolised to FA. Among the aryl esters, a hydroxylated metabolite was also
produced.
Figure 3.5: Examples of FA aryl and alkyl esters metabolized to FA in rat liver microsomes
Metabolism in plasma
Metabolism in rat plasma also produced FA, albeit at a slower rate in comparison to RLM
incubations. One compound in particular, GKFA17 (Figure 3.5) was evaluated for metabolism in
human, rat and mouse plasma, and its stability decreased in the order: human>>rat>>mouse. In
mouse plasma, GKFA17 had a short half-life of 30 minutes, exhibiting rapid hydrolysis to FA, with
less than 10% of the parent compound detected at the end of the incubation period. Conversely, in
human plasma, it was very stable, with >99% remaining 3 hours after incubation.
108
3.6 Role of mycobacterial metabolism in bioactivation and biodegradation of drugs
Mycobacteria possess hydrolytic enzymes that are known to metabolise xenobiotics. One such
example is pyrazinamide (PZA), a first-line anti-TB drug. PZA is well-established as a prodrug which
undergoes hydrolysis by mycobacterial deamidase to yield the weakly acidic pyrazinoic acid (POA),
which is responsible for the pharmacological activity observed.18,19 To support the assertion of
intrabacillary hydrolysis, it has been shown that clinical resistance to PZA is associated with
mutations in the pncA gene which encodes the mycobacterial gene.19 Via and co-workers, however,
reported host-mediated hydrolysis of PZA, demonstrating the contribution of host bioactivation to
the clinical efficacy of PZA.20 Another example is that of the aminoglycosides, a class of second-line
anti-TB agents used in the treatment of MDR-TB. As highlighted in Chapter 1, the inactivation of the
aminoglycoside kanamycin through enzymatic modification has been reported. A mycobacterial
acetyltransferase enhanced intracellular survival (Eis) has been shown to carry out multiple
acetylations on kanamycin (KAN), rendering Mtb resistant to several aminoglycosides. To support
this, DNA sequencing of KAN-resistant clinical isolates revealed the upregulation of mycobacterial
eis.21,22 Also highlighted in Chapter 1, recently, Warrier et al reported N-methylation of an
antimycobacterial pyridobenzimidazole by Rv0560c, a previously uncharacterized methyltransferase
in Mtb.23
As discussed in chapter 1, a common mechanism of resistance to anti-TB drugs that are prodrugs is
the emergence of resistance mutations in genes that encode the enzymes required for their
bioactivation. Ethionamide, a second-line anti-TB agent, is one such example, with mutations
reported in ethA, which encodes the monooxygenase required for its bioactivation. A recent study
published by Blondiaux and co-workers reported that a novel molecule, Small Molecule Aborting
Resistance (SMARt-420) fully reversed ethionamide resistance in Mtb-infected mice, and, in
addition, increased the basal sensitivity of bacteria to ethionamide.24
3.7 Rationale
As mentioned in section 3.5.2.3, data from our lab demonstrated that, in Msm, FA is metabolised by
mycobacterial hydrolases to its lactone, which has significantly less antibacterial activity than FA.17
Since these experiments were carried out using lysates of Msm and Mtb, the hydrolysis observed
could only be attributed to cytosolic hydrolases. This excludes the contribution of enzymes
expressed in the mycobacterial cell membrane and/or enzymes that may be inactivated during cell
109
lysis, which may play a role in the in vitro metabolism of xenobiotics. In the prokaryotic world, Mtb is
unrivalled in the range of enzymes involved in lipid metabolism, including a variety of hydrolases,
some of which are expressed in the cell membrane.25–27 Although their substrates are typically
bacterial, their substrate specificity may be variable and some of them may hydrolyse xenobiotics.
The example of the prodrug PZA attests to the contribution of mycobacterial metabolism to
pharmacological activity. Moreover, some species of Streptomyces and Nocardia have been reported
to hydrolyse the C-16 acetyl group in FA as a mechanism of resistance to FA.28–31 As mentioned in
section 3.5.3.1, the C-3 esters were hydrolysed to FA in vitro. Among the FA analogues evaluated,
GKFA16 and GKFA17 showed good in vitro antimycobacterial activity in broth cultures and in Mtb-
infected THP-1 cells. In addition, relative to several other analogues, they had good selectivity
indices. GKFA61, a C-3 silicate ester, was selected for evaluation due to its promising in vivo PK data
from our lab, which revealed that, when administered to C57BL/6 mice at equivalent doses, it had a
longer half-life than FA. On this basis, they were selected for evaluation of in vitro mycobacterial
metabolism. In addition, two C-21 amide FA-aminoquinoline hybrids, AW23 and AW25, were also
selected for similar evaluation. As discussed in Chapter 2, these two hybrids were 4-fold less potent
than FA against Mtb. We hypothesised that this may be due to their stability in broth cultures; the
failure of hydrolysis to release FA and the aminoquinoline pharmacophore is therefore a plausible
explanation for their poor antimycobacterial activity relative to FA. Figure 3.6 illustrates their
chemical structures, the MIC90 (in Mtb H37Rv).
Figure 3.6: Structures of FA analogues for evaluation of mycobacterial metabolism
3.8 Aim
We hypothesised that there may be hydrolases in Mtb that may contribute to bioactivation or
biodegradation of FA and selected analogues. The aim of this work was therefore to investigate the
110
role of mycobacterial metabolism in the bioactivation and or biodegradation of FA and selected
ester and amide analogues in an in vitro system. The specific objective was to investigate the in vitro
metabolism of FA and selected C-3 ester and C-21 amide analogues in broth cultures of Mtb.
3.8.1 Incubation of compounds in Mtb
The compounds were added at 0.5X MIC to Mtb in PBS (0.05% Tween80) pH 7.4 and incubated in a
shaking incubator at 37oC over with sampling at various time-points over 48 hours. In parallel, the
compounds were added to heat-killed Mtb as a control to rule out degradation or bioactivation in
the absence of live bacteria. At each time-point, acetonitrile containing an internal standard was
used to deactivate the bacterial metabolism process. The samples were centrifuged and analysed by
LC-MS. The ratio of the analyte to internal standard over time was then plotted to give a measure of
the stability of the compound over the 48 hours.
3.8.2 Results
3.8.2.1 Stability of FA in Mtb cultures
Over 48 hours, FA was stable in both the live and heat-killed Mtb cultures (Graph 3.5). This suggests
that FA is not metabolised by the live bacilli and that any instability is due to non-specific
mechanisms such as aqueous degradation. The data shown are of technical triplicate samples,
representative of 2 experiments carried out on separate days.
Graph 3.5: Ratio of FA to internal standard in live and heat-killed Mtb cultures over time
3.8.2.2 Stability of GKFA16 and GKFA17 in Mtb cultures
In contrast, there was a gradual decline in the concentration of GKFA16 and GKFA17 in the live Mtb
culture (Graphs 3.6 and 3.7). Moreover, FA was detected in these cultures, with a concomitant
0
1
2
3
4
5
0 10 20 30 40
An
alyt
e/I
S ra
tio
Time (Hrs)
GKFA_HK
GKFA_LIVE
FA HK
FA live
111
increase in concentration over the 48 hours. This suggests that GKFA16 and GKFA17 are hydrolysed
to FA by the live bacilli. Furthermore, in both cases, when compared to the heat-killed Mtb cultures
containing FA where the concentration of FA remained constant over time, GKFA16 and GKFA17
were hydrolysed to higher concentrations of FA, a further testament to the mycobacterial hydrolysis
occuring. In the heat-killed cultures, this hydrolysis was marginal, and occurred at a much lower rate.
Graph 3.6: Ratio of FA and GKFA16 to internal standard in live and heat-killed Mtb cultures over
time
Graph 3.7: Ratio of FA and GKFA17 to internal standard in live and heat-killed Mtb over time
3.8.2.3 Stability of GKFA61 in Mtb cultures
Over 48 hours, GKFA61 was stable in both the live and heat-killed Mtb cultures, and no FA was
detected in the incubations (Graph 3.8). This suggests that it is not metabolised by the live bacilli
and that any instability is due to non-specific mechanisms such as aqueous degradation. The data
0
2
4
6
0 10 20 30 40
An
alyt
e/I
S ra
tio
Time (Hrs)
GKFA16_HK
GKFA16_LIVE
FA_HK
FA_LIVE
-2
0
2
4
6
8
10
12
0 10 20 30 40
An
alyt
e/I
S ra
tio
Time (Hrs)
GKFA17_HK
GKFA17_LIVE
FA_HK
FA_LIVE
112
shown are of technical triplicate samples, representative of 2 experiments carried out on separate
days.
Graph 3.8: Ratio of GKFA61 to internal standard in live and heat-killed Mtb over time
3.8.2.4 Stability of AW23 and AW25 in Mtb cultures
Similarly, the C-21 amides AW23 and AW25 were stable over the course of the 48 hours in both the
live and heat-killed Mtb cultures, and no FA was detected in the incubations (Graph 3.9).
Graph 3.9: Ratio of AW23 to internal standard in live and heat-killed Mtb over time
0
2
4
6
8
10
0 10 20 30 40
An
alyt
e/I
S
Time (Hrs)
GKFA61_HK
GKFA61_LIVE
0
0.4
0.8
1.2
1.6
2
0 10 20 30 40
An
alyt
e:I
S ra
tio
Time (Hrs)
AW23 HK
AW23 LIVE
113
Graph 3.10: Ratio of AW25 to internal standard in live and heat-killed Mtb over time
3.8.3 Discussion
FA remained stable in live Mtb cultures, a similar result to that previously observed in Mtb lysate.
This rules out the involvement of mycobacterial cell membrane-associated hydrolases in the
biodegradation of FA. Conversely, the C-3 esters GKFA16 and GKFA17 were hydrolysed by live bacilli
to achieve higher concentrations of FA compared to the heat-killed Mtb cultures, where the
concentration of FA remained relatively unchanged. These data are corroborated by preliminary in
vivo mouse PK (unpublished data from our lab), which have shown that these two compounds are
hydrolysed to achieve higher (lung) concentrations of FA when compared to the mice administered
with FA. Given the extensive hydrolysis of GKFA17 previously observed in mouse plasma and in rat
liver microsomes, it is plausible that mycobacterial and host metabolism could synergize to achieve
higher concentrations of FA in mice, increasing its bioavailability. In addition, both these compounds
were observed to be very stable in human plasma. Bacterial hydrolysis could therefore hydrolyse
them to achieve higher concentrations of FA in man.
The C-3 silicate ester GKFA61 and the C-21 amides AW23 and AW25 were stable in both live and
heat-killed Mtb cultures over 48 hours. The lack of hydrolysis of these compounds to FA in broth
cultures may contribute to their lower potency compared to FA. In the case of GKFA61, the isopropyl
groups provide steric hindrance around the C-3 position, improving metabolic stability, and,
consequently a longer half-life seen for this compound in mice.
Strictly speaking, prodrugs should be devoid of pharmacological activity, and require enzymatic
hydrolysis to release the pharmacologically active metabolite.32,33 The C-3 FA esters, GKFA16 and
GKFA17, in themselves possess modest in vitro and ex vivo activity against Mtb, albeit lower than
that of FA. Notwithstanding, these compounds are hydrolysed by mycobacterial and host esterases
0
2
4
6
8
0 10 20 30 40
An
alyt
e:I
S ra
tio
Time(Hrs)
AW 25 HK
AW25 LIVE
114
to the parent drug. Moreover, unpublished data from our lab demonstrated that, in an in vivo PK
mouse model, in comparison to mice that were administered with FA, higher concentrations of FA
were detected in the lungs of mice that were administered with GKFA16 and GKFA17. Potentially,
higher bioavailability in the lung- the organ of interest in the context of pulmonary TB, could result in
improved efficacy of these compounds. Since they enhance the bioavailability of FA, they fit the
broader definition of prodrugs, which includes drugs that improve properties of the
pharmacologically active metabolite, such as PK. Mtb-associated hydrolysis of these esters shows
that mycobacterial metabolism may facilitate compound efficacy, which can be incorporated into
the design of future analogues.
Apart from their relevance in PK, bioactivation or biodegradation may have implications for drug
efficacy, as certain Nocardia and Streptomyces species exploit biodegradation as a mechanism of
resistance to FA and other antibiotics.28–38 Mycobacteria are known to possess hydrolases, including
esterases. Although the substrates are typically endogenous, their activity against xenobiotics has
not been studied, and it would be worthwhile to characterise their specificity, since FA and
analogues shares the steroid nucleus with cholesterol and other lipid metabolites critical to Mtb
survival.25,27,39–41 The example of these two compounds illustrates the value of establishing the role
of mycobacterial metabolism in drug PK, for its overall implications on efficacy.
115
3.9 Summary
Relative to FA, the FA-aminoquinoline hybrids were cytotoxic to both CHO and THP-1 cells.
There was no clear trend with relation to the length of the methylene spacer across the amide and
ester hybrids. In the THP-1 assay, the primaquine hybrid AW33 was the least cytotoxic of the
hybrids. Evaluation of selected aminoquinoline derivatives singly and in combination with FA in a 1:1
ratio in CHO cells suggests that the quinoline scaffold contributes to the cytotoxicity of these
hybrids. This is supported by the observation that FA was not cytotoxic in the same assay, and a
previous report in the literature, of compounds with a similar aminoquinoline scaffold, that were
found to be cytotoxic against this cell line.
The low aqueous solubility observed for these hybrids in Chapter 2 was further confirmed in the
cytotoxicity assays; AW45, the amide hybrid with a 5-carbon methylene spacer, precipitated in the
culture medium used for these assays. This may have precluded the accurate determination of the
cytotoxicity of some of these hybrids. By virtue of their poor solubility in aqueous media, in vitro
cytotoxicity and poor antimycobacterial activity in comparison to FA, these compounds were not
progressed to macrophage efficacy studies.
FA and three analogues, GKFA16, GKFA17 and GKFA37 (3-ketoFA), were evaluated for intracellular
efficacy in THP-1 cells. FA, GKFA17 and GKFA37 were active against intracellular Mtb, effecting a 2-
log reduction in CFU over the course of 6 days. This was more rapidly achieved at the highest
concentration for each of these compounds, which was 5x the MIC in broth cultures. GKFA16 only
caused a 1-log reduction, correlating with its lower potency in Mtb broth cultures compared to FA
and the other two analogues. In this macrophage model of infection, GKFA37, which has been
reported as a metabolite of FA in man with lower antibacterial activity than the parent drug, showed
a 1-fold higher difference in potency compared to FA. This was a similar result to that observed in
broth culture, where it showed a 1-fold higher difference in potency compared to FA. The
intracellular efficacy observed for FA and the analogues in this study point to their ability to
accumulate within phagocytic cells. This is consistent with existing literature reports of the
intracellular efficacy of FA against several strains of Staphylococcus aureus.
Three C-3 ester analogues, GKFA16, GKFA17 and GKFA61, as well as two C-21 FA amides, the FA-
aminoquinoline hybrids AW23 and AW25, were evaluated for in vitro mycobacterial metabolism. In
live Mtb cultures, GKFA16 and GKFA17 were extensively hydrolysed to FA, while, in heat-killed
cultures, their concentrations remained relatively unchanged. This bioconversion was not observed
for GKFA61, AW23 and AW25, whose concentrations remained relatively constant in both live and
heat-killed cultures. These findings corroborate in vivo PK data (unpublished), which showed higher
concentrations of FA in mice administered with GKFA16 compared to mice administered with
116
equivalent doses of FA. The lack of mycobacterial hydrolysis of GKFA61 by live bacilli correlates with
the longer half-life observed for this compound in mice, plausibly due to steric hindrance around the
C-3 position, which may confer metabolic stability.
117
3.10 References
(1) Tan, S.; Russell, D. G. Immunol. Rev. 2015, 264 (1), 233–248.
(2) VanderVen, B. C.; Fahey, R. J.; Lee, W.; Liu, Y.; Abramovitch, R. B.; Memmott, C.; Crowe, A.
M.; Eltis, L. D.; Perola, E.; Deininger, D. D.; Wang, T.; Locher, C. P.; Russell, D. G. PLOS Pathog.
2015, 11 (2), e1004679.
(3) Lenaerts, A.; Barry, C. E.; Dartois, V. Immunol. Rev. 2015, 264 (1), 288–307.
(4) Mosmann, T. J. Immunol. Methods 1983, 65 (1–2), 55–63.
(5) Rubinstein, L. V; Shoemaker, R. H.; Paull, K. D.; Simon, R. M.; Tosini, S.; Skehan, P.; Scudiero,
D. A.; Monks, A.; Boyd, M. R. J. Natl. Cancer Inst. 1990, 82 (13), 1113–1118.
(6) Andayi, W. A.; Egan, T. J.; Gut, J.; Rosenthal, P. J.; Chibale, K. ACS Med. Chem. Lett. 2013, 4 (7),
642–646.
(7) Turnidge, J. Int. J. Antimicrob. Agents 1999, 12, S23–S34.
(8) England, K.; Boshoff, H. I. M.; Arora, K.; Weiner, D.; Dayao, E.; Schimel, D.; Via, L. E.; Barry, C.
E. Antimicrob. Agents Chemother. 2012, 56 (6), 3384–3387.
(9) Lemaire, S.; Van Bambeke, F.; Pierard, D.; Appelbaum, P. C.; Tulkens, P. M. Clin. Infect. Dis.
2011, 52.
(10) Godtfredsen, W. O.; von Daehne, W.; Tybring, L.; Vangedal, S. J. Med. Chem. 1966, 9 (1), 15–
22.
(11) von Daehne, W.; Godtfredsen, W. O.; Rasmussen, P. R. Adv. Appl. Microbiol. 1979, 25, 95–
146.
(12) Tsuji, B. T.; Okusanya, O. O.; Bulitta, J. B.; Forrest, A.; Bhavnani, S. M.; Fernandez, P. B.;
Ambrose, P. G. Clin. Infect. Dis. 2011, 52 (Supplement 7), S513–S519.
(13) Bulitta, J. B.; Okusanya, O. O.; Forrest, A.; Bhavnani, S. M.; Clark, K.; Still, J. G.; Fernandes, P.;
Ambrose, P. G. Antimicrob. Agents Chemother. 2013, 57 (1), 498–507.
(14) Zhang, J.; Sun, Y.; Liu, J.-H.; Yu, B.-Y.; Xu, Q. Bioorg. Med. Chem. Lett. 2007, 17 (22), 6062–
6065.
(15) Ma, X.-C.; Ning, J.; Ge, G.-B.; Liang, S.-C.; Wang, X.-L.; Zhang, B.-J.; Huang, S.-S.; Li, J.-K.; Yang,
118
L. Drug Metab. Dispos. 2011, 39 (4), 675–682.
(16) Rudakova, E. V; Boltneva, N. P.; Makhaeva, G. F. Bull. Exp. Biol. Med. 2011, 152 (1), 73–75.
(17) Njoroge, M. PhD Thesis, University of Cape Town, 2014.
(18) Zhang, Y.; Scorpio, A.; Nikaido, H.; Sun, Z. J. Bacteriol. 1999, 181 (7), 2044–2049.
(19) Scorpio, A.; Zhang, Y. Nat. Med. 1996, 2 (6), 662–667.
(20) Via, L. E.; Savic, R.; Weiner, D. M.; Zimmerman, M. D.; Prideaux, B.; Irwin, S. M.; Lyon, E.;
O’Brien, P.; Gopal, P.; Eum, S.; Lee, M.; Lanoix, J.-P.; Dutta, N. K.; Shim, T.; Cho, J. S.; Kim, W.;
Karakousis, P. C.; Lenaerts, A.; Nuermberger, E.; Barry, C. E.; Dartois, V. ACS Infect. Dis. 2015,
1 (5), 203–214.
(21) Zaunbrecher, M. A.; Sikes, R. D.; Metchock, B.; Shinnick, T. M.; Posey, J. E. Proc. Natl. Acad.
Sci. 2009, 106 (47), 20004–20009.
(22) Chen, W.; Biswas, T.; Porter, V. R.; Tsodikov, O. V; Garneau-Tsodikova, S. Proc. Natl. Acad. Sci.
2011, 108 (24), 9804–9808.
(23) Warrier, T.; Kapilashrami, K.; Argyrou, A.; Ioerger, T. R.; Little, D.; Murphy, K. C.; Nandakumar,
M.; Park, S.; Gold, B.; Mi, J.; Zhang, T.; Meiler, E.; Rees, M.; Somersan-Karakaya, S.; Porras-De
Francisco, E.; Martinez-Hoyos, M.; Burns-Huang, K.; Roberts, J.; Ling, Y.; Rhee, K. Y.; Mendoza-
Losana, A.; Luo, M.; Nathan, C. F. Proc. Natl. Acad. Sci. 2016, 113 (31), E4523–E4530.
(24) Blondiaux, N.; Moune, M.; Desroses, M.; Frita, R.; Flipo, M.; Mathys, V.; Soetaert, K.; Kiass,
M.; Delorme, V.; Djaout, K.; Trebosc, V.; Kemmer, C.; Wintjens, R.; Wohlkönig, A.; Antoine, R.;
Huot, L.; Hot, D.; Coscolla, M.; Feldmann, J.; Gagneux, S.; Locht, C.; Brodin, P.; Gitzinger, M.;
Déprez, B.; Willand, N.; Baulard, A. R. Science (80-. ). 2017, 355 (6330), 1206–1211.
(25) Côtes, K.; Bakala N’Goma, J. C.; Dhouib, R.; Douchet, I.; Maurin, D.; Carrière, F.; Canaan, S.
Appl. Microbiol. Biotechnol. 2008, 78 (5), 741–749.
(26) Brust, B.; Lecoufle, M.; Tuaillon, E.; Dedieu, L.; Canaan, S.; Valverde, V.; Kremer, L. PLoS One
2011, 6 (9), e25078.
(27) Tallman, K. R.; Levine, S. R.; Beatty, K. E. ACS Infect. Dis. 2016, 2 (12), 936–944.
(28) von der Haar, B.; Schrempf, H. J. Bacteriol. 1995, 177 (1), 152–155.
119
(29) Dvonch, W.; Greenspan, G.; Alburn, H. E. Experientia 1966, 22 (8), 517.
(30) von der Haar, B.; Rosenberg, D.; Dittrich, W.; Schrempf, H. J. Antibiot. (Tokyo). 1991, 44 (7),
785–792.
(31) von Daehne, W.; Lorch, H.; Godtfredsen, W. O. Tetrahedron Lett. 1968, No. 47, 4843–4846.
(32) Rautio, J.; Kumpulainen, H.; Heimbach, T.; Oliyai, R.; Oh, D.; Järvinen, T.; Savolainen, J. Nat.
Rev. Drug Discov. 2008, 7 (3), 255–270.
(33) Huttunen, K. M.; Raunio, H.; Rautio, J. Pharmacol. Rev. 2011, 63 (3), 750–771.
(34) Morisaki, N.; Iwasaki, S.; Yazawa, K.; Mikami, Y.; Maeda, A. J. Antibiot. (Tokyo). 1993, 46 (10),
1605–1610.
(35) Yazawa, K.; Mikami, Y.; Maeda, A.; Morisaki, N.; Iwasaki, S. J. Antimicrob. Chemother. 1994,
33 (6), 1127–1135.
(36) Yazawa, K.; Mikami, Y.; Sakamoto, T.; Ueno, Y.; Morisaki, N.; Iwasaki, S.; Furihata, K.
Antimicrob. Agents Chemother. 1994, 38 (9), 2197–2199.
(37) Dabbs, E. R.; Yazawa, K.; Mikami, Y.; Miyaji, M.; Morisaki, N.; Iwasaki, S.; Furihata, K.
Antimicrob. Agents Chemother. 1995, 39 (4), 1007–1009.
(38) Harada, K.-I.; Tomita, K.; Fujii, K.; Sato, N.; Uchida, H.; Yazawa, K.; Mikami, Y. J. Antibiot.
(Tokyo). 1999, 52 (3), 335–339.
(39) Saravanan, P.; Dubey, V. K.; Patra, S. Chem. Biol. Drug Des. 2012, 79 (6), 1056–1062.
(40) Point, V.; Malla, R. K.; Diomande, S.; Martin, B. P.; Delorme, V.; Carriere, F.; Canaan, S.; Rath,
N. P.; Spilling, C. D.; Cavalier, J. J. Med. Chem. 2012, 55 (22), 10204–10219.
(41) Point, V.; Malla, R. K.; Carrière, F.; Canaan, S.; Spilling, C. D.; Cavalier, J.-F. J. Med. Chem.
2013, 56 (11), 4393–4401.
120
Chapter 4
Target Identification and Mechanism of Resistance of Fusidic Acid
Chapter overview
This chapter provides a summary of the target identification and mechanism of action studies of
fusidic acid in several organisms, with a brief overview of the function and structure of the known
target. The investigation of its target and subsequent validation are presented, in addition to
determination of its in vitro cross-resistance with other anti-TB agents.
4.1 The identification of distinct modes of action for the same molecule in different organisms.
TB chemotherapy only began in earnest in the 20th century, and majority of the first line anti-TB
chemotherapeutic agents were in clinical use decades before their modes of action were
established. For example, the mode of action of streptomycin (STM), the first drug that was used to
successfully cure a TB patient, was only established in the late 1950s despite being in use from the
early 1930s. Rifampicin (RIF) and isoniazid (INH), the mainstays of TB treatment since the 1960s, had
their mechanisms of action elucidated decades later. For instance, the bactericidal activity of INH
was only attributed to its inhibition of mycolic acid biosynthesis in the 1970s , and even then, the
true mode of action was only definitively elucidated much later.1,2 These discoveries were made
before the revolutions in genomics and molecular sciences, which enabled further (and often more
rapid) advances in drug target identification over the past 20 years.3,4
As highlighted in the previous chapter, with the growing awareness of polypharmacology, it is also
possible for a compound or drug to possess different molecular targets in different organisms. This is
the case with cyclomarin A (Figure 4.1), a naturally occurring cyclic peptide that inhibits the growth
of Plasmodium falciparum by inhibiting diadenosine triphosphate hydrolase (PfAp3Aase) whereas, in
Mtb, it targets the essential protease, ClpP.
121
Figure 4.1: Structure of cyclomarin A
This could be due to the fact that these two organisms are taxonomically unrelated, and
furthermore, the molecular targets of cyclomarin A are not essential for the viability of majority of
other organisms, due to redundancy of the genes that encode for these enzymes.5–7 Thus,
repositioning of even well-characterized anti-infectives should include identification of their target
or targets in the intended organism.
4.2 Mechanism of action of fusidic acid (FA)
FA is known to be a protein synthesis inhibitor in Gram-positive bacteria, inhibiting the translation
machinery, specifically the penultimate step in the elongation cycle, as well as ribosomal recycling.8
A recent study by Borg et al has uncovered deeper mechanistic understanding of its inhibitory
action.9 Protein synthesis can be divided into four steps: initiation, elongation, termination and
recycling. As illustrated in Figure 4.2 below, Elongation factor G (EF-G) is critical to the penultimate
elongation step, and is usually bound to Guanosine Triphosphate (GTP) in order to catalyse
translocation of the transfer RNA (tRNA) from the ribosomal A-site to the P-site.10
FA inhibits translocation of the tRNA from the A-site to the P-site by stabilizing the EF-G: Guanosine
Diphosphate (GDP) complex, preventing its release from the ribosome.8,10 It is presumed that the EF-
G:GTP complex binds to a defined site on the ribosome in the pre-translocation state. After
hydrolysis of GTP to GDP and inorganic phosphate (Pi), and consequent translocation, the EF-G:GDP
loses its affinity for the ribosome.11,12 Agrawal and colleagues used cryo-electron microscopy to
reconstruct fusidic acid-stalled EF-G:70S ribosome complexes, which delineate the binding site and
interaction mode of EF-G with the ribosome.13 These studies demonstrated that FA does not bind to
122
free EF-G, but rather to EF-G:GTP in complex with the ribosome, which implies that the antibiotic
requires a specific conformation of EF-G for binding.8 Thus, FA binding locks the ribosome in this
ternary complex, preventing the post-translocational conformation necessary for the next cycle of
elongation. Concomitantly, EF-G occupies the space on the ribosome, which overlaps with the
binding site of the elongation factor EF-Tu that is required for the amino acyl-tRNA delivery step.14
Several of the protein synthesis inhibitors listed in Figure 4.2 have antibacterial activity and are used
in the clinical management of a wide spectrum of infections, but lack activity against Mtb. These
include clindamycin, the macrolides erythromycin, neomycin and telithromycin, as well as
tetracyclines and chloramphenicol.15 Apart from their clinical or veterinary use in the treatment of a
wide spectrum of organisms, several of the inhibitors listed are relevant in TB drug discovery.
Interestingly, chloramphenicol (Cam) and tetracycline (Tet), which are used in the treatment of a
range of organisms, were shown to inhibit mycobacterial protein synthesis, but not growth, by Shaila
et al.16 This was attributed to poor permeability of the molecules across the cell wall. On the other
hand, paromomycin (Par) has been shown to possess in vitro and in vivo activity against Mtb,
including MDR-TB.17 The results of a clinical study by Donald and colleagues reported similar anti-TB
activity to STM.18
123
Figure 4.2: Antibiotic target sites during bacterial protein synthesis. Adapted from Wilson D. N.10
Initiation of protein synthesis involves the formation of a 70S ribosome (composed of a 30S and a 50S subunit) with the
initiator tRNA and start codon of the mRNA positioned at the P-site. This process is inhibited by the antibiotics edeine
(Ede), kasugamycin (Ksg), pactamycin (Pct) and thermorubin (Thb) on the 30S subunit, and by the orthosomycins,
avilamycin (Avn) and evernimicin (Evn), as well as thiostrepton (Ths) on the 50S subunit. The elongation cycle involves the
delivery of the aminoacylated-tRNA (aa-tRNA) to the A-site of the ribosome by elongation factor Tu (EF-Tu), which is
inhibited by Streptomycin (STM), tetracyclines (Tet) and glycylcyclines (tigecycline (Tig)). Peptide-bond formation between
the A- and P-site tRNAs is inhibited by blasticidin S (Bls), chloramphenicol (Cam), lincosamides (e.g., clindamycin (Cln)),
oxazolidinones (e.g., linezolid (Lzd)), pleuromutilins (Plu), puromycin (Pmn), streptogramin A (SA) and sparsomycin (Spr).
Translocation of the tRNAs is catalysed by EF-G and inhibited by the tuberactinomycins, capreomycin (Cap) and viomycin
(Vio); the aminoglycosides, hygromycin B (Hyg), neomycin (Neo) and paromomycin (Par); as well as fusidic acid (FA),
Spectinomycin (SPEC) and Ths. Elongation of the nascent chain is inhibited by the macrolides (e.g., erythromycin (Ert)),
streptogramin B (SB) and ketolides (e.g., telithromycin (Tel)). The final phases of termination and recycling lead to release
of the polypeptide chain and subsequent dissociation of the 70S ribosome, followed by recycling of the components for the
next round of initiation. Termination is inhibited by peptidyl-transferase inhibitors, such as Bls, Cam, Pmn and Spr, whereas
recycling is inhibited by translocation inhibitors, especially FA.
124
The tuberactinomycins, viomycin (Vio) and capreomycin (Cap) were identified as active against
multidrug-resistant tuberculosis in the 1950s.19–21 Streptomycin (STM) and Cap were advanced to
clinical use, and form part of the WHO standard regimens for MDR-TB.22
Following the successful treatment of XDR-TB in a small cohort of patients in a study by Lee et al,
linezolid (Lzd), a bacteriostatic antimicrobial, has garnered interest in TB drug discovery in recent
years.23,24 It is regarded as a “drug of last resort” in the treatment of Gram positive infections, mainly
vancomycin-resistant Enterococci (VRE) and Methicilllin-resistant Staphylococcus aureus (MRSA).25
The repurposing of Lzd underpins not only the continued relevance of drug repositioning in drug
discovery for drug-resistant TB, but also the usefulness of bacteriostatic antimicrobials. SPEC has
moderate in vitro activity against Mtb, and the encouraging development of novel spectinamide
analogues with potent in vitro activity and excellent in vivo profile in a mouse model of infection
show promise for drug-resistant TB.26
In addition to translocation inhibition, FA has been shown to inhibit ribosome recycling, which is
required for the release of the nascent polypeptide and therefore for the next round of initiation. In
fact, earlier reports reported that along with blasticidin S, another antibiotic, it has been shown to
be a more potent recycling inhibitor, with an IC50
in the ranges of ~0.1–15 μM for inhibition of
subunit dissociation, whereas its IC50 for inhibition of translocation is in the range of 10 –200 μM.8,10,
27,28 More recent studies by Borg et al have shown that FA’s inhibitory action is more nuanced,
ultimately dominated by the inhibition of elongation, but that its inhibition of ribosome recycling
may play a role in encoding FA resistance.9,29
4.2.1 Antiprotozoal mode of action of FA
FA has been shown to inhibit growth of the blood stage of the protozoan Plasmodium falciparum
which causes malaria.30 P. falciparum has two genome-containing organelles, the mitochondrion and
the relic plastid (apicoplast), the latter being a non-photosynthetic organelle unique to organisms
belonging to the phylum Apicomplexa. Several apicoplast pathways are critical for the blood and
liver stages of the parasite’s life cycle in the human host, and so have been studied as potential drug
targets.
As in bacteria, FA is a known inhibitor of the plasmodial translation machinery, targeting both
mitochondrial and apicoplast EF-G, albeit differentially, showing higher sensitivity in apicoplast EF-G.
This is partly attributable to a conserved GVG motif found in the critical GTP-binding domain (I) of
most other pro and eukaryotic EF-G that is absent in plastid/apicoplast EF-Gs. Additionally, FA has
also been found to inhibit ribosomal recycling in both the mitochondrion and the apicoplast.31,32
125
4.3 Elongation Factor G (EF-G): Function and structure
4.3.1 Function
EF-G is a member of the translational GTPase (trGTPase) superfamily whose bacterial members are
associated with diverse biological roles. It performs ribosome-dependent hydrolysis of GTP and is
involved in two distinct steps of protein synthesis: elongation and ribosome recycling. During the
elongation step, EF-G binds the ribosome and promotes the movement of tRNA and mRNA relative
to the ribosome. The relative shift of the mRNA is by a distance of one codon and the peptidyl- and
deacylated-tRNAs are shifted from the pre-translocational to the post-translocational site. Unlike
other GTPases, EF-G is active in the GDP-bound form and not in the GTP-bound form; that is, in a
kinetically stable ribosome–EF-G:GDP complex formed by GTP hydrolysis on the ribosome. During
the recycling step, EF-G acts in concert with the ribosome recycling factor (RRF) to effect the
dissociation of the ribosome into its individual subunits.33
Most of the functional characterization of this essential factor has been carried out by heterologous
expression in E. coli, whereas the majority of crystal structure elucidation studies have been
performed on EF-G from Thermus thermpohilus;34 even fewer studies have reported detailed
structures of E. coli EF-G in complex with FA.35–38
4.3.2 Structure
Early biochemical evidence indicated that EF-G is a multi-domain GTPase, an observation which has
been confirmed by crystallographic data.39–43 EF-G consists of five structurally well-defined domains
(Figure 4.3). The first G or GTPase domain binds and hydrolyses GTP and is common to all P-loop
GTPases (a structural class to which EF-G belongs), and so is highly conserved across different
species. It contains five typical motifs for GTP recognition – G1 to G5 – which form the GTP-binding
pocket. Within the G domain is a region termed the G’ insert, speculated to be an internal guanine
nucleotide exchange factor. Little information exists on the specific function of domain II. Domains
III, IV and V mimic amino acyl-tRNA when it is bound to EF-Tu:GTP in the ternary complex. Domain III
has been shown to be essential for the induction of GTP hydrolysis and subsequent translocation,
while domains IV and V are required for translocation but not for GTP hydrolysis.
126
Figure 4.3: Crystal structure of T. thermophilus EF-G from Margus et al. 41 The left panel indicates the
ribosome side of EF-G while the right column shows the opposite side, following a 180o rotation
about the y-axis. The numbers indicate the highly conserved amino acid residues, relative to
T.thermophilus.
Several studies have demonstrated that FA permits ribosome-stimulated GTP hydrolysis by EF-G, but
prevents the associated conformational changes in EF-G, and so inhibits EF-G turnover by stabilizing
EF-G:GDP on the ribosome.42 By binding at the interface of domains I and III, FA could restrict the
movement of these domains relative to each other, preventing EF-G from adopting the low affinity
GDP-bound conformation required for dissociation of the complex from the ribosome. Figure 4.4
illustrates the inhibitory effect of FA on the translocation process.43 In addition, two recent studies ,
one by Li and colleagues44, and another by Koripella et al45, have further delineated the activity of
EF-G by demonstrating that several mutations in a highly conserved amino acid residue, Histidine 91,
do not cause defects in intrinsic GTP hydrolysis, but lead to varying levels of defective ribosome-
associated GTP hydrolysis by EF-G due to conformational changes.
127
Figure 4.4: Translocation on the ribosome and the inhibitory effect of FA. Adapted from Frank et al.36
4.3.2.1 EF-G Homologue: EF-G2
EF-G was believed to exist exclusively in a single form as a bi-functional protein until recently, when
two genes (hEFG1 and hEFG2) encoding two different forms of EF-G were discovered in mammalian
mitochondria.46,47 An analysis of 191 bacterial genomes in a study of ribosomal associated GTPases
resulted in the identification of a second copy of EF-G in up to 30% of the bacterial strains
analysed.48 The second form of EF-G (EF-G2) has been isolated from several organisms and analysed
for activity. EF-G2 from T. thermophilus shows ribosome-dependent GTPase activity, with little
GTPase activity in the absence of ribosomes. It has a low level of activity in poly(U)-dependent
protein synthesis but its role in ribosome recycling is yet to be elucidated. EF-G2 isolated from M.
smegmatis was assayed for ribosome-dependent GTPase activity and ribosome recycling; neither
was observed, indicating a lack of ability to function in either of the roles of EF-G under the
conditions studied. Only in Borrelia burgdorferi (B. burgdorferi) and Pseudomonas aeruginosa (P.
aeruginosa) has the activity of both forms of EF-G been studied in depth.33,49 B. burgdorferi EF-G1
was found to act exclusively in translocation while EF-G2 was shown to function solely in ribosome
128
recycling, as is the case in human mitochondrial EF-G1 and EF-G2.49 In P. aeruginosa, EFG-1B, a form
of EF-G1, was found to be the sole translocase, while EFG1A (also a form of EF-G1) was surmised to
be responsible for ribosome recycling.33
Multiple sequence alignment of E-FG and EF-G2 from representative organisms by several groups
have revealed a wide variation in sequence homology; a high degree of homology between the EF-
G1 sequences, a slightly less uniform degree of homology between EF-G2 across these organisms
and lowest homology between EF-G and EF-G2 within the same organism. Importantly, regions of
sequence involved in GTP binding and hydrolysis are most strictly conserved between the two forms
of EF-G.50 Table 4.1 summarises the homology levels across several organisms.
Table 4.1: Sequence homology between EF-G and EF-G2 among several species50
Species comparison % homology
EF-G: Msm vs Mtb 83
EF-G: E. coli vs Tth 60
EF-G: Msm/Mtb vs E.coli/Tth 57-60
EF-G2: Msm vs Mtb 78
EF-G2: Msm vs Tth 33
EF-G2: Mtb vs Tth 36
Msm/Mtb EF-G vs EF-G2 30
Tth EF-G vs EF-G2 36
EF-G is encoded by the fus gene, which is located in the str operon that also contains genes encoding
two other ribosomal proteins, S7 and S12, along with a tuf gene, which encodes Elongation Factor
Tu (EF-Tu), a protein also involved in the elongation phase of protein synthesis.33 In the case of Msm,
earlier annotations in the NCBI database showed sequences corresponding to MSMEG_1400 and
MSMEG_6535 as EF-G and EF-G2 respectively. In current listing (also in the smegmalist database),
MSMEG_1400 is annotated as a pseudogene while MSMEG_6535 is annotated as the main
functional EF-G. Experimentally, however, Seshadri and co-workers observed that MSMEG_1400
encodes a functional EF-G, while MSMEG_6535 encodes EF-G2. In this study, we retained the earlier
annotations for these genes.50
129
4.3.2.2 Mtb EF-G
Genetic analysis of the Mtb genome predicted the presence of two forms of EF-G: EF-G1 (fusA1) and
EF-G2 (fusA2).51,52 Mtb fusA1 has previously been expressed in E. coli to study its interaction with
Mtb ribosome recycling factor (RRF)53, but, to date, there are no published reports of its GTPase
activity. Furthermore, the putative protein synthesis activity has not been evaluated in a biochemical
assay. The M. smegmatis homologues MsmfusA1 and MsmfusA2 have been expressed, purified and
evaluated in vitro, validating an earlier report by Martemyanov and co-workers that fusA2 does not
possess GTPase activity, but is capable of binding GTP.43,50
Although it might be inferred from these data that FA inhibits Mtb in a similar manner, there are no
published reports to support this. As already demonstrated, drugs may have distinct modes of action
in different organisms and, moreover, possibly more than one mode of action. In addition, as
observed for FA, mechanisms of resistance to the same drug may vary depending on the pathogen
and the nature of infection.54
4.4 Resistance to FA
4.4.1 In vitro resistance
In vitro resistance to FA in S. aureus strains has been selected for by the application of drug pressure
and mutations identified in fusA, the gene which encodes EF-G.43,55,56 Both low- and high-level
resistance have been achieved, with MIC50 and MIC90 values ranging from 1 g/ml to 132 g/ml.
57Analysis of mutations from the numerous resistant mutants revealed that high-level resistance
mutations cluster in two main regions of EF-G, at the interface between domains I and III. In most
cases reported, these were single amino acid substitutions. It was also noted that these mutations
did not confer a fitness cost on the bacteria, as assessed by doubling times in vitro.
As mentioned above, FA binding results in a conformation that locks the EFG:GDP complex on the
ribosome; therefore, mutations within this region possibly either facilitate the conformational
changes in EF-G required for dissociation from the ribosome (despite the presence of the drug), or
may simply prevent the drug from binding to EF-G.43 Evidence supporting this can be inferred from
studies such as that by Martemyanov and co-workers, who reported that EF-G lacking domain III
resulted in a 103-fold decrease in GTPase activity, but was able to bind to the ribosome in the
presence of the GDP or GTP and FA.43,58
130
In addition to mutations within fusA, other resistance-conferring determinants have been identified
in recent years. These are described in the context of in vivo resistance to FA, owing to their clinical
relevance.
4.4.2 In vivo resistance
Resistance to FA was reported as early as the 1970s, but the frequency of reports remained low,
with rates approximately 1-2 % in the early 1990s even in countries which employed FA extensively.
However, in the past two decades, there has been an increase in the prevalence of FA-resistant (FAR)
clinical isolates of staphylococcal species, including methicillin-resistant S. aureus (MRSA). Evidence
of this is found in numerous published reports of surveillance studies that have been conducted in
hospitals across various European countries, Malaysia, and the United States of America.59–64 For
example, one study of MRSA isolates collected over a 2-year period in Denmark reported that 17.6%
were FA-resistant.59,61 FA monotherapy has been strongly associated with the emergence of
resistance among both methicillin-resistant and susceptible S. aureus.
Previously, FA resistance was thought to be exclusively due to spontaneous chromosomal mutations
in fusA. However, in recent years, there have been published reports from extensive studies that
examined the relative prevalence of different FAR mechanisms, the genetic elements that carry
them, and the relative importance of clonal expansion of FAR strains versus horizontal dissemination
of these determinants. These additional resistance determinants, which have been designated as
fusB-type resistance determinants, include fusB-E. In fact, the predominant mechanism of clinical
FAR in S. aureus is the horizontal acquisition of determinants that encode FusB-type proteins.57,59 The
spread of FAR MRSA in particular regions of Europe has been attributed in part to clonal expansion of
community-acquired clones.60,61
Members of the FusB family, the best studied of which is FusB itself, are small (~25 kDa) proteins
that bind EF-G with a 1:1 stoichiometry and protect it from the inhibitory effect of FA. X-ray
crystallographic studies have determined the 3D structures of two representatives of the FusB
family, revealing a two-domain protein with an unusual zinc-binding fold in the C-terminal domain.
Using NMR to elaborate the structure of the EF-G:FusB complex, Tomlinson and co-workers
demonstrated that the C-terminal domain is the primary site of interaction of FusB with EF-G.62,63
Moreover, they showed that through direct interaction with EF-G, FusB promotes disassembly of the
FA-stalled post-translocation complex, thus enabling the elongation cycle to proceed. Guo et al
postulated that FusB rescues FA inhibition by facilitating dissociation of the FA-EF-G-ribosome
complex, in a study where they demonstrated that FusB can rescue both FA inhibition of
131
translocation and ribosome recycling.28 The ability of FusB to drive EF-G release explains why it
mediates resistance to FA. How FusB might achieve this effect has not been conclusively
established.62 A model by Cox and co-workers (Figure 4.5) illustrates the hypothesised mechanism of
FusB-type mediated resistance to FA.64
Figure 4.5: Schematic of the proposed mechanism of FA resistance mediated by FusB-type proteins,
Adapted from Cox et al.64 (A) EF-G catalyzes translocation in a reaction driven by the hydrolysis of GTP. (B) In the
presence of FA, the drug immobilizes EF-G·GDP complexes on the ribosome, sterically blocking the next stage of translation
and stalling protein synthesis. (C) FusB-type proteins compete with the ribosome for binding to EF-G, thereby destabilizing
the ribosome:EF-G:GDP:FA complex and prompting its dissociation; FA cannot bind to EF-G when the latter is not resident
on the ribosome, and will spontaneously dissociate once the complex has been dislodged from the ribosome. (D)
Dissociation of the EF-G·GDP·FA complex clears the ribosomal A site, allowing entry of the next incoming aminoacyl-tRNA
molecule, and translation resumes.
FusC has been detected in clinical strains of S. aureus that lack a mutation in fusA and fusB, while
FusD is the Staphylococcus saprophyticus homologue of FusB, conferring intrinsic resistance of this
organism to FA. Given that S. saprophyticus is unlikely to encounter antibiotic, and that the genes
encoding this protein are chromosomally located, it is speculated that the FusB homologues play an
as yet unknown role in housekeeping.59 It is plausible that the recruitment of one or more FusB
132
homologues from intrinsically resistant organisms into S. aureus may have occurred over time due to
selective pressure exerted by use of FA.
Interestingly, to date, no clinical strains harbouring mutations in both fusA and fusB have been
detected, implying that a combination of the two resistance genotypes is unlikely to confer high
level resistance to FA, and that emergence of resistant clinical strains bearing both resistance
determinants is an unlikely scenario. O’Neill and colleagues demonstrated that introduction of fusB
into S. aureus strains expressing low-level FAR did not elevate the level of FAR .57
4.4.3 Evaluation of the fitness cost of FAR
Resistance mutations in bacteria are associated with pleiotropic effects, which may include reduced
fitness of the resultant strains. It is important to consider the extent to which antibiotic resistance
determinants impose a fitness cost on the bacterium. A strain’s fitness reflects its robustness in the
face of adaptation to mutations, environmental and internal changes, allowing it to survive,
reproduce, and, in the case of pathogenic bacteria, retain virulence.65 From a mechanistic
perspective, fitness deficit can be attributed to the fact that these mutations target vital biological
processes, or alternatively, that the energy cost of resisting antimicrobial attack depletes resources
normally devoted to important cellular functions.66 Although many studies have demonstrated
associated fitness cost for the acquisition of antimicrobial resistance, some resistance-conferring
mutations have been shown to have low or no fitness deficit.67 Antibiotic resistance can result in
secondary mutations to abrogate such costs, as has been reported for in vitro strains of FA-resistant
S. aureus.8,59 It would be beneficial to identify such fitness costs in Mtb, as they may have
implications on in vivo growth rate, virulence and transmissibility.
Factors that affect fitness either independently or in combination include: selective drug pressure,
environmental changes, genotype of the strain and stress induced by competing strains.65 Due to the
multiple correlates and effects, fitness cost can be assessed in several ways, and there has been no
resolution on what method is best. Relative fitness is defined as the ability of a genotype or
individual to survive and reproduce in the presence of a second genotype or individual.66 It is often
determined by competition experiments between isogenic antibiotic-susceptible (wild-type) and
antibiotic-resistant (mutant) bacteria in culture. Competition experiments are based on the
assumption that competing strains don’t affect each other and compete only by intrinsic growth rate
and efficiency in utilizing nutrients.65 In this study, we applied two routinely used methods of
assessment: growth rate in liquid culture (comparing the doubling times of the wild-type and mutant
strain) and relative fitness.
133
4.5 Validation of targets using target-based whole cell screening
As demonstrated by the case of RIF and INH in section 4.1, identification of the target of a
compound or chemical scaffold with antimycobacterial activity is not essential for subsequent stages
of drug discovery and development. However, knowledge of the target can facilitate the
optimization of pharmacological and pharmacokinetic properties of such compounds or compound
classes.68 In the case of drug repositioning, since there is putative knowledge of the drug target,
often, a reverse engineering approach to in vitro target identification and validation is employed.
Typically, this is achieved through the use of chemical genomics, often a combination of techniques,
including the isolation and sequencing of resistant mutants, whole genome transcriptional profiling,
and assays of macromolecular synthesis such as RNA, protein, DNA, and fatty acids. Subsequently,
the target(s) identified is/are validated through targeted gene modulation.69 Target-based whole cell
screening (TB-WCS) is applicable in such instances, since analogues of the parent drug can serve as
chemical probes to validate the target of interest.
A well-established strategy in TB-WCS involves the use of tetracycline (Tet) – regulatable promoter
elements to generate mutants that conditionally express the target or targets of interest. This can be
achieved through two configurations- Tet-ON, where addition of Tet induces gene expression, and,
consequently, increased levels of the target; or Tet-OFF, in which addition of Tet represses gene
expression, resulting in depletion of the target.70,71 TB-WCS using conditional knockdown (cKD)
mutants of Mtb hypersensitised to target- and pathway-specific inhibitors have been used in the
search for novel antimycobacterial chemical scaffolds for TB drug discovery, and also in the
validation of targets of interest.72–74 A recent example is the validation of CoaBC as a cidal target in
the Coenzyme A pathway of Mtb by Evans and co-workers.75
134
4.6 Aims and objectives
Against this background of information on FA with respect to S. aureus, and, given that Mtb lacks
plasmids, it is likely that resistance to FA is driven by mutations in the chromosomal genes. The aim
of this study was to identify the mechanism of action (MoA) and plausible mechanisms of resistance
(MoR) to FA in Msm and Mtb. The specific objectives were:
1. To generate spontaneous resistant mutants by selective drug pressure, with subsequent
whole-genome sequencing (WGS) to identify causal mutations within the genomes of the
resistant isolates.
2. To validate the target of FA in Mtb by means of TB-WCS, using FA and selected analogues.
3. To determine potential fitness costs associated with the mutations identified. This was to be
carried out by growth comparison of the doubling time of FA-resistant strains against wild-
type strains and by competition assay.
4. To determine in vitro cross-resistance of FA with selected anti-TB agents and compounds in
development by determining the susceptibility of FA-resistant mutant strains to a panel of
approved and experimental compounds.
4.7 Identification of spontaneous resistant mutants and determination of frequency of mutation.
The frequency of FAR mutants of Msm and Mtb was determined by plating approximately 108 to 109
CFU/ml of logarithmic phase on standard solid medium (7H10 agar plates) containing various
concentrations of FA above the MIC in liquid medium. In the case of Msm, colonies were scored
after five to seven days, while for Mtb, four weeks. The spontaneous mutants arose at a frequency
of 1.0 x 10-8 in both cases. The colonies isolated underwent re-growth and exposure to FA to
establish a shift in MIC. For those that exhibited a significant MIC shift, genomic DNA was extracted,
amplified by Polymerase Chain Reaction (PCR) and subjected to targeted sequencing and whole
genome sequencing (only the Mtb isolate).
4.7.1 Results of MIC90 screening of putative FAR Msm mutants
An 8-fold shift in the MIC of FA (from 80.8 μM to 646.4 μM) was observed for one of the four
colonies isolated, while the remaining three colonies showed a 2-fold change in MIC, and were thus
not considered truly resistant isolates.
135
4.7.1.1 Sequencing results for Msm isolate
Genomic DNA was extracted from all four colonies isolated, and amplification of fusA1 (EF-G1) and
fusA2 (EF-G2) carried out by PCR. The amplicons were purified and subjected to targeted
sequencing, with reference to wild-type Msm mc2155. As no SNPs were identified, repeated
unsuccessful attempts at resistant mutant generation were made under varying conditions. Details
of the experimental conditions are described in Chapter 6.
4.7.1.2 Results of MIC90 screening of putative FAR Mtb mutants
Colonies arose at each of the various concentrations of FA at a frequency of 1 x10-8. The colonies
were screened against FA to determine their MIC90, with shifts observed in the range 2- to 32-fold
(Table 4.2). One of the colonies that arose at 20X MIC exhibited a 32-fold increase in MIC. This
isolate, designated GKFA, was selected for genomic analysis by targeted sequencing of MtufusA1,
the gene encoding Mtb EF-G, as well as WGS with H37Rv MA as the reference strain. The remaining
pseudoresistant isolates did not yield reproducible resistance after re-growth and re-exposure to FA.
Table 4.2: Results of MIC90 screening of putative FAR Mtb mutants
Colony ID and concentration of FA used for selection
MIC90 (M) in 7H9/OADC*
Fold shift in MIC*
Mtb H37Rv MA (wild-type) 5 -
GKFA (20X MIC) 160 32
SRM 2 (10X MIC) 10 2
SRM 3 (15X MIC) 10 2
SRM 4 (20X MIC) 10 2
SRM 5 (25X MIC) 20 4
SRM 6.1 (5X MIC) 5 1
SRM 6.2 (5X MIC) 5 1
*Data are representative of 2 biological replicates
136
4.7.1.3 Sequencing results for Mtb GKFA isolate
Whole genome sequencing of the FA-resistant Mtb isolate GKFA revealed a single nonsynonymous
SNP, which resulted in a H462Y substitution in fusA, similar to the result found in the targeted
sequencing of MtufusA1. This suggests that the mechanism of action of FA is by inhibition of EF-G,
and that mutations in the gene encoding for EF-G play a role in the in vitro resistance of Mtb to FA.
4.8 Fitness cost of the FA resistance-conferring mutation in Mtb
In order to determine the possible fitness cost associated with the H462Y mutation in fusA1, growth
kinetics of the mutant strain and wild-type were assessed during separate culture in liquid 7H9
medium as well as in competition. The growth kinetics of the two strains was comparable over 7
days (Graph 4.1). In the competition assay adapted from Bhatter et al, a value of 0.9 was obtained,
where values less than 1 indicate fitness cost in the absence of the antibiotic, 1 indicates no cost,
and values greater than 1 indicate benefit in the absence of the antibiotic.65,66 Thus, relative to the
wild-type, the FAR showed little cost.
Day
OD
60
0
Graph 4.1: Growth curve of wild-type Mtb and FA-resistant mutant strain Mtb GKFA. Data
are representative of 3 biological replicates. The strains were measured in duplicate; the
errors represent values of the mean standard deviation.
137
4.9 Determination of the susceptibility of the GKFA isolate to selected FA analogues and
antituberculosis agents
Table 4.3: Results of selected MIC90 screening of FA against colonies isolated during resistant
mutant generation*
14-day 7H9/OADC MIC in µM against selected isolated colonies screened
Drug or
compound
H37Rv
MA GKFA SRM 2 SRM 3 SRM 4 SRM 5
SRM 6.1
SRM 6.2
FA 5 160 10 10 10 20 5 5
RIF 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01
KAN 3.12 3.13 1.56 1.56 1.56 1.56 1.56 1.56
EMB 1.56 0.78 1.56 3.13 1.56 1.56 1.56 1.56
Oflox 0.31 0.31 0.31 0.31 0.31 0.31 0.31 0.31
STM 20 5 2.5 20 20 20 2.5 2.5
INH 0.01 0.01 0.01 0.01 <0.01 0.01 0.01 0.01
GKFA54 80 160 80 80 80 160 80 80
GKFA17 5 >160 >160 >160 >160 >160 160 160
GKFA37 2.5 80 5 10 5 10 2.5 2.5
GKFA24 80 160 80 80 40 80 80 80
GKFA51 80 >160 160 160 80 160 80 80
KSFA44 >160 >160 160 >160 >160 >160 160 160
KSFA16 40 160 80 80 80 80 80 80
GKFA59 10 160 20 20 20 20 10 10
GKFA16 20 160 80 80 80 80 40 40
In addition to FA, selected analogues of FA, as well as a panel of standard antituberculosis drugs and
compounds in development were tested against wild-type and the GKFA strain of Mtb to identify
hyper susceptibility or hyper-resistance of this strain to selected compounds. Table 4.3 summarises
the 14-day assay results, carried out in standard 7H9 growth medium. This was carried out in order
to identify potential in vitro cross-resistance of FA with these compounds, due to the combinatorial
nature of anti-TB chemotherapy.
With the exception of STM, there were no differences in MIC of the compounds between wild-type
Mtb and the resistant mutant strain. This indicates a lack of in vitro cross-resistance between FA and
*Data are representative of 3 biological replicates
138
the standard first line anti-TB agents. The GKFA isolate was hyper resistant to the FA analogues
tested, most notably GKFA16, GKFA37 and GKFA59 (Figure 4.6), the three most potent compounds
against wild-type Mtb. STM showed a slight hypersensitivity, with 4 to 8-fold decrease in MIC against
4 of the 7 colonies screened.
Figure 4.6: Structures of selected FA analogues tested against putative Mtb FAR mutants
4.10 Validation of EF-G as the target of FA in Mtb: Evaluation of the effect of transcriptional
silencing of fusA on susceptibility of Mtb to FA and selected analogues
TB-WCS was used to validate EF-G as the target of FA in Mtb, using a Tet-OFF cKD mutant strain of
Mtb constructed by Dr. Vinayak Singh at the University of Cape Town. In this mutant strain,
supplementation of standard 7H9 medium with Tet caused transcriptional silencing of fusA,
subsequently depleting EF-G. This mutant strain was then tested for hypersensitivity to FA and
selected analogues (GKFA16, GKFA17, GKFA59; Figure 4.6) using an adaptation of the checkerboard
synergy assay reported by Ramón-García et al.76 This assay applies the broth microdilution method
to test combinations of two compounds across a range of concentrations in a 96-well format. The
susceptibility of the fusA cKD strain to FA and selected analogues was evaluated in 7H9 medium in
the absence (-ATc) or presence (+ATc) of a range of concentrations of ATc. RIF, whose MoA differs
from that postulated for FA, was also tested in order to rule out general hypersensitivity of the cKD
strain. In addition, the susceptibility of the cKD strain to STM, which had a 4-8 fold decrease in MIC
in the FAR Mtb strain, was also assessed. Bacterial viability was measured using the Microplate
Alamar Blue Assay (MABA), which is described in detail in Chapter 6.
139
4.10.1 Results of the effect of transcriptional silencing of fusA on susceptibility of Mtb to FA and
selected analogues
Using the cherckerboard assay, 2.5 ng/ml was determined as the lowest concentration of
anhydrotetracycline (ATc) that was sufficient for transcriptional silencing of fusA without inhibiting
Mtb growth. (Appendix 3). At this concentration, the fusA cKD strain exhibited strong
hypersensitivity to FA and the analogues; their MIC90 decreased by 32- and 64- fold shifts
respectively. There was no shift in the MIC of RIF, both in the presence and absence of ATc.
Interestingly, for STM, a 4-fold decrease in MIC of STM was observed. This was a similar result to
that obtained in the FAR Mtb strain GKFA.
Even in the absence of ATc, relative to wild-type (WT) Mtb, the fusA cKD strain showed
hypersensitivity to the FA analogues. The greatest hypersensitivity was observed for GKFA59, which
exhibited 8-fold higher potency in the cKD strain. RIF, on the other hand, showed no difference in
MIC between the two strains. Table 4.4 summarises the MIC90 of FA and selected analogues in the
fusA cKD strain in the absence (-ATc) or presence (+ATc, 2.5 ng/ml).
Table 4.4: MIC90 of FA, selected analogues and anti-TB drugs in fusA conditional knockdown strain
Drug/compound MIC in WT Mtb
µM
MIC in Tet-OFF
(-ATc) µM
MIC in Tet-OFF
(+ATc) µM
Fold shift in
MIC
FA 5 5 0.16 32
GKFA16 10 5 <0.16 >64
GKFA17 5 5 <0.16 >32
GKFA59 10 1.25 <0.16 >64
RIF 0.01 0.01 0.01 -
STM 20 5 5 4
140
4.11 Discussion
4.11.1 Msm results
Seshadri and co-workers generated fusA2 deletion mutants of Msm by allelic exchange in an
attempt to understand its functional relevance in mycobacteria, with heterologous expression of EF-
G2 in E.coli.50 Several pertinent findings arose from that study: EF-G2 is not essential for Msm
survival (under laboratory conditions); EF-G2 binds guanine nucleotides but does not possess EF-G-
like function: GTPase, ribosome recycling (in conjunction with ribosome recycling factor) and
translocation activities in Msm; Msm EF-G2 is upregulated in late stationary phase, similar to the
predicted expression pattern of Mtb EF-G2 from a micro-array based study, which also reported
upregulation of EF-G2 during starvation conditions.50,77 However, these authors were unable to
establish its exact biological significance in vitro or in vivo. In this study, the use of a heterologous
expression system for EFG-2 may have excluded the role of mycobacterium-specific factors or a
specific ribosomal or post-translational conformation required for its activity. Moreover, its
sequence homology with EF-G and EF-G2 with respect to the conserved G domain indicates that it
may play a role in protein synthesis.
Recent studies have shown that EF-G2 proteins are highly divergent in primary sequence, and
thought to be a duplication of EF-G1 early in prokaryotic evolution. This greater divergence in EF-G2
was illustrated by Margus and colleagues (Figure 4.8), who compared the domain and motif
conservation of EF-G1 and EF-G2.41 The highest conservation disparity between the two proteins is
observed in domains I, II and III, inviting supposition of difference in functionality of EF-G2. There
have been examples where gene duplication and a subsequent acquisition of new function have
been shown to be the most plausible explanation for the appearance of additional families.78 It is
tempting to speculate that, in the case of Msm, fusA1 and fusA2 may be paralogous genes, with the
gene duplication releasing EF-G from the constraints inherent to its dual functionality, enabling each
to become more specialized in distinct singular functions. In Msm, the two roles of EF-G, that is,
elongation and ribosome recycling, may each have been ascribed exclusively to one form following
gene duplication. Alternatively, the additional EF-G families may carry out auxiliary functions
required in specific phases of life or under certain environmental conditions. Under selective drug
pressure, EF-G2 may perform EF-G or “EF-G-like function”, rescuing protein synthesis in M.
smegmatis.
141
G2 G3
G4
G5
MsmEFG1_ 1 MA----------QKDVLTDLNKVRNIGIMAHIDAGKTTTTERILYYTGVNYKIGETHDGASTTDWMEQEQ 60
MtbEFG1_ 1 MA----------QKDVLTDLSRVRNFGIMAHIDAGKTTTTERILYYTGINYKIGEVHDGAATMDWMEQEQ 60
MsmEFG2_ 1 MADRTHSPAGNGSVPTAERPAAIRNVALVGPSGGGKTTLVEALLVAGGVLTRPGSVADGSTVCDFDEAEI 70
MtbEFG2_ 1 MADRVNASQGAAAAPTANGPGGVRNVVLVGPSGGGKTTLIEALLVAAKVLSRPGSVTEGTTVCDFDEAEI 70
Consensus_aa: MA............shhp..s.lRNhslht..stGKTThhE.lLhhs.l..+.Gphh-GsshhD@.E.Eb
Consensus_ss: hhhhhh hh eeeeee hhhhhhhhhhhhhhhhhh eee hhhhh
MsmEFG1_ 61 ERGITITSAAVTCFWNNNQINIIDTPGHVDFTVEVERSLRVLDGAVAVFDGKEGVEPQSEQVWRQADKYD 130
MtbEFG1_ 61 ERGITITSAATTTFWKDNQLNIIDTPGHVDFTVEVERNLRVLDGAVAVFDGKEGVEPQSEQVWRQADKYD 130
MsmEFG2_ 71 AQQRSVSLALASLSHNGIKVNLIDTPGYADFVGELRAGLRAADCALFVIAANETIDEPTKTLWQECNEVQ 140
MtbEFG2_ 71 RQQRSVGLAVASLAYDGIKVNLVDTPGYADFVGELRAGLRAADCALFVIAANEGVDEPTKSLWQECSQVG 140
Consensus_aa: [email protected]@hDFhsElc.sLRhhDtAlhVhstpEsl-..ocplWpptsph.
Consensus_ss: h eeeeeeeeeee eeeeeee hhhhhhhhhhhh eeeeeee hhhhhhhhhhhh
MsmEFG1_ 131 VPRICFVNKMDKLGADFYFTVRTIEERLGAKPLVIQLPIGAENDFIGIIDLVEMKAKVWRGETALGEKYE 200
MtbEFG1_ 131 VPRICFVNKMDKIGADFYFSVRTMGERLGANAVPIQLPVGAEADFEGVVDLVEMNAKVWRGETKLGETYD 200
MsmEFG2_ 141 MPRAVVITKLDHPRANYDAALTAAQEAFGDKVAPLYFPVGDGESCKGVVGLLTRTYYDYSG-----GTHT 205
MtbEFG2_ 141 MPRAVVITKLDHARANYREALTAAQDAFGDKVLPLYLPSGD-----GLIGLLSQALYEYAD-----GKRT 200
Consensus_aa: [email protected][email protected]
Consensus_ss: eeeeee hhhhhhhhhhhh eeeeeeeee eeee hhhhh ee
MsmEFG1_ 201 VEDIPADLADKAEEYRTKLLETVAESD--EALLEKYFGGEELSVDEIKGAIRKLTVNSELYPVLCGSAFK 268
MtbEFG1_ 201 TVEIPADLAEQAEEYRTKLLEVVAESD--EHLLEKYLGGEELTVDEIKGAIRKLTIASEIYPVLCGSAFK 268
MsmEFG2_ 206 ARPPDGSHDAAIAELRGSLIEGVIEESEDETLMERYLGGEEIDEAVLIADLEKAVARASFFPVIPVCSQS 275
MtbEFG2_ 201 TRTPAESDTERIEEARGALIEGIIEESEDESLMERYLGGETIDESVLIQDLEKAVARGSFFPVIPVCSST 270
Consensus_aa: h...s.s.s..h.EhRs.LlEslhEps..E.LhE+YhGGEpls.s.lb.slcKhhh.tph@PVlsstt.p
Consensus_ss: hhhhhhhhhhhhhhhhhhh hhhhhhhh hhhhhhhhhhhhh eeeeeee
MsmEFG1_ 269 NKGVQPMLDAVIDYLPSPLDVESVQGHVPGKEDEVISRKPSVDEPFSALAFKIAVHPFFGKLTYVRVYSG 338
MtbEFG1_ 269 NKGVQPMLDAVVDYLPSPLDVPPAIGHAPAKEDEEVVRKATTDEPFAALAFKIATHPFFGKLTYIRVYSG 338
MsmEFG2_ 276 GVGTLELLDIISRGFPAPPEHQLPEVFTPQG-APRKPLSCDPDGPLLAEVVKTTSDPYVGRVSLVRVFSG 344
MtbEFG2_ 271 GVGTLELLEVATRGFPSPMEHPLPEVFTPQG-VPHAELACDNDAPLLAEVVKTTSDPYVGRVSLVRVFSG 339
Consensus_aa: [email protected]@hG+lohlRV@SG
Consensus_ss: hhhhhhhhhhhh ee ee eeeeeeeeee eeeeeeeeee
MsmEFG1_ 339 VVESGSQVVNSTKG---------------------------KKERLGKLFQMHANKENPVERASAGHIYA 381
MtbEFG1_ 339 TVESGSQVINATKG---------------------------KKERLGKLFQMHSNKENPVDRASAGHIYA 381
MsmEFG2_ 345 TIRPDATVHVSGHFSAFTDTSGSHGAAAAADGSTHSHADHDEDERIGTLSFPLGKQQRPAPTVVAGDICA 414
MtbEFG2_ 340 TIRPDTTVHVSGHFSSF-----------FGGGTSNTHPDHDEDERIGVLSFPLGKQQRPAAAVVAGDICA 398
Consensus_aa: hlcssspVhsts+............................ccERlG.L.b.htppppPh..hsAGcIhA
Consensus_ss: ee eeeee eeeeeeeeeee eeee ee eee
MsmEFG1_ 382 VIGLKDTTTGDTLCDPNEQIVLESMTFPDPVIEVAIEPKTKSDQEKLGTAIQKLAEEDPTFKVHLDQETG 451
MtbEFG1_ 382 VIGLKDTTTGDTLSDPNQQIVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDSETG 451
MsmEFG2_ 415 IGRLSRAETGDTLSDKTDPLVLRPWTMPDPLLPIAVAPRAKTDEDKLSVGLQRLAAEDPTLRIEQNPETH 484
MtbEFG2_ 399 IGKLSRAETGDTLSDKAEPLVLKPWTMPEPLLPIAIAAHAKTDEDKLSVGLGRLAAEDPTLRIEQNQETH 468
Consensus_aa: l..LpchpTGDTLtD.sp.lVLcshThP-Pll.lAl.s+hKoDp-KLthtl.+LA.EDPTh+lcbs.ET.
Consensus_ss: ee eeeeeee eeeeeeee hhhhhhhhhhhhhhhhh eeeeeee
MsmEFG1_ 452 QTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYRETIKRKVEKVEYTHKKQTGGSGQFAKVLIDLEP 521
MtbEFG1_ 452 QTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYKETIKRLVQNVEYTHKKQTGGSGQFAKVIINLEP 521
MsmEFG2_ 485 QIVLWCMGEAHAAVVLDALSRRYGVSVDTVELRVPLRETFAGKA-TGHGRHVKQSGGHGQYAVCDIEVEP 553
MtbEFG2_ 469 QVVLWCMGEAHAGVVLDTLANRYGVSVDTIELRVPLRETFAGNA-KGHGRHIKQSGGHGQYGVCDIEVEP 537
Consensus_aa: [email protected][email protected]
Consensus_ss: eeeeeee hhhhhhhhhhhhhh eeee eeeeeeee eeeee eeeeeeee
MsmEFG1_ 522 FVGEDGATYEFENKVTGGRIPREYIPSVDAGAQDAMQYGVL--AGYPLVNLKVTLLDGAYHEVDSSEMAF 589
MtbEFG1_ 522 FTGEEGATYEFESKVTGGRIPREYIPSVDAGAQDAMQYGVL--AGYPLVNLKVTLLDGAYHEVDSSEMAF 589
MsmEFG2_ 554 LPE--GSGFEFVDKVVGGAVPRQFIPSVEKGVRAQMEKGVTGESGYPVVDIRVTLFDGKAHSVDSSDFAF 621
MtbEFG2_ 538 LPE--GSGFEFLDKVVGGAVPRQFIPNVEKGVRAQMDKGV--HAGYPVVDIRVTLLDGKAHSVDSSDFAF 603
Consensus_aa: [email protected]@IPsV-.Ghps.MpbGV...tGYPlVsl+VTLhDG.hHpVDSS-hAF
Consensus_ss: eeeeeeeee hhhhhhhhhhhhhhh eee eeeeeeeeeeeeee hhh
MsmEFG1_ 590 KVAGSQALKKAAQAAQPVILEPIMAVEVTTPEDYMGEVIGDLNSRRGQIQAMEERS-GARVVKAQVPLSE 658
MtbEFG1_ 590 KIAGSQVLKKAAALAQPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERA-GARVVRAHVPLSE 658
MsmEFG2_ 622 QMAGALALRDAAAATKINLLEPVDDVTIVVPDDLVGTIMGDLSGRRGRVLGTDKHDADRTVIKAEIPEVE 691
MtbEFG2_ 604 QMAGALALREAAAATKVILLEPIDEISVLVPDDFVGAVLGDLSSRRGRVLGTETAGHDRTVIKAEVPQVE 673
Consensus_aa: phAGtbhL+cAA.hhp..lLEPl..lplhhP-DhhG.lhGDLstRRGplbth-p.s.s.pVl+AplPbsE
Consensus_ss: hhhhhhhhhhhhhh eeeeeeeeeeeee hhhhhhhhhhhhh eeeeeeee eeeeeeee hhh
MsmEFG1_ 659 MFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIAKATGQ 701
MtbEFG1_ 659 MFGYVGDLRSKTQGRANYSMVFDSYSEVPANVSKEIIAKATGE 701
MsmEFG2_ 692 LVRYAIDLRSMSHGAGQFRRSFARYEPMPESAAARLRTSA--- 731
MtbEFG2_ 674 LTRYAIDLRSLAHGAASFTRSFARYEPMPESAAARVKAGAG-- 714
Consensus_aa: [email protected]...
Consensus_ss: h hhhhhhhh eeeeeeee eee hhhhhhhhhh
Figure 4.7: Sequence alignment of EF-G and EF-G2 from Mtb and Msm (generated using PROMALS3D)
Accession numbers for the sequences: MsmEFG1: AFP37835 NCBI; MsmEFG2:YP_890748.1 NCBI;
MtbEFG1: CCP43427 NCBI; MtbEFG2: CCP4285 NCBI
I II
III II
III IV
I
IV V
V IV
B
A
142
Figure 4.8: Domain conservation comparison between EF-G and EF-G2. Adapted from Margus et al.41
4.11.2 Mtb result
Mutations conferring in vitro and in vivo (from clinical isolates) resistance to FA have been mapped
in EF-G from several organisms: T. thermophilus, S. typhimurium and S. aureus and Pseudomonas
aeruginosa.33,43,55,56,79–83 Chen and co-workers analysed and classified all fusA-based mutations as
affecting: (i) FA binding: modification of the drug binding site with resultant decreased affinity for FA
(ii) EF-G conformation (iii) EF-G stability: altered interaction between EF-G and the ribosome.
Reiterated by Johansson et al in an earlier study, these factors contribute directly or indirectly to FA
resistance.83,84 FA binds to ribosome-bound EF-G in a pocket between domains II and III and the
switch II region of the G domain40, which are the most highly conserved regions across several
organisms (Figure 4.9). Several amino acid residues in T. thermophilus EF-G identified as interacting
with FA in crystallographic studies by Gao and co-workers are largely conserved across EF-Gs
examined, and substitutions in these residues have been associated with FA resistance.40 Further
corroboration of this was provided by Besier and co-workers who established a causal relationship
between several amino acid substitutions and FA resistance by introducing previously reported
amino acid substitutions into FA-susceptible S. aureus, which subsequently exhibited corresponding
levels of FA resistance.55 One of these mutations, H457Y, reported previously, both in vitro and in
vivo, putatively alters the surface in the FA-binding pocket, leading to alterations in drug binding.55 A
study by Ramakrishnan et al also identified His 458 in T. thermophilus as a corresponding conserved
residue to the His 462 in Mtb EF-G.85These findings corroborate the result in this study, that the
H462Y substitution leads to FA resistance. Thus, the FA resistance observed in the GKFA Mtb isolate
may be due to an altered drug binding pocket within the target.
143
Salient insights from the studies into the molecular basis of FA resistance include: a single amino
acid substitution mutation is necessary and sufficient to confer resistance to FA, and that different
amino acid exchanges at the same site may lead to different levels of FA resistance. It is imperative
that we generate more FA-resistant mutant Mtb strains, in order to study the scope of possible sites
of mutation within the gene and to determine potential fitness cost-mediating mutations.
The low-level increase in sensitivity of the FA-resistant strain to STM may be attributed to synergistic
inhibition of protein synthesis. Like FA, strep is a translation inhibitor, acting at the initiation step,
inhibiting Elongation Factor Tu (EF-Tu) which delivers the amino-acylated tRNA to the A-site of the
ribosome (Figure 4.2). The mutation harboured by the GKFA isolate may, in addition to altering drug
binding, also alter the function of EF-G, resulting in reduced elongation cycles compared to wild-type
(inferred from the absence of other potential fitness cost-mediating mutations within fusA).
Subsequent inhibition of initiation by STM may lead to further repression of protein synthesis,
manifested as hypersensitivity to the drug. This is supported by evidence from our lab (unpublished
data) where in vitro synergistic screening of FA with known drugs has shown synergistic effect with
other translation inhibitors (unpublished). This is not surprising, as Johanson and Hughes reported
that, compared to wild-type S. typhimurium, FA-resistant strains exhibited low-level sensitivity and
resistance to SPEC and KAN respectively.86 In addition, Macvanin and Hughes reported increased
susceptibility of a FAR strain of Salmonella enterica serovar Typhimurium to RIF and chloramphenicol
as well as selected antibiotics under the following classes: -lactams, aminoglycosides and
fluoroquinolones.87 Like FA, they are both translation inhibitors, with SPEC acting as a translocation
inhibitor, while KAN causes mistranslation in addition to inhibiting translocation.
The growth rates of the two strains in separate liquid cultures were comparable, and in the
competition assay, a relative fitness of 0.9 indicated that H462Y is a no-cost FAR mutation. This is
consistent with the finding of Melnyk et al, who reported a mean relative fitness of 0.8 for several
FAR strains of S. typhimurium, and concluded that resistance to fusidanes are no-cost mutations.66
Tet repression of fusA in a mutant strain led to strong hypersensitivity to FA and selected analogues,
thus confirming that these compounds inhibit Mtb growth by targeting EF-G. This effect was specific
to this class of compounds, as RIF, which inhibits RNA transcription, did not elicit a similar phenotype
in the knockdown strain. The 4-fold increase in potency of STM in the FAR strain was mirrored in the
knockdown, providing further evidence of its synergistic activity in inhibiting Mtb translation
machinery.
4.12 Summary
144
Repeated attempts at generating FAR strains of M. smegmatis proved unsuccessful. The inability to
raise spontaneous FA-resistant mutants in this study may be attributed to the unknown biological
role of EF-G2. EF-G was validated as the target of FA in Mtb, via resistant mutant selection and
whole genome sequencing. The resistant mutant strains arose at a frequency of 10-8, corresponding
to the frequency observed in naturally-occurring FA-resistant S. aureus. A substitution mutation in
the genome encoding gene fusA1 resulted in high-level in vitro resistance to FA, but did not affect
growth kinetics. The resulting mutated residue, located in a region in domain III conserved across EF-
G and EF-G2 in both Msm and Mtb, is conserved across several organisms of clinical relevance. To
date, there are no published reports of FA-resistant mutants of Mtb, although a corresponding
substitution mutation has been reported in both in vitro and clinical strains of S. aureus, H457Y, that
exhibited high level FA resistance. This mutation putatively alters the drug-binding pocket of EF-G.
Furthermore, the mutation is selective for FA and selected FA analogues, as no cross-resistance was
observed when tested against a panel of first and second-line anti-TB agents and compounds in
development.
A slight increase in susceptibility (4 to 8-fold decrease in MIC) of the FA-resistant strain to STM was
observed, which may be due to synergistic inhibition of protein synthesis because, like FA, STM is a
translational inhibitor.
A knockdown strain underexpressing EF-G was used to conduct target-based whole cell screening of
FA and three analogues, with consequent hypersensitivity observed for these compounds. This
effect was not observed with RIF, a transcriptional inhibitor, providing further confirmation of EF-G
as the target of FA in Mtb.
It would be useful to isolate more resistant mutants in order to identify other causal mutations of
FAR within the Mtb genome, as the evidence from clinical isolates of other organisms suggests a wide
scope of the mutations that lead to FAR. This information in turn, can be used to map mutational
“hotspots” as has been done for the standard anti-TB drugs such as RIF and INH.88–92 From the
existing knowledge of the effects of mutations on FA binding, coupled with structural information,
this could potentially guide structure-based design of FA analogues that can overcome the potential
inhibitory effects of the known resistance mutations.
4.13 References
145
(1) Kolyva, A. S.; Karakousis, P. C. In Understanding Tuberculosis – New Approaches to Fighting Against Drug Resistance; Cardona, P.-J., Ed.; 2012.
(2) Vilchèze, C.; Jacobs, Jr., W. R. Annu. Rev. Microbiol. 2007, 61 (1), 35–50.
(3) Lechartier, B.; Rybniker, J.; Zumla, A.; Cole, S. T. EMBO Mol. Med. 2014, 6 (2), 158–168.
(4) Ioerger, T. R.; O’Malley, T.; Liao, R.; Guinn, K. M.; Hickey, M. J.; Mohaideen, N.; Murphy, K. C.; Boshoff, H. I. M.; Mizrahi, V.; Rubin, E. J.; Sassetti, C. M.; Barry, C. E.; Sherman, D. R.; Parish, T.; Sacchettini, J. C. PLoS One 2013, 8 (9), e75245.
(5) Bürstner, N.; Roggo, S.; Ostermann, N.; Blank, J.; Delmas, C.; Freuler, F.; Gerhartz, B.; Hinniger, A.; Hoepfner, D.; Liechty, B.; Mihalic, M.; Murphy, J.; Pistorius, D.; Rottmann, M.; Thomas, J. R.; Schirle, M.; Schmitt, E. K. Chembiochem 2015, 16 (17), 2433–2436.
(6) Schmitt, E. K.; Riwanto, M.; Sambandamurthy, V.; Roggo, S.; Miault, C.; Zwingelstein, C.; Krastel, P.; Noble, C.; Beer, D.; Rao, S. P. S.; Au, M.; Niyomrattanakit, P.; Lim, V.; Zheng, J.; Jeffery, D.; Pethe, K.; Camacho, L. R. Angew. Chemie Int. Ed. 2011, 50 (26), 5889–5891.
(7) Vasudevan, D.; Rao, S. P. S.; Noble, C. G. J. Biol. Chem. 2013, 288 (43), 30883–30891.
(8) Wilson, D. N. Crit. Rev. Biochem. Mol. Biol. 2009, 44 (6), 393–433.
(9) Borg, A.; Holm, M.; Shiroyama, I.; Hauryliuk, V.; Pavlov, M.; Sanyal, S.; Ehrenberg, M. J. Biol. Chem. 2015, 290 (6), 3440–3454.
(10) Wilson, D. N. Nat. Rev. Microbiol. 2014, 12, 35–48.
(11) Stark, H.; Rodnina, M. V; Wieden, H. J.; van Heel, M.; Wintermeyer, W. Cell 2000, 100 (3), 301–309.
(12) Rodnina, M. V; Savelsbergh, A.; Katunin, V. I.; Wintermeyer, W. Nature 1997, 385 (6611), 37–41.
(13) Agrawal, R. K.; Heagle, A. B.; Penczek, P.; Grassucci, R. A.; Frank, J. Nat. Struct. Biol. 1999, 6 (7), 643–647.
(14) Biuković G., PhD Thesis, Onasbrück University, Germany, 2004.
(15) Basic and clinical Pharmacology, 12th ed.; Katzung, B. G., Masters, S. B., Trevor, A. J., Eds.; McGraw-Hill: London, 2012.
(16) Shaila, M. S.; Gopinathan, K. P.; Ramakrishnan, T. Antimicrob. Agents Chemother. 1973, 4 (3), 205–213.
(17) Kanyok, T. P.; Reddy, M. V.; Chinnaswamy, J.; Danziger, L. H.; Gangadharam, P. R. Antimicrob. Agents Chemother. 1994, 38 (2), 170–173.
(18) Donald, P. R.; Sirgel, F. A.; Kanyok, T. P.; Danziger, L. H.; Venter, A.; Botha, F. J.; Parkin, D. P.; Seifart, H. I.; Van De Wal, B. W.; Maritz, J. S.; Mitchison, D. A. Antimicrob. Agents Chemother. 2000, 44 (12), 3285–3287.
(19) Holm, M.; Borg, A.; Ehrenberg, M.; Sanyal, S. Proc. Natl. Acad. Sci. 2016, 113 (4), 978–983.
(20) Finlay, A. C.; Hobby, G. L.; Hochstein, F.; Lees, T. M.; Lenert, T. F.; Means, J. A.; P’an, S. Y.; Regina, P. P.; Routien, J. B.; Sobin, B. A.; Tate, K. B.; Kane, J. H. Am. Rev. Tuberc. 1951, 63 (1),
146
1–3.
(21) Ehrlich, J.; Smith, R. M.; Penner, M. A.; Anderson, L. E.; Bratton, A. C. Am. Rev. Tuberc. 1951, 63 (1), 7–16.
(22) World Health Organization. Global Tuberculosis Report, 2016.
(23) Lee, M.; Lee, J.; Carroll, M. W.; Choi, H.; Min, S.; Song, T.; Via, L. E.; Goldfeder, L. C.; Kang, E.; Jin, B.; Park, H.; Kwak, H.; Kim, H.; Jeon, H.-S.; Jeong, I.; Joh, J. S.; Chen, R. Y.; Olivier, K. N.; Shaw, P. A.; Follmann, D.; Song, S. D.; Lee, J.-K.; Lee, D.; Kim, C. T.; Dartois, V.; Park, S.-K.; Cho, S.-N.; Barry, C. E. N. Engl. J. Med. 2012, 367 (16), 1508–1518.
(24) Lee, M.; Song, T.; Kim, Y.; Jeong, I.; Cho, S. N.; Barry, C. E. N. Engl. J. Med. 2015, 373 (3), 290–291.
(25) Zahedi Bialvaei, A.; Rahbar, M.; Yousefi, M.; Asgharzadeh, M.; Samadi Kafil, H. J. Antimicrob. Chemother. 2017, 72 (2), 354–364.
(26) Lee, R. E.; Hurdle, J. G.; Liu, J.; Bruhn, D. F.; Matt, T.; Scherman, M. S.; Vaddady, P. K.; Zheng, Z.; Qi, J.; Akbergenov, R.; Das, S.; Madhura, D. B.; Rathi, C.; Trivedi, A.; Villellas, C.; Lee, R. B.; Rakesh; Waidyarachchi, S. L.; Sun, D.; McNeil, M. R.; Ainsa, J. A.; Boshoff, H. I.; Gonzalez-Juarrero, M.; Meibohm, B.; Böttger, E. C.; Lenaerts, A. J. Nat. Med. 2014, 20 (2), 152–158.
(27) Savelsbergh, A.; Rodnina, M. V; Wintermeyer, W. RNA 2009, 15 (5), 772–780.
(28) Guo, X.; Peisker, K.; Backbro, K.; Chen, Y.; Koripella, R. K.; Mandava, C. S.; Sanyal, S.; Selmer, M. Open Biol. 2012, 2 (3), 120016–120016.
(29) Borg, A.; Pavlov, M.; Ehrenberg, M. Nucleic Acids Res. 2016, 44 (7), 3264–3275.
(30) Black, F. T.; Wildfang, I. L.; Borgbjerg, K. Lancet (London, England) 1985, 1 (8428), 578–579.
(31) Johnson, R. A.; McFadden, G. I.; Goodman, C. D. PLoS One 2011, 6 (6), e20633.
(32) Srivastava, K.; Imran, M.; Habib, S. Mol. Biochem. Parasitol. 2013, 192 (1–2), 39–48.
(33) Palmer, S. O.; Rangel, E. Y.; Hu, Y.; Tran, A. T.; Bullard, J. M. PLoS One 2013, 8 (11), e80252.
(34) Tourigny, D. S.; Fernandez, I. S.; Kelley, A. C.; Ramakrishnan, V. Science (80-. ). 2013, 340 (6140), 1235490–1235490.
(35) Brilot, A. F.; Korostelev, A. A.; Ermolenko, D. N.; Grigorieff, N. Proc. Natl. Acad. Sci. 2013, 110 (52), 20994–20999.
(36) Frank, J.; Agrawal, R. K. Nature 2000, 406 (6793), 318–322.
(37) Wintermeyer, W.; Rodnina, M. V. Essays Biochem. 2000, 35 (1), 117–129.
(38) Julián, P.; Konevega, A. L.; Scheres, S. H. W.; Lázaro, M.; Gil, D.; Wintermeyer, W.; Rodnina, M. V; Valle, M. Proc. Natl. Acad. Sci. U. S. A. 2008, 105 (44), 16924–16927.
(39) Gao, N.; Zavialov, A. V; Ehrenberg, M.; Frank, J. J. Mol. Biol. 2007, 374 (5), 1345–1358.
(40) Gao, Y.-G.; Selmer, M.; Dunham, C. M.; Weixlbaumer, A.; Kelley, A. C.; Ramakrishnan, V. Science 2009, 326 (5953), 694–699.
147
(41) Margus, T.; Remm, M.; Tenson, T. PLoS One 2011, 6 (8), e22789.
(42) Ticu, C.; Nechifor, R.; Nguyen, B.; Desrosiers, M.; Wilson, K. S. EMBO J. 2009, 28 (14), 2053–2065.
(43) Laurberg, M.; Kristensen, O.; Martemyanov, K.; Gudkov, A. T.; Nagaev, I.; Hughes, D.; Liljas, A. J. Mol. Biol. 2000, 303 (4), 593–603.
(44) Li, W.; Liu, Z.; Koripella, R. K.; Langlois, R.; Sanyal, S.; Frank, J. Sci. Adv. 2015, 1 (4), e1500169–e1500169.
(45) Kiran Koripella, R.; Holm, M.; Dourado, D.; Mandava, C. S.; Flores, S.; Sanyal, S. Sci. Rep. 2015, 5, 12970.
(46) Hammarsund, M.; Wilson, W.; Corcoran, M.; Merup, M.; Einhorn, S.; Grandér, D.; Sangfelt, O. Hum. Genet. 2001, 109 (5), 542–550.
(47) Bhargava, K.; Templeton, P.; Spremulli, L. L. Protein Expr. Purif. 2004, 37 (2), 368–376.
(48) Margus, T.; Remm, M.; Tenson, T. BMC Genomics 2007, 8 (1), 15.
(49) Suematsu, T.; Yokobori, S.; Morita, H.; Yoshinari, S.; Ueda, T.; Kita, K.; Takeuchi, N.; Watanabe, Y. Mol. Microbiol. 2010, 75 (6), 1445–1454.
(50) Seshadri, A.; Samhita, L.; Gaur, R.; Malshetty, V.; Varshney, U. Tuberculosis (Edinb). 2009, 89 (6), 453–464.
(51) Sassetti, C. M.; Rubin, E. J. Proc. Natl. Acad. Sci. U. S. A. 2003, 100 (22), 12989–12994.
(52) Sassetti, C. M.; Boyd, D. H.; Rubin, E. J. Mol. Microbiol. 2003, 48 (1), 77–84.
(53) Rao, A. R.; Varshney, U. EMBO J. 2001, 20 (11), 2977–2986.
(54) Nat. Microbiol. 2016, 1 (6), Editorial.
(55) Besier, S.; Ludwig, A.; Brade, V.; Wichelhaus, T. A. Mol. Microbiol. 2003, 47 (2), 463–469.
(56) Nagaev, I.; Björkman, J.; Andersson, D. I.; Hughes, D. Mol. Microbiol. 2001, 40 (2), 433–439.
(57) O’Neill, A. J.; Chopra, I. Mol. Microbiol. 2006, 59 (2), 664–676.
(58) Martemyanov, K. A.; Gudkov, A. T. J. Biol. Chem. 2000, 275 (46), 35820–35824.
(59) O’Neill, A. J.; McLaws, F.; Kahlmeter, G.; Henriksen, A. S.; Chopra, I. Antimicrob. Agents Chemother. 2007, 51 (5), 1737–1740.
(60) Farrell, D. J.; Castanheira, M.; Chopra, I. Clin. Infect. Dis. 2011, 52 Suppl 7, S487-92.
(61) McLaws, F. B.; Larsen, A. R.; Skov, R. L.; Chopra, I.; O’Neill, A. J. Antimicrob. Agents Chemother. 2011, 55 (3), 1173–1176.
(62) Tomlinson, J. H.; Thompson, G. S.; Kalverda, A. P.; Zhuravleva, A.; O’Neill, A. J.; Cox, G.; Edwards, T. A.; O’Neill, A. J.; McLaws, F. B.; Larsen, A. R.; Skov, R. L.; Chopra, I.; O’Neill, A. J.; Jones, R. N.; Mendes, R. E.; Sader, H. S.; Castanheira, M.; Johnson, R. A.; McFadden, G. I.; Goodman, C. D.; Neill, A. J. O.; Chopra, I.; McLaws, F. B.; Kahlmeter, G.; Henriksen, A. S.; Chopra, I. Antimicrob. Agents Chemother. 2011, 6 (3), 1173–1176.
148
(63) Tomlinson, J. H.; Thompson, G. S.; Kalverda, A. P.; Zhuravleva, A.; O’Neill, A. J. Sci. Rep. 2016, 6, 19524.
(64) Cox, G.; Thompson, G. S.; Jenkins, H. T.; Peske, F.; Savelsbergh, A.; Rodnina, M. V; Wintermeyer, W.; Homans, S. W.; Edwards, T. A.; O’Neill, A. J. Proc. Natl. Acad. Sci. 2012, 109 (6), 2102–2107.
(65) Bhatter, P.; Chatterjee, A.; D’souza, D.; Tolani, M.; Mistry, N. PLoS One 2012, 7 (3), e33507.
(66) Melnyk, A. H.; Wong, A.; Kassen, R. Evol. Appl. 2015, 8 (3), 273–283.
(67) Pope, C. F.; McHugh, T. D.; Gillespie, S. H. In Methods in molecular biology (Clifton, N.J.); Springer, 2010; Vol. 642, pp 113–121.
(68) Singh, V.; Mizrahi, V. Drug Discov. Today 2017, 22 (3), 503–509.
(69) Warner, D. F.; Mizrahi, V. S. Afr. Med. J. 2012, 102 (6), 457–460.
(70) Guo, X. V.; Monteleone, M.; Klotzsche, M.; Kamionka, A.; Hillen, W.; Braunstein, M.; Ehrt, S.; Schnappinger, D. J. Bacteriol. 2007, 189 (13), 4614–4623.
(71) Ehrt, S. Nucleic Acids Res. 2005, 33 (2), e21–e21.
(72) Wei, J.-R.; Krishnamoorthy, V.; Murphy, K.; Kim, J.-H.; Schnappinger, D.; Alber, T.; Sassetti, C. M.; Rhee, K. Y.; Rubin, E. J. Proc. Natl. Acad. Sci. 2011, 108 (10), 4176–4181.
(73) Abrahams, G. L.; Kumar, A.; Savvi, S.; Hung, A. W.; Wen, S.; Abell, C.; Barry, C. E.; Sherman, D. R.; Boshoff, H. I. M.; Mizrahi, V. Chem. Biol. 2012, 19 (7), 844–854.
(74) Evans, J. C.; Mizrahi, V. Front. Microbiol. 2015, 6, 812.
(75) Evans, J. C.; Trujillo, C.; Wang, Z.; Eoh, H.; Ehrt, S.; Schnappinger, D.; Boshoff, H. I. M.; Rhee, K. Y.; Barry, C. E.; Mizrahi, V. ACS Infect. Dis. 2016, 2 (12), 958–968.
(76) Ramón-García, S.; Ng, C.; Anderson, H.; Chao, J. D.; Zheng, X.; Pfeifer, T.; Av-Gay, Y.; Roberge, M.; Thompson, C. J. Antimicrob. Agents Chemother. 2011, 55 (8), 3861–3869.
(77) Weinstein, E. A.; Yano, T.; Li, L.-S.; Avarbock, D.; Avarbock, A.; Helm, D.; McColm, A. a; Duncan, K.; Lonsdale, J. T.; Rubin, H. Proc. Natl. Acad. Sci. U. S. A. 2005, 102 (12), 4548–4553.
(78) Wójtowicz, D.; Tiuryn, J. J. Comput. Biol. 2007, 14 (4), 479–495.
(79) Martemyanov, K. A.; Liljas, A.; Yarunin, A. S.; Gudkov, A. T. J. Biol. Chem. 2001, 276 (31), 28774–28778.
(80) Hansson, S.; Singh, R.; Gudkov, A. T.; Liljas, A.; Logan, D. T. FEBS Lett. 2005, 579 (20), 4492–4497.
(81) Hansson, S.; Singh, R.; Gudkov, A. T.; Liljas, A.; Logan, D. T. J. Mol. Biol. 2005, 348 (4), 939–949.
(82) Besier, S.; Ludwig, A.; Brade, V.; Wichelhaus, T. A. Antimicrob. Agents Chemother. 2005, 49 (4), 1426–1431.
(83) Chen, Y.; Koripella, R. K.; Sanyal, S.; Selmer, M. FEBS J. 2010, 277 (18), 3789–3803.
149
(84) Johanson, U.; Ævarsson, A.; Liljas, A.; Hughes, D. J. Mol. Biol. 1996, 258 (3), 420–432.
(85) Ramakrishnan, G.; Chandra, N. R.; Srinivasan, N. Mol. BioSyst. 2015, 11 (12), 3316–3331.
(86) Johanson, U.; Hughes, D. Gene 1994, 143 (1), 55–59.
(87) Macvanin, M.; Hughes, D. FEMS Microbiol. Lett. 2005, 247 (2), 215–220.
(88) Comas, I.; Borrell, S.; Roetzer, A.; Rose, G.; Malla, B.; Kato-Maeda, M.; Galagan, J.; Niemann, S.; Gagneux, S. Nat. Genet. 2011, 44 (1), 106–110.
(89) Andre, E.; Goeminne, L.; Cabibbe, A.; Beckert, P.; Kabamba Mukadi, B.; Mathys, V.; Gagneux, S.; Niemann, S.; Van Ingen, J.; Cambau, E. Clin. Microbiol. Infect. 2017, 23 (3), 167–172.
(90) Torres, J. N.; Paul, L. V; Rodwell, T. C.; Victor, T. C.; Amallraja, A. M.; Elghraoui, A.; Goodmanson, A. P.; Ramirez-Busby, S. M.; Chawla, A.; Zadorozhny, V.; Streicher, E. M.; Sirgel, F. A.; Catanzaro, D.; Rodrigues, C.; Gler, M. T.; Crudu, V.; Catanzaro, A.; Valafar, F. Emerg. Microbes Infect. 2015, 4 (7), e42.
(91) Seifert, M.; Catanzaro, D.; Catanzaro, A.; Rodwell, T. C. PLoS One 2015, 10 (3), e0119628.
(92) Dhar, N.; McKinney, J. D. Proc. Natl. Acad. Sci. 2010, 107 (27), 12275–12280.
150
Chapter 5
Conclusions and Recommendations for Future Work
5.1 Conclusions
The overall objective of this study was to identify novel analogues of fusidic acid (FA) with improved
antimycobacterial activity through semi-synthesis. This was motivated by the hypothesis that FA’s
modest antimycobacterial activity is partly due to the presence of functional groups such as the C-21
carboxylic acid which may limit its permeation across Mtb’s hydrophobic cell wall.
Through ester and amide couplings, the C-21 carboxylic acid was functionalized to yield ester and
amide aminoquinoline hybrids. This was motivated in part by the recent report of potent
antitubercular amide derivatives of spectinomycin, an old antibiotic with weak antimycobacterial
activity, and the fact that bedaquiline, the first anti-TB drug licensed in over 40 years, bears the
quinoline scaffold.
The FA hybrids were 2- to 8-fold less potent than FA against Mtb, and were 2 to 10-fold less soluble
in aqueous media compared to FA. The poor solubility of these compounds in aqueous media
prevaricates their true antimycobacterial activity, because the antimycobacterial assays are
conducted in aqueous media. Furthermore, from a clinical perspective, this highlights the
importance of ensuring an optimum balance between aqueous solubility and permeability of
compounds. Aqueous solubility has implications on drug efficacy and safety. This is because the flux
of a drug across the intestinal membrane is proportional to the concentration gradient between the
intestinal lumen and the blood. Thus, even for drugs with high permeability, poor aqueous solubility
leads to decreased absorption. Similarly, in the case of injectable drugs, low aqueous solubility
results in decreased absorption into the bloodstream. In addition, high concentrations of poorly
soluble injectable drugs may crystallize in tissues and organs, resulting in acute toxicity.
The aminoquinoline pharmacophore lowered the antimycobacterial activity of the hybrids, as 1:1
molar mixtures of FA with selected aminoquinoline derivatives exhibited the MIC of FA, while the
aminoquinoline derivatives were all separately inactive. In comparing the length of the alkyl linker,
in both the amide and ester series, there was no correlation between chain length and
antimycobacterial activity. However, AW45, the amide with the longest alkyl linker, precipitated in
the aqueous media for the turbidimetric solubility assay at 10 M, distorting its antimycobacterial
assay result. The synthesis and antimycobacterial evaluation of these C-21 analogues contributes to
the expansion of FA Structure-Activity-Relationship (SAR) profile. The low potency of these C-21
151
amides and esters resembles its antibacterial SAR in other organisms, where the carboxylic acid
group has been shown to be essential for activity.
The FA hybrids were evaluated for cytotoxicity against two cell lines; Chinese Hamster Ovarian (CHO)
and THP-1, and found to be more cytotoxic than FA. Consistent with its in vivo safety profile, FA was
not cytotoxic in both cell lines, while the aminoquinoline derivatives on their own were cytotoxic.
These data suggest that the aminoquinoline moiety contributed to the overall cytotoxicity observed
in the hybrids. Like in the case of the antimycobacterial activity, there was no correlation between
the length of the alkyl linker and cytotoxicity. It is, however, important to note that these in vitro
cytotoxicity assays are conducted in laboratory-adapted cell lines whose predictive value is limited,
and, as observed for a few compounds in this study, the cytotoxicity profile of compounds may vary
across different cell lines. Nevertheless, due to their poor solubility, cytotoxicity and low
antimycobacterial activity, the FA-aminoquinoline hybrids were not progressed further.
As part of the broader goal of repositioning FA for antituberculosis drug discovery, other FA
analogues have been synthesised in our laboratory. The second objective of this study was to
evaluate the intracellular efficacy of FA and three C-3 analogues, GKFA16, GKFA17 and GKFA37 (3-
ketoFA) were evaluated for their intracellular efficacy in THP-1 cells. FA and all the analogues
evaluated were active against intracellular Mtb. Notably, in the case of GKFA37- a metabolite of FA
in humans, this was consistent with previous reports of its antibacterial activity. The intracellular
efficacy of the analogues studied in this project are an encouraging result for antitubercular drug
repositioning; it has been shown that activity in broth cultures does not always translate to
intracellular activity, since Mtb is an intracellular pathogen. This positive result notwithstanding,
several limitations are to be considered; the predictive value of data obtained from in vitro cell lines
is limited tempered by the inherent variations across different cell lines. Moreover, in the context of
in vivo disease, macrophages are part of the granuloma, which results from the interplay of several
other mechanisms that play an important role in the outcome of infection.
A third objective of this project was to evaluate the role of mycobacterial biotransformation in the
antimycobacterial activity of selected FA analogues. FA and five analogues were evaluated for their
stability in Mtb cultures. Three C-3 esters: GKFA16, GKFA17, GKFA61, as well as two C-21 amides,
AW23 and AW25. In live Mtb cultures, GKFA16 and GKFA17 were hydrolysed extensively to FA. In
heat-killed cultures, the concentrations of these compounds remained relatively unchanged,
suggesting that the metabolism was specifically associated with Mtb. Similar incubation of FA
revealed negligible hydrolysis, consistent with data from our laboratory, which showed that FA is
relatively stable in Mtb lysate incubations. Recently, preliminary in vivo studies in our laboratory
152
revealed that these two compounds were hydrolysed to achieve higher concentrations of FA in the
lungs of healthy C57BL/6 mice that received GKFA16 and GKFA17 when compared to those that
received FA intravenously. Taken together, these data suggest that these two esters can be
exploited as prodrugs to enhance fusidic acid PK in the lungs, the primary site of TB infection.
Furthermore, from an in vivo PK perspective, the fact that the esters themselves have
antimycobacterial activity is plausibly beneficial; an initial (loading dose) of the ester can be
administered to achieve modest efficacy, while subsequent hydrolysis ensures a longer duration of
action due to increasing concentration of FA over time.
GKFA61, a C-3 silicate ester of FA, was relatively stable in both heat-killed and live cultures, with no
FA detected in these incubations. This result is consistent with its in vivo PK profile in mice, where it
has been shown to have a longer half-life. Its metabolic stability may be due to the presence of
isopropyl groups around the C-3 position, which cause steric hindrance, thus blocking this site of
metabolism. Similarly, the concentrations of the C-21 amides AW23 and AW25 remained relatively
unchanged in both heat-killed and live cultures.
A fourth objective, the identification and validation of the target of FA in Mtb, was achieved through
the generation of spontaneous resistant mutants and target-based whole cell screening (TB-WCS).
Spontaneous resistant mutant generation in Mtb revealed a point mutation (H462Y) in fusA1, which
encodes Elongation Factor G (EF-G), its known bacterial target. EF-G is a ribosomal GTPase, and this
mutation occurred in a highly conserved domain of EF-G associated with catalytic activity of the
enzyme. It has been demonstrated that similar mutations in other bacteria result in conformational
changes within EF-G that decrease drug affinity. In addition, this mutation was not associated with a
fitness cost, and no in vitro cross-resistance was observed with a panel of anti-TB drugs. This is an
encouraging result, since none of the existing ribosome-targeting anti-TB agents inhibits EF-G. A
knockdown strain underexpressing EF-G was used to conduct TB-WCS of FA and three analogues,
with hypersensitivity observed for these compounds. This effect was not observed with rifampicin, a
transcriptional inhibitor, thus providing further confirmation of EF-G as the target of FA in Mtb.
153
5.2 Recommendations for future work
Since the carboxylic acid is essential for antimycobacterial activity, bioisosteres should be considered
in further expansion of fusidic acid SAR. Bioisosteres are functional groups or substituents that have
similar chemical or physicochemical properties and whose replacement retains biological activity.
Bioisosteric replacement is exploited in medicinal chemistry to address aspects associated with the
design and development of drug candidates, such as enhancing physicochemical properties,
improving potency or attenuating toxicity. Studies involving bioisosteric replacement of the
carboxylic acid are underway in our laboratories.
In addition, since FA is a high molecular weight compound, subsequent analogues synthesised may
benefit from supramolecular derivatization with biocompatible partner molecules such as inclusion
complexes, co-crystals and solvates or hydrates. These can be useful in improving its
physicochemical properties, specifically solubility.
Since the C-21 amides synthesised in this project were stable in Mtb incubations, the C-21 esters
should also be evaluated for stability in Mtb cultures subject to successful LC-MS method
development.
The evaluation of intracellular efficacy carried out in this study relied on CFU enumeration, which is
low-throughput, due to its labour-intensive and time-consuming nature. Studies are underway in our
lab to delineate the factors that affect drug permeation in an in vitro macrophage infection model. In
addition, a macrophage model of infection using fluorescent reporter strains of Mtb is being
developed, which would enable rapid, convenient, medium-throughput evaluation of intracellular
efficacy, in a 96-well format that allows more accurate dose-response curves for compounds over a
wider range of drug concentrations than CFU enumeration. However, as is applicable to all
laboratory-adapted cell lines, the relevance of macrophage assays to in vivo host infection
conditions is arguable. These cell lines exclude the interplay of host-associated factors with these
cells, which ultimately play a role in the outcome of infection. Moreover, in the case of Mtb
infection, the granuloma, and in a wider context, caseating granulomas, account for heterogeneity in
responses to drug treatment. To mitigating this limitation, bone-marrow derived macrophages or if
possible, primary human macrophages should be considered in testing selected derivatives further.
For target identification and mechanism of resistance determination, more spontaneous resistant
mutants should be isolated to study the spectrum of causal mutations of FAR. In conjunction with
structural information on Mtb EF-G, coupled with in silico tools, this can be useful in the design of
future derivatives that overcome resistance mechanisms associated with the drug target. In
154
addition, efflux has been reported as a bacterial mechanism of FAR. Mtb has a variety of efflux
pumps with a wide range of substrates, including antimicrobials. Efflux pumps are associated with
Mtb resistance to fluoroquinolones and RIF. The role of efflux in Mtb FAR should be interrogated,
and if established, efflux inhibitors can be pursued as a strategy to overcome this.
The knockdown strain can be exploited as a tool to identify more potent antimycobacterial
compounds targeting EF-G with superior physicochemical and pharmacokinetic properties to FA; this
might be especially useful in screening recently discovered natural products.
Finally, FA is an old antibiotic that was approved for clinical use before the widespread availability
and use of animal models for in vivo pre-clinical work. Anecdotal reports from a group of researchers
in the 1960s reported higher clearance of FA in rodent species compared to the data generated from
PK studies in humans. This species-specific difference in metabolism may account for its poor in vivo
efficacy in mice (unpublished data), and thus, a more appropriate model of TB infection such as the
marmoset monkey should be considered for in vivo pre-clinical PK studies.
155
Chapter 6
Experimental
6.1 Chemistry
6.1.1 Reagents and solvents
All commercially available chemicals were purchased from Sigma-Aldrich South Africa or Merck
South Africa except for fusidic acid, which was purchased from AvaChem Scientific, Texas, USA.
N, N-Dimethylformamide (DMF) and methanol (MeOH) were purchased as anhydrous solvents,
while all other commonly used solvents were purchased from Kimix Chemicals, South Africa or
Protea Chemicals as Analytical Reagent (AR) grade then purified and dried using an SP-1 solvent
drying system from LC Technology. Ammonium acetate (NH4OAc) and MeOH, the High Performance
Liquid Chromatography (HPLC) grade solvents, were bought from Sigma Aldrich for chromatography
and Mass Spectrometry.
6.1.2 Chromatography
Reactions were monitored by Thin Layer Chromatography (TLC) using Merck F254 aluminum-backed
pre-coated silica gel plates purchased from Merck. Spots were visualized using ultraviolet (UV) light
(254/366 nm) or the following spraying reagents: cerric ammonium nitrate, anisaldehyde or
bromocresol green. Silica gel chromatography was performed using Merck kieselgel 60: 70-230 mesh
for gravity columns and 230-400 mesh for flash chromatography on Biotage® Isolera Prime™.
6.1.3 Physical and spectroscopic characterization
Melting points were determined on a Reichert-Jung Thermovar hot-stage microscope, adapted from
methods by Kofler and Kofler and are uncorrected.1,2
Low-resolution Mass Spectrometry (LRMS) was performed on a JEOL GC Mate II or an AB Sciex 4000
QTrap.
HPLC: Compound peak purity of the final compounds was determined by HPLC using a thermo
separation system comprising of a Spectra series P200 pump, AS100 automated sampler and UV 100
variable wavelength detector. For UV detection, a photo diode array (PDA) detector was set to
monitor the wavelength at 254 nm. The stationary phase used for Waters preparatory HPLC was a
Waters® X-bridge C18 5.0 μm column (4.6 x 150 mm) (Phenomenex, Torrance, CA) fitted with a
Supelguard TM Ascentis® guard cartridge C18 (2cm × 40 mm, 3 um) (Supelco Analytical, Bellefonte,
PA).
156
The mobile phase consisted of 0.4% acetic acid in 10 mM NH4OAc in HPLC grade (Type 1) water; with
flow rate = 1.20 ml/min; and acetonitrile (B) delivered at a flow rate 1.20 ml/min. All compounds
were confirmed to have ≥ 95% purity.
Table 6.1: Gradients used for investigation of the purity of compounds with preparatory HPLC
Time % A % A
Initial 75 25
9.00 0 100
14.00 0 100
14.10 75 25
20.00 75 25
Peak purity was reported as the integrated area of the compound peak as a percentage of total peak
areas observed.
LC-MS: Liquid chromatograph with mass spectrometer (LC-MS) analysis was performed using an
Agilent® 1260 Infinity Binary Pump, Agilent® 1260 Infinity Diode Array Detector (DAD), Agilent® 1290
Infinity Column Compartment, Agilent® 1260 Infinity Standard Autosampler, and a Agilent® 6120
Quadrupole (Single) mass spectrometer, equipped with an atmospheric pressure chemical ionization
(APCI) and electrospray ionization (ESI) multimode ionisation source. Purities were determined by
Agilent® LC-MS using a Kinetex Core C18 2.6 μm column (50 x 3 mm); organic phase (Mobile Phase
B): 0.4% acetic acid, 10 mM NH4OAc in a 9:1 ratio of HPLC grade methanol and Type 1 water,
aqueous phase (Mobile Phase A): 0.4% acetic acid in 10 mM NH4OAc in HPLC grade (Type 1) water;
with flow rate = 0.9 ml/min; detector: diode array (DAD) and all compounds were confirmed to have
≥ 95% purity.
Table 6.2: Gradient used for investigation of the purity and mass of compounds using LCMS
Time % A % B
Initial 75 25
1.00 75 25
3.00 0 100
4.50 0 100
5.20 75 25
6.00 75 25
157
NMR: All 1H NMR spectra were recorded in deuterochloroform (CDCl3) or deuteromethanol (CD3OD)
on a Bruker 300 Mega Hertz (MHz) or Varian Unity Spectrometer (400 MHz) with tetramethylsilane
(TMS) as an internal standard. All chemical shifts (δ) are given in parts per million (ppm), while
coupling constants (J) are expressed in Hertz (Hz) and are rounded off to one decimal place, resulting
in exactly the same coupling constants for coupling partners. 13C NMR spectra were recorded on the
same instruments at 75 MHz and in the same deuterated solvents, with TMS as an internal standard.
The 13C chemical shift values are listed without specific assignment to carbon atoms.
158
6.1.4 General synthetic procedure for 4-aminoquinoline derivatives3,4
A mixture of 4, 7-dichloroquinoline (1 g, 10.1 mmol), Et3N (2.1 ml, 15 mmol) and the appropriate
diamine or alcohol (2 mmol) was stirred under nitrogen at 80 oC for 1 hour without stirring. The
temperature was then raised to 140 oC and maintained for 3 hours with stirring, after which the
reaction mixture was left to cool to ambient temperature. Ice was then added, resulting in the
formation of a precipitate, which was stored in the refrigerator for 1 hour. The precipitate was
filtered and the residue washed with cold water (2 x 5 ml) followed by cold diethyl ether (2 x 5 ml) to
afford the substituted aminoquinoline diamines and amino alcohols in excellent yields (90-98%).
N-(7-chloroquinolin-4-yl)-propane-1, 3-diamine (AW27)
White powder (1.07 g, 90%) ; Rf 0.21 (1:9 MeOH:CH2Cl2); melting
point (m.p.) 125-127 oC ; literature m.p. (lit. m.p. 124-127 oC)4; δH
(400 MHz, CD3OD): 8.35 (1H, d, J 6.0 Hz, H2), 8.05 (1H, d, J 9.0 Hz,
H5), 7.75 (1H, d, J 3.0 Hz, H8), 7.38 (1H, dd, J 3.0 Hz, 9.0 Hz, H6),
6.54 (1H, d, J 6.0 Hz, H3), 3.59 (2H, t, J 6.3 Hz, H9), 1.37 (2H, m,
H10), 3.02 (2H, t, J 6.3 Hz, H9); δC (75 MHz, CD3OD): 154.0, 151.2,
146.9, 135.1, 130.3, 127.2, 122.5, 118.5, 112.4, 44.3, 41.6, 32.8. LRMS (EI) m/z 236.09 [M+H+]; HPLC
purity: > 95%.
N-(7-chloroquinolin-4-yl)-butane-1, 4-diamine (AW18)
Brown powder (1.21 g, 96%); Rf 0.21 (1:9 MeOH:CH2Cl2); m.p.
123-125 oC (lit. m.p. 124-127 oC)4; δH (400 MHz, CD3OD): 8.5
(1H, d, J 5.2 Hz, H2), 7.99 (1H, d, J 9.0 Hz, H5), 7.64 (1H, d, J 2.0
Hz, H8), 7.31(1H, dd, J 2.0 Hz, 9.0 Hz, H6), 6.4 (1H, d, J 5.2 Hz,
H3) 3.2 (2H, t, J 5.9 Hz, H9), 2.99 (2H, t, J 5.9 Hz, H12), 1.77 (2H,
m, H11), 1.61(2H, m, H10); δC (75 MHz, CD3OD): 153.0, 150.0,
147.0, 135.0, 129.1, 127.0, 124.0, 118.1, 113.6, 45.4, 41.4, 30.1, 26.0. LRMS (EI) m/z 250.10 [M+H+];
HPLC purity: > 95%.
159
N-(7-chloroquinoline-4-yl)-pentane-1, 5-diamine (AW43)
Light brown powder (1.30 g, 98%); Rf 0.22 (1:9
MeOH:CH2Cl2); m.p. 133-135 oC (lit. m.p. 136-138 oC)4; δH
(400 MHz, CD3OD): 8.41(1H, d, J 5.8 Hz, H2), 8.0 (1H, d, J 8.9
Hz, H5), 7.49 (1H, d, J 2.3 Hz, H8), 7.38 (1H, dd, J 2.3 Hz, 8.9
Hz, H6), 6.58 (1H, d, J 5.8 Hz, H3), 3.4 (2H, t, J 6.2 Hz, H9),
2.71 (2H, t, J 6.2 Hz, H13), 1.54 (2H, m, H12), 1.49 (2H, m,
H10), 1.38 (2H, m, H11); δC (75 MHz, CD3OD): 154.1, 150.6, 133.4, 130.0, 128.8, 126.5, 123.2, 119.1,
114.0, 44.6, 42.3, 32.3, 30.2, 26.1. LRMS (EI) m/z 264.12 [M+H+]; HPLC purity: > 95%.
2-(7-chloroquinolin-4-ylamino) ethanol (AW21)
Off-white powder (1.1 g, 98%); Rf 0.20 (1:9 MeOH:CH2Cl2); m.p 216-
218 oC ; δH (400 MHz, CD3OD): 8.35 (1H, d, J 5.7 Hz,H2), 8.10 (1H, d, J
9.4 Hz, H5), 7.77 (1H, d, J 2.1 Hz, H8), 7.40 (1H, dd, J 2.1 Hz, 9.4 Hz, H6),
6.58 (1H, d, J 5.7 Hz,H3), 3.83 (2H, t, J 6.3 Hz, H10), 3.68 (1H, t, J 6.3 Hz,
NH), 3.50 (2H, t, J 6.3 Hz, H9), 2.91 (1H, t, J 6.4 Hz, OH); δC (75 MHz,
CD3OD): 153.6, 149.9, 146.4, 136.1, 128.3, 126.7, 124.0, 117.9, 112.1,
60.3, 42.4. LRMS (EI) m/z 223.06 [M+H+]; HPLC purity: > 95%.
3-(7-chloroquinolin-4-ylamino) propan-1-ol (AW26)
Light brown powder (1.13 g, 95%); Rf 0.23 (1:9 MeOH:CH2Cl2); m.p.
221-223 oC; δH (400 MHz, CD3OD): 8.14 (1H, d, J 6.2, H2), 7.86 (1H,
d, J 8.9, H5), 7.57 (1H, d, J 2.4 Hz, H8), 7.20 ( 1H, dd, J 2.4 Hz, 8.9 Hz,
H6), 6.34 (1H, d, J 6.2 Hz, H3), 3.22 (2H, t, J 6.1 Hz, H11), 2.62 ( 2H, t,
J 6.1 Hz, H9), 2.56 (1H, m, NH), 1.71 ( 2H, m, H10 ), 1.47 (1H, m, OH);
δC (75 MHz, CD3OD): 153.2, 150.4, 148.7, 135.6, 128.7, 126.9,
123.1, 118.5, 114.2, 61.2, 44.9, 32.3. LRMS (EI) m/z 237.07 [M+H+]; HPLC purity: > 95%.
160
4-(7-chloroquinoline-4-ylamino) butan-1-ol (AW28)
Light green crystals (1.08 g, 96%); Rf 0.23 (1:9 MeOH:CH2Cl2);
m.p 216-218 oC; δH (400 MHz, CD3OD): 8.32 (1H, d, J 6.2 Hz, H2),
8.07 (1H, d, J 8.6 Hz, H5), 7.76 (1H, d, J 2.9 Hz, H8), 7.39 (1H, dd,
J 2.9 Hz, 8.6 Hz, H6), 6.51 (1H, d, J 6.2 Hz, H3), 3.63 (2H, t, J 6.1
Hz, H12), 3.38 (2H, t, J 6.1 Hz, H9), 1.81 (2H, m, H11), 1.69 (2H, m,
H10); δC (75 MHz, CD3OD): 154.0, 150.6, 148.1, 135.4, 130.2,
128.1, 122.2, 119.8, 113.6, 63, 45.9,30.6, 27.2. LRMS (EI) m/z 251.07 [M+H+]; HPLC purity: > 95%.
5-(7-chloroquinolin-4-ylamino) pentan-1-ol (AW29)
Light yellow powder (1.2 g, 90%); Rf 0.24 (1:9 MeOH:CH2Cl2);
m.p. 212-214 oC; δH (400 MHz, CD3OD): 8.32 (1H, d, J 6.3 Hz,
H2), 8.13 (1H, d, J 9.0 Hz, H5), 7.76 (1H, d, J 2.8 Hz, H8), 7.43
(1H, dd, J 2.8 Hz, 9.0 Hz, H6), 6.54 (1H, d, J 6.3 Hz, H3), 3.59
(2H, t, J 5.9 Hz, H13), 3.41 (t, J 5.9 Hz, H9), 1.77 (2H, m, H10),
1.51-1.61 (4H, m, H11 + H12); δC (75 MHz, CD3OD): 155.1,
151.3, 148.6, 136.7, 130.4, 128.2, 124.0, 120.1, 114.7, 64.0, 45.5, 33.2, 30.7, 25.1. LRMS (EI) m/z
265.10 [M+H+]; HPLC purity: > 95%.
6.1.5 General synthetic procedure for fusidic acid amides5
HOBt (130 mg, 0.97 mmol) was added to a solution of fusidic acid (200 mg, 0.39 mmol) and EDCI
(150 mg, 0.97 mmol) in DMF (8 ml) and the resulting reaction mixture was stirred for 15 minutes at
25 oC. In a separate round bottom flask, DIPEA (0.8 ml, 0.5 mmol) was added to the amine (0.42
mmol) in DMF (2 ml) and the resulting mixture was stirred for 10 minutes. In the case of primaquine
which was commercially available as a diphosphate salt, 0.78 mmol of DIPEA was used in order to
release the free base. The solution containing the amine was then added dropwise to the flask
containing the acid and the resulting reaction mixture was stirred at 25 oC for 16 hours. After
completion of the reaction (monitored by TLC), 15 ml of 20% MeOH/CH2Cl2 was added to the
reaction mixture, which was then washed with saturated aqueous sodium hydrogen carbonate
NaHCO3 (2 x 15 ml) followed by saturated aqueous sodium chloride (2 x 15 ml) and dried over
MgSO4. The solvent was evaporated under reduced pressure and the crude residue was purified
using column chromatography (10% MeOH/CH2Cl2) to furnish the amides in moderate to excellent
yields (25-90%).
161
N-(7-chloroquinolin-4-yl)-ethanoyl fusidic acid amide (AW23)
Bright yellow crystals (223 mg, 80%)
Rf 0.23 (1:9 MeOH:CH2Cl2); m.p. 148-
150 oC; δH (300 MHz, CDCl3): 8.40
(1H,d, J 6.0 Hz, H2’), 8.13 (1H, d, J 9.0
Hz, H5’), 8.01 (1H, d, J 2.3 Hz, H8’), 7.41
(1H, dd, J 2.3 Hz, 9.0 Hz, H6’), 6.38 (1H,
d, J 6.0 Hz, H3’), 5.88 (1H, d, J 8.2 Hz,
H16), 5.11 (1H, t, J 7.3 Hz, H24), 4.42
(1H, m, H11), 3.81 (1H, m, H3), 3.25-
3.55 (4H, m, H9’+ H10’) 3.09 (1H, m,
H13), 2.46 (2H, m, H22), 2.11 (1H, m, H5), 2.07-2.17 (2H, m, H23), 1.85-2.33 (2H, m, H12), 1.30-2.19 (2H,
m, H15), 1.96 (3H, s, acetyl), 1.51-2.17 (2H, m, H1), 1.67 (3H, s, H27), 1.60 (3H, s, H26), 1.58 (1H, m, H4),
1.57 (1H, m, H9), 1.12-1.74 (2H, m, H7), 1.13-1.59 (2H, m, H6), 1.38 (3H, s, H30), 0.98 (3H, s, H19), 0.92
(3H, d, J 6.2 Hz, H28), 0.91 (3H, s, H18); δC (75 MHz, CDCl3): 174.2, 171.2, 153.4, 151.1, 150.5, 148.7,
135.6, 132.9, 130.3, 128. 7, 126.9, 124.2, 123.7, 118.5, 114.3, 74.9, 72.3, 69.0, 50.3, 49.9, 48.1, 45.1,
42.1, 40.3, 39.2, 37.8, 36.9, 36.0, 34.9, 32.9, 30.5, 30.0, 29.2, 28.0, 26.1, 24.9, 23.1, 20.8, 19.9, 18.2,
17.3, 15.4; LRMS (ESI) m/z 721.41 [M+H+]; HPLC purity: > 95% (tr = 5.42 min).
N-(7-chloroquinolin-4-yl)-N-methylpropanoyl fusidic acid amide (AW24)
Light yellow crystals (73 mg, 25%); Rf
0.29 (1:9 MeOH:CH2Cl2); m.p. 137-140
oC; δH (300 MHz, CDCl3): 8.35 (1H,d, J
5.8 Hz, H2’), 7.96 (1H, d, J 8.9 Hz, H5’),
7.43(1H, d, J 3.0 Hz, H8’) 7.27 (1H, dd, J
3.0 Hz, 8.9, H6’), 6.33 (1H, d, J 5.8 Hz,
H3’), 5.57 (1H, d, J 8.2 Hz, H16), 5.0 (1H,
t, J 7.3 Hz, H24), 4.30 (1H, m, H11), 3.65
(1H, m, H3), 2.97 (1H, m, H13), 2.84 (2H,
m, H9’), 2.51( 2H, m, H11’), 2.38-2.46 (2H, m, H22), 2.19 (1H, m, H5), 2.03-2.11 (2H, m, H23), 1.85-2.33
(2H, m, H12), 1.27-2.14 (2H, m, H15), 1.86 (3H, s, acetyl), 1.72(2H, m, H10’), 1.51-2.17 (2H, m, H1), 1.69
(3H, s, H27), 1.55 (3H, s, H26), 1.58 (1H, m, H4), 1.57 (1H, m, H9), 1.12-1.74 (2H, m, H7), 1.13-1.59 (2H,
162
m, H6), 1.33 (3H, s, H30), 0.84-0.92 (9H, m, H18+19+28); δC (75 MHz, CDCl3): 173.4, 170.8, 153.2, 151.7,
149.9, 148.3, 136.1, 133.0, 130.6, 129. 1, 127.2, 124.0, 124.9, 117.9, 114.1, 75.0, 72.7, 69.7, 50.8,
49.2, 47.9, 46.3, 42.8, 41.3, 40.5, 39.4, 38.1, 37.6, 36.9, 35.2, 34.6, 33.5, 30.2, 31.3, 29.6, 28.1, 25.8,
24.9, 22.8, 20.4, 19.1, 18.0, 16.9, 14.8; LRMS (ESI) m/z 749.48 [M+H+]; HPLC purity: > 95% (tr = 5.29
min).
N-(7-chloroquinolin-4-yl)-butanoyl fusidic acid amide (AW25)
Yellow crystals (107 mg, 50%) Rf
0.29 (1:9 MeOH:CH2Cl2); m.p.
164-167 oC; δH (400 MHz, CDCl3):
8.24 (1H,d, J 5.9 Hz, H2’), 8.17
(1H, d, J 9.0 Hz, H5’), 7.91 (1H, d, J
3.2 Hz, H8’) 7.20 (1H, dd, J 3.2 Hz,
9.0, H6’), 6.33 (1H, d, J 5.9 Hz,
H3’), 5.73 (1H, d, J 8.2 Hz, H16),
4.98 (1H, t, J 7.3 Hz, H24), 4.27
(1H, m, H11), 3.75 (2H, m, H12’),
3.66 (1H, m, H3), 3.23 (2H, m, H9’), 2.88 (1H, m, H13), 2.36-2.45 (2H, m, H22), 2.11 (1H, m, H5), 2.11-
2.19 (2H, m, H23), 1.85-2.33 (2H, m, H12), 1.30-2.19 (2H, m, H15), 1.92 (3H, s, acetyl), 1.51-2.17 (6H, m,
H1+H10’+H11’), 1.55 (3H, s, H27), 1.46 (3H, s, H26), 1.58 (1H, m, H4), 1.57 (1H, m, H9), 1.21-1.68 (2H, m,
H7), 1.13-1.59 (2H, m, H6), 1.36 (3H, s, H30), 0.90 (3H, s, H19), 0.85 (3H, d, J 6.2 Hz, H28), 0.81 (3H, s,
H18); δC (75 MHz, CDCl3): 172.8, 171.0, 153.6, 150.4, 149.3, 148.0, 137.3, 133.8, 131.2, 129. 6, 128.1,
125.1, 124.5, 118.0, 114.7, 74.2, 73.1, 70.7, 51.1, 49.0, 48.0, 46.1, 42.7, 41.0, 40.3, 39.1, 38.0, 37.5,
37.0, 36.2, 34.0, 33.1, 30.8, 31.6, 30.2, 28.5, 26.1, 25.7, 23.2, 20.9, 19.9, 17.8, 17.0, 15.0; LRMS (ESI)
m/z 749.48 [M+H+]; HPLC purity: > 95% (tr = 4.99 min).
163
N-(7-chloroquinolin-4-yl)-propanoyl fusidic acid amide (AW31)
Yellow crystals (155 mg, 55%) Rf 0.30
(1:9 MeOH:CH2Cl2); m.p. 151-154 oC; δH
(400 MHz, CDCl3) 8.32 (1H,d, J 6.2 Hz,
H2’), 8.02 (1H, d, J 9.1 Hz, H5’), 7.78(1H,
d, J 3.2 Hz, H8’) 7.21 (1H, dd, J 3.2 Hz,
9.1 Hz, H6’), 6.39 (1H, d, J 6.2 Hz, H3’)
5.81 (1H, d, J 8.2 Hz, CH16), 5.0 (1H, t, J
7.3 Hz, H24), 4.29 (1H, m, H11), 3.62
(2H,m, H11’), 3.1 (2H, m, H9’), 3.39 (1H,
m, H3), 2.9 (1H, m, H13), 2.32-43 (2H, m, H22), 2.11 (1H, m, H5), 2.03-2.09 (2H, m, H23), 1.85-2.33 (2H,
m, H12), 1.30-2.19 (2H, m, H15), 1.97 (3H, s, acetyl), 1.51-2.17 (2H, m, H1+H10’), 1.62 (3H, s, H27), 1.6
(3H, s, H26), 1.58 (1H, m, H4), 1.57 (1H, m, H9), 1.14-1.73 (2H, m, H7), 1.13-1.59 (2H, m, H6), 1.34 (3H,
s, H30), 0.93 (3H, s, H19), 0.89 (3H, d, J 6.2 Hz, H28), 0.8 (3H, s, H18); δC (75 MHz, CDCl3): 174.6, 170.3,
154.0, 151.6, 149.9, 146.7, 135.7, 133.9, 130.5, 131.4, 128.0, 124.4, 122.8, 118.9, 113.0, 75.2, 71.9,
69.3, 49.3, 48.3, 45.3, 44.2, 41.0, 39.2, 38.5, 37.3, 36.1, 35.8, 34.8, 32.7, 31.1, 30.6, 29.6, 28.2, 27.6,
25.0, 24.6, 23.1, 21.2, 20.6, 18.1, 17.3, 15.0; LRMS (ESI) m/z 735.42 [M+H+]; HPLC purity: > 95% (tr =
5.42 min).
N-(6-methoxyquinolin-8-yl)-pentanoyl fusidic acid amide (AW33)
Bright yellow crystals (73 mg, 25%)
Rf 0.57 (1:9 MeOH:CH2Cl2); m.p. 107-
110 oC: δH (400 MHz, CDCl3): 8.53
(1H, dd, J 4.1 Hz, 1.8 Hz, H2’), 7.91
(1H, d, J 8.0 Hz, H4’ ), 7.39 (1H, m,
H3’), 6.33 (2H, d, J 4.9 Hz, H5’+7’),
5.75 (1H, d, J 8.2 Hz, H16), 5.05 (1H,
t, J 7.0 Hz, H24), 4.30 (1H, m, H11),
3.89 (3H, s, OMe) 3.60 (1H, m, H3),
2.84 (1H, m, H13), 3.4(2H, m, H13’),
3.2 (1H, m, H11’), 2.46 (2H, m, H22),
2.11 (1H, m, H5), 2.05-2.18 (2H, m, H23), 1.88-2.36 (2H, m, H12), 1.30-2.19 (2H, m, H15), 1.95 (3H, s,
164
acetyl), 1.51-2.17 (2H, m, H1), 1.64 (3H, s, H27), 1.60 (3H, s, H26), 1.58 (1H, m, H4), 1.57 (1H, m, H9),
1.35 (3H, s, H30), 1.53 (2H, m, H12’), 1.48 (2H, m, H9’), 1.27 (3H, s, H10’), 1.21-1.74 (2H, m, H7), 1.13-
1.59 (2H, m, H6), 0.95 (3H, s, H19), 0.90 (3H,s, H28), 0.88 (3H, s, H18); δC (75 MHz, CDCl3): 173.6, 171.1,
159.7, 151.3, 147.3, 146.3, 137.2, 135.0, 134.7, 133.2, 130.4, 124.2, 123.1, 101.3, 100.4, 75.7, 72.0,
69.2,56.9, 51.8, 50.9, 49.8, 45.3, 41.6, 40.5, 39.3, 37.4, 36.9, 36.0, 35.8, 34.6, 32.0, 30.9, 29.3, 28.1,
27.6, 26.3, 25.0, 24.2, 23.9, 23.1, 21.0, 20.5, 18.2, 17.1, 15.5; LRMS (ESI) m/z 759.50 [M+H+]; HPLC
purity: > 95% (tr = 8.44 min).
N-(7-chloroquinoline-4-yl)-pentanoyl fusidic acid amide (AW45)
Pale yellow crystals (265 mg, 90%)
Rf 0. 29 (1:9 MeOH:CH2Cl2); m.p.
143-146 oC; δH (400 MHz, CDCl3):
8.31 (1H,d, J 5.8 Hz, H2’), 8.01 (1H,
d, J 9.2 Hz, H5’), 7.87 (1H, d, J 3.0
Hz, H8’) 7.19 (1H, dd, J 3.0 Hz, 9.2,
H6’), 6.26 (1H, d, J 5.8 Hz, H3’), 5.65
(1H, d, J 8.2 Hz, H16), 4.97 (1H, t, J
7.1 Hz, H24), 4.26 (1H, m, H11), 3.66
(1H, m, H3), 3.27 (2H, m, H9’), 2.87
(1H, m, H13), 2.81 (2H, m, H12’), 2.68 (2H, m, H13’), 2.37-41 (2H, m, H22), 2.11 (1H, m, H5), 2.03-2.15
(2H, m, H23), 1.25-2.34 (2H, m, H12), 1.32-2.21 (2H, m, H15), 1.95 (3H, s, acetyl), 1.54-2.24 (6H, m,
H1+10’+11’), 1.59 (3H, s, H27), 1.47 (3H, s, H26), 1.57 (1H, m, H4+H9), 1.14-1.76 (2H, m, H7), 1.15-1.61 (2H,
m, H6), 1.26 (3H, s, H30), 1.06 (3H, s, H19), 0.90 (3H, d, J 6.2 Hz, H28), 0.85 (3H, s, H18); δC (75 MHz,
CDCl3): 174.3, 171.1, 154.3, 151.3, 150.7, 133.6, 132.6, 130.4, 129.8, 129.0, 127.0, 124.2, 123.1,
119.7, 115.2, 74.5, 71.5, 68.3, 49.3, 48.8, 45.1, 44.3, 42.6, 39.5, 39.0, 37.0, 36.3, 36.2, 35.6, 33.0,
32.3, 31.1, 30.3, 29.9, 28.8, 28.4, 26.4, 25.2, 23.8, 23.0, 21.1, 20.5, 18.3, 17.5, 16.2; LRMS (ESI) m/z
763.45 [M+H+]; HPLC purity: > 95% (tr = 5.32 min).
165
6.1.6 General synthetic procedure for fusidic acid esters
A solution of fusidic acid (200 mg, 0.39 mmol) and EDCI (150 mg, 0.97 mmol) was stirred in DMF (8
ml) at 25 oC and the solution was left to stir for 15 minutes. In a separate round bottom flask, DMAP
was added (118 mg, 0.97 mmol) to the alcohol (0.42 mmol) dissolved in DMF (2 ml) and stirred for
10 minutes. The solution containing the alcohol was then added dropwise to the flask containing the
acid, and the resulting reaction mixture was stirred at 25 oC for 15 hours. The reaction was
monitored by TLC and after completion, 15 ml of 20% MeOH/CH2Cl2 was added to the reaction
mixture which was then was washed with saturated aqueous NaHCO3 (2 x 15 ml) followed by
saturated aqueous NaCl (2 x 15 ml) and dried over MgSO4. The solvent was evaporated in vacuo and
purification of the resulting crude residue using column chromatography (10% MeOH/CH2Cl2)
afforded the esters in moderate yields (69-85%).
2-(7-chloroquinolin-4-ylamino)-ethanoyl fusidic acid ester (AW32)
White crystals (192 mg, 69%) Rf 0.29
(1:9 MeOH:CH2Cl2); m.p. 87-90 oC; δH
(400 MHz, CDCl3): 8.40 (1H,d, J 5.8
Hz, H2’), 8.15 (1H, d, J 8.9 Hz, H5’), 7.89
(1H, d, J 3.1 Hz, H8’), 7.60 (1H, dd, J 3.1
Hz, 8.9 Hz, H6’), 6.46 (1H, d, J 6.0 Hz,
H3’), 5.79 (1H, d, J 8.4 Hz, H16), 5.07
(1H, t, J 7.0 Hz, H24), 4.30 (1H, m, H11),
3.69 (1H, m, H3), 3.21-3.61 (4H, m,
H9’+ H10’) 3.16 (1H, m, H13), 2.31-2.39 (2H, m, H22), 2.11 (1H, m, H5), 2.07-2.17 (2H, m, H23), 1.84-2.32
(2H, m, H12), 1.33-2.21 (2H, m, H15), 1.94 (3H, s, acetyl), 1.51-2.16 (2H, m, H1), 1.65 (3H, s, H27), 1.61
(3H, s, H26), 1.58 (1H, m, H4), 1.57 (1H, m, H9), 1.09-1.69 (2H, m, H7), 1.13-1.59 (2H, m, H6), 1.31 (3H,
s, H30), 0.93 (3H, s, H19), 0.90 (3H, d, J 6.2 Hz, H28), 0.88 (3H, s, H18); (API) δC (75 MHz, CDCl3): 174.0,
170.6, 153.5, 150.6, 149.5, 148.9, 136.1, 133.4, 131.2, 128. 0, 127.2, 125.7, 124.9, 119.5, 113.0,
75.3, 72.7, 70.1, 50.8, 50.2, 47.5, 45.9, 43.1, 40.7, 40.0, 37.6, 36.1, 35.3, 34.9, 33.6, 31.8, 30.4, 32.2,
28.6, 26.3, 25.2, 23.1, 20.6, 19.0, 17.9, 16.3, 14.6; LRMS (ESI) m/z 722.39 [M+H+]; HPLC purity: > 95%
(tr = 6.73 min).
166
3-(7-chloroquinolin-4-ylamino)-propanoyl fusidic acid ester (AW42)
Pale white crystals (211 mg, 74%) Rf
0.28 (1:9 MeOH:CH2Cl2); m.p. 101-104
oC; δH (400 MHz, CDCl3): 8.39 (1H,d, J
6.1 Hz, H2’), 8.19 (1H, d, J 9.2 Hz, H5’),
7.88 (1H, d, J 2.0 Hz, H8’), 7.59 (1H, dd,
J 2.0 Hz, 9.2 Hz, H6’), 6.37 (1H, d, J 6.1
Hz, H3’), 5.78 (1H, d, J 8.4 Hz, H16), 5.04
(1H, t, J 7.2 Hz, H24), 4.28 (1H, m, H11),
3.63 (1H, m, H3), 3.35-3.57 (4H, m, H11’)
3.03 (1H, m, H13), 2.98 (1H, m, H9’), 2.39-2.43 (2H, m, H22), 2.11 (1H, m, H5), 2.12-2.17 (2H, m, H23),
1.88-2.37 (2H, m, H12), 1.34-2.19 (2H, m, H15), 1.93 (3H, s, acetyl), 1.51-2.17 (4H, m, H1+H10’), 1.60
(3H, s, H27), 1.58 (1H, m, H4), 1.57 (1H, m, H9), 1.52 (3H, s, H26), 1.14-1.75 (2H, m, H7), 1.5-1.62 (2H, m,
H6), 1.49 (3H, s, H30), 1.31 (3H, s, H19), 0.90 (3H, d, J 6.2 Hz, H28), 0.84 (3H, s, H18); δC (75 MHz, CDCl3):
173.9, 170.0, 154.3, 150.6, 149.7, 147.4, 136.1, 134.8, 131.9, 132.4, 129.3, 124.0, 123.5, 119.3,
113.7, 75.0, 73.8, 71.0., 50.2, 48.1, 46.5, 44.0, 41.9, 40.8, 38.1, 37.6, 36.3, 35.0, 34.1, 33.6, 31.9,
30.0, 29.3, 28.2, 26.5, 25.4, 24.0, 23.4, 21.0, 19.3, 18.7, 16.3, 14.9 ; LRMS (ESI) m/z 736.38 [M+H+];
HPLC purity: > 95% (tr = 6.99 min).
4-(7-chloroquinoline-4-ylamino)-butanoyl fusidic acid ester (AW34)
White crystals (238 mg, 82%) Rf
0.28 (1:9 MeOH:CH2Cl2); .m.p.
80-84 oC; δH (400 MHz, CDCl3):
8.37(1H,d, J 6.0 Hz, H2’), 8.09
(1H, d, J 8.9 Hz, H5’), 7.83 (1H, d,
J 3.3 Hz, H8’) 7.18 (1H, dd, J 3.3
Hz, 9.2 Hz, H6’), 6.40 (1H, d, J 6.0
Hz, H3’) 5.85 (1H, d, J 7.9 Hz H16),
5.15 (1H, t, J 7.0 Hz, H24), 4.34
(1H, m, H11), 3.71 (2H,m, H12’),
3.40 (1H, m, H3), 3.14 (2H, m, H9’), 2.97 (1H, m, H13), 2.39-2.44 (2H, m, H22), 2.11 (1H, m, H5), 2.09-
2.15 (2H, m, H23), 1.83-2.31 (2H, m, H12), 1.35-2.22 (2H, m, H15), 2.02 (3H, s, acetyl), 1.53-2.19 (6H, m,
H1+H10’+ H11’), 1.65 (3H, s, H27), 1.59 (3H, s, H26), 1.58 (1H, m, CH4), 1.57 (1H, m, H9), 1.13-1.71 (2H, m,
167
H7), 1.13-1.59 (2H, m, H6), 1.35 (3H, s, H30), 1.06 (3H, s, H19), 0.93 (3H, d, J 6.2 Hz, H28), 0.86 (3H, s,
H18); δC (75 MHz, CDCl3): 173.8, 171.6, 153.3, 151.4, 150.2, 148.6, 136.3, 134.1, 132.2, 130. 5, 129.3,
126.1, 124.3, 119.3, 115.7, 75.9, 74.2, 70.3, 50.7, 49.0, 47.9, 46.4, 43.1, 40.7, 40.5, 39.3, 38.2, 37.6,
37.0, 35.1, 34.6, 33.8, 32.7, 31.5, 30.4, 29.3, 28.5, 26.3, 24.2, 20.1, 19.4, 18.2, 17.6, 15.3; LRMS (ESI)
m/z 750.42 [M+H+]; HPLC purity: > 95% (tr = 7.02 min).
5-(7-chloroquinolin-4-ylamino)-pentanoyl fusidic acid ester (AW35)
Yellow crystals (253 mg, 85%) Rf
0.43(1:9 MeOH:CH2Cl2); m.p. 77-
80 oC; δH (400 MHz, CDCl3): 8.33
(1H,d, J 6.0 Hz, H2’), 8.11 (1H, d, J
9.1 Hz, H5’), 7.90 (1H, d, J 3.2 Hz,
H8’) 7.24 (1H, dd, J 3.2 Hz, 9.1 Hz,
H6’), 6.39 (1H, d, J 6.0 Hz, H3’), 5.77
(1H, d, J 8.4 Hz, H16), 5.02 (1H, t, J
7.3 Hz, H24), 4.28 (1H, m, H11), 3.78
(2H, m, H13’), 3.58 (1H, m, H3),
3.36 (2H, m, H9’), 2.98 (1H, m, H13), 2.81 (2H, m, H12’), 2.41-2.53 (2H, m, H22), 2.11 (1H, m, H5), 2.09-
2.15 (2H, m, H23), 1.85-2.33 (2H, m, H12), 1.31-2.17 (2H, m, H15), 1.91 (3H, s, acetyl), 1.51-2.26 (8H, m,
H1+H10’+H11’+H12’), 1.60 (3H, s, H27), 1.59 (1H, m, H4+H9), 1.51 (3H, s, H26), 1.12-1.74 (2H, m, H7), 1.13-
1.59 (2H, m, H6), 1.21 (3H, s, H30), 1.06 (3H, s, H19), 0.90 (3H, d, J 6.2, H28), 0.86 (3H, s, H18); δC (75
MHz, CDCl3): 173.6, 170.3, 153.5, 150.7, 148.2, 135.4, 133.1, 132.4, 130.2, 129.1, 128.7, 123.8, 122.7,
118.1, 116.0, 75.3, 72.6, 69.7, 53.3, 49.1, 46.3, 45.0, 43.6, 41.3, 40.0, 38.2, 37.1, 36.4, 35.2, 33.5,
32.3, 31.0, 30.2, 29.6, 28.9, 28.0, 27.4, 26.1, 24.3, 23.6, 21.8, 20.0, 19.2, 17.9, 15.2; LRMS (ESI) m/z
764.44 [M+H+].; HPLC purity: > 95% (tr = 7.20 min).
168
6.2 Biology experimental section
6.2.1 Turbidimetric Solubility6
Solubility of the test compounds was determined using the turbidimetric method described by
Bevan and Lloyd.7 Stock solutions of test and control compounds were prepared by dissolving an
accurately weighed amount of each in HPLC-grade DMSO to a 10 mM concentration. Pre-dilutions of
the stock solutions, also in DMSO, were then prepared in clear, v-shaped bottom 96-well
polystyrene microtitre plates as illustrated in Figure 6.1.
Compound 1
(triplicate)
Compound 2
(triplicate)
Compound 3
(triplicate)
Compound 4
(triplicate)
Conc.
(mM) 1 2 3 4 5 6 7 8 9 10 11 12
0 A
0.25 B
0.5 C
1.0 D
2.0 E
4.0 F
8.0 G
10.0 H
Figure 6.1: Layout of turbidimetric solubility assay compound pre-dilution plate
For this, each stock solution was diluted serially in triplicate by first pipetting 20 μl DMSO into wells
in row G on the plate and 50 μl DMSO to the wells in the rows above (i.e. rows F, E, D…A). 80 μl of
the 10 mM stock solutions was then pipetted to the wells in row G and mixed to give a starting
concentration of 8 mM (100 μl). Serial dilution of this solution was achieved by subsequently
transferring 50 μl to the well in the row above (Row F) from Row F through to B. The final pre-
dilution concentrations obtained ranged from 0.25 mM (Row B) to 8.0 mM (Row G). All wells in Row
A contained only DMSO, while those in Row H contained the undiluted 10 mM stock solution.
From each pre-dilution solution, secondary dilutions of the compounds in both DMSO and 0.01M pH
7.4 phosphate buffered saline (PBS) were prepared in a second 96-well plate, also in triplicate
(Figure 6.2). Wells in columns 1-6 contained the test compound dissolved in DMSO while those in
169
columns 7-12 contained the same compound and concentration dissolved in PBS. The final volume in
each well was 200 μl, prepared by pipetting 4 μl each of solution from the pre-dilution plate to the
corresponding well into both DMSO and PBS (both 196 μl). The final concentration of DMSO in the
PBS aqueous buffer preparations was therefore 2% v/v. The concentrations of test compounds in
DMSO served as controls to determine potential false turbidimetric absorbance readings arising
from the compounds in solution absorbing radiation at the analysis wavelength.
DMSO 0.01M pH 7.4 PBS
Compound 1
(triplicate)
Compound 2
(triplicate)
Compound 1
(triplicate)
Compound 2
(triplicate)
Conc. (M) 1 2 3 4 5 6 7 8 9 10 11 12
0 A
5 B
10 C
20 D
40 E
80 F
160 G
200 H
Figure 6.2: Turbidimetric solubility assay plate layout
The plates were covered and left to equilibrate for 2 hrs at ambient temperature, after which UV-VIS
absorbance readings were measured at 620 nm using a SpectraMax 340PC384 microplate reader
(Molecular Devices, Sunnydale, CA). Absorbance from the wells containing only DMSO and 2% v/v
DMSO in PBS (0 μM in plate layout, Row A) served as controls and blanks. At concentrations above
the limit of solubility, undissolved particles precipitated out of solution, occluding incident radiation,
resulting in increased apparent absorbance. Therefore, the concentration at which increased
absorbance was noted was deemed the approximate solubility of the compounds. Reserpine and
hydrocortisone were used as minimum and maximum solubility standards respectively, as
established by reports from literature.7
170
6.2.2 Bacterial strains and growth conditions
For all the experiments carried out, the strain of M. smegmatis (Msm) used was M. smegmatis
mc21558, while that of Mtb was M. tuberculosis H37Rv (MA)9, from stocks maintained by the
Molecular Mycobacteriology Research Unit (MMRU) at -80 oC. In the case of Msm, the stocks were
stored in 33% glycerol (v/v). All culturing and manipulations of Mtb were performed in a
Biosafety Level 3 laboratory, in a Class II flow cabinet at negative pressure (160 - 170 kPa).
Table 6.3: Bacterial strains used in this study
Strain Description/Genotype Reference/Source
Mycobacterium smegmatis
(Msm) mc2155
High frequency transformation
mutant of Msm ATCC 706 Snapper et al, 1990
Mycobacterium tuberculosis
(Mtb) H37Rv(MA)
Virulent reference laboratory
strain of Mtb ATCC 27294 Ioerger et al, 2010
Unless otherwise specified, strains were cultured in Middlebrook 7H9 (Difco™) broth enriched with
10% oleic acid-dextrose-catalase (OADC) (Difco™), 0.5% glycerol and 0.05% Tween® 80. The agar
used for raising colonies was Middlebrook 7H10 (Difco™) medium supplemented with 10% OADC
and 0.5% glycerol. Growth medium was sterilised by autoclaving at 121 oC for 15 minutes and, in the
case of liquid broth, additionally filtered using filtration flasks fitted with 0.22 µm filter membranes.
Glycerol-alanine salts supplemented with iron and Tween®80 (GAST/Fe) was made up using the
recipe outlined below, and the medium was sterilised by filtration using filtration flasks fitted with
µm filter membranes.
6.2.2.1 Culture media
All media were made to a final volume of 1L with distilled water. Media were sterilized by
autoclaving at 121 °C for 15 min, except GAST/Fe which was sterilised by filtration.
7H9/OADC
4.7 g Middlebrook 7H9 broth powder (DifcoTM, USA), 2 ml glycerol (Merck, Germany)
100 ml OADC Middlebrook Enrichment (BD Microbiology Systems, USA) added after autoclaving.
Tween®80 was added to 0.05%.
171
GAST/Fe
0.3 g of Bacto Casitone (Difco); 4.0 g of dibasic potassium phosphate; 2.0 g of citric acid; 1.0 g of L-
alanine; 1.2 g of magnesium chloride hexahydrate; 0.6 g of potassium sulfate; 2.0 g of ammonium
chloride; 0.05 g of ferric ammonium citrate; 1.8 ml of 10M NaOH; 10 ml of glycerol; Tween®80 was
added to 0.05% and pH adjusted to 6.6.
7H10/OADC agar
19 g Middlebrook 7H10 agar powder (DifcoTM, USA), 5 ml glycerol (Merck, Germany)
100 ml Middlebrook OADC Enrichment (BD Microbiology Systems, USA) added after autoclaving.
Msm liquid cultures were grown at 37 oC in a shaking incubator while Mtb liquid cultures were
placed flat in non-shaking incubators. All culturing and manipulation of Mtb strains was performed
in a Biosafety Level 3 laboratory in Class II flow cabinets at negative pressure.
6.2.2.2 Antimycobacterial screening: The Minimum Inhibitory Concentration (MIC) of FA against
Msm and Mtb
Drug susceptibility testing by broth microdilution using the Microplate Alamar Blue Assay (MABA)
The determination of the MIC of FA was conducted by broth microdilution method, using the
Microplate Alamar Blue Assay (MABA). The broth microdilution method enables the determination
of the minimum inhibitory concentration (MIC) of compounds over a range of concentrations on a
single 96-well microtitre plate.10,11 In the MABA assay, metabolic activity of the cell correlates with
the reduction of resazurin to resorufin, and the resulting change in colour from blue to pink and
fluorescent, allowing visual detection and fluorometric or colorimetric quantification. Wells with
non-viable cells thus remain blue while those with viable cells exhibit pink colouration. For the
experiments reported, visual detection was used to assess growth and growth inhibition. Prior to
addition of alamar blue (at day 3 in the case of Msm and day 7 for Mtb), growth and inhibition was
assessed by visual inspection for pellet formation.
Briefly, a 10 ml culture of Mtb was grown to an OD600 of 0.6 – 0.7. The culture was then diluted
1:500 (in the case of Mtb) or 1:1000 (in the case of Msm) in 7H9/OADC. In a 96- well, U-bottom
microtitre plate (PGRE650180, Lasec, SA), 50 μl of 7H9/OADC was added to all wells from Rows 2-12.
The compounds to be tested were added to Row 1 at a final concentration of 8 × MIC90 (for
compounds with pre-determined or estimated MIC values) and serially diluted, 2-fold, using a
172
multichannel pipette, by transferring 50 μl of the liquid in Row 1 to Row 2 and aspirating to mix. 50
μl of the liquid in Row 2 was transferred to Row 3 and aspirated. The procedure was repeated until
Row 11 was reached, where 50 μl of the liquid in Row 11 was discarded to bring the final volume in
these wells to 50 μl. In Row 12, 1 mg/ml of RIF or INH was used as the control for maximal inhibition.
Finally, 50 μl of the diluted culture was added to all the wells. The microtitre plate was stored in a
secondary container and incubated at 37 °C for 3 days (Msm) and 14 days (Mtb). On Day 3 (Msm)
and Day 14 (Mtb) alamarBlue® (BUF012B, Celtic Molecular Diagnostics) was added to each well and
plates were incubated at 37 °C for 6 hours or 24 hours, respectively (in the case of Msm, in plastic
Ziploc® bags, while in the case of Mtb, with 5% CO2) without shaking. The MIC results registered
were calculated, defined as the lowest concentration of compound that inhibited visible growth. The
lowest concentration of drug which prevented the colour change of alamar blue (from blue to pink)
was considered the MIC that inhibited more than 90% of the bacterial population (MIC90).
173
6.3 Assessment of the effect of transcriptional silencing of fusA1 on the susceptibility of Mtb to FA
and selected analogues using the checkerboard assay 12
An adapted form of the checkerboard assay was used to assess the effect of transcriptional silencing
of fusA1 on the susceptibility of Mtb to FA and selected analogues. This assay applied the broth
microdilution method, whereby anhydrotetracycline (ATc, compound A) and FA/ selected
analogues (compound B), were serially diluted 2-fold across and down the plate, respectively13
(Figure 6.3).
1 2 3 4 5 6 7 8 9 10 11 12
A
Min
imu
m in
hib
itio
n
Maxim
um
inh
ibitio
n
B
C
D
E
F
G
H
Figure 6.3: Layout of checkerboard assay 96-well microtitre plate
Briefly, 50 μl media was added to every well in the plate, except Row 1 and 12 (minimum and
maximum inhibition controls, respectively). Additional 50 μl media was added to row B3-B11, and
column 2A-2H, and 100 μl to well B2. From 10 mM stock solutions, dilutions of FA and the FA
analogues were made to a concentration 400x MIC and ATc to a concentration of 1 µg/ml. 2 μl of
FA/FA analogue (compound B) was added to the wells B3-B11 and serially diluted (50 μl) to H (50 μl
was discarded from H). 4μl of the same compound B was added to well B2 and serially diluted (100
μl) down column 2 (100 μl was discarded form 2H). Finally, 2 μl of ATc (compound A) was added to
every well in column 3 and serially diluted (50 μl) from column 2 to column 3 until column 11 (50 μl
Compound A (ATc)
Co
mp
ou
nd
B
174
was discarded from 11). Finally, 50 μl Mtb culture was added to every well. RIF at a final
concentration of 0.2 μM (50 × MIC) was used as the maximum inhibition control, while drug-free
7H9 served as the minimum inhibition control and well A2 served as a “no drug” control. The
microtitre plates were stored in secondary containers and incubated at 37°C for 13 days, after which
10 μl of alamar blue (Celtic Molecular Diagnostics) was added to each well. After incubation for 24
hr, the MIC results registered were calculated, defined as the lowest concentration of compound
that inhibited visible growth. The lowest concentration of drug which prevented the colour change
of alamar blue (from blue to pink) was considered the MIC that inhibited more than 90% of the
bacterial population (MIC90).
6.4 Generation of spontaneous resistant mutants
6.4.1 Generation of FA-resistant mutant strains of Msm
To generate FA-resistant (FAR) strains of Msm, the MIC of FA in 7H9 medium was established as 41.6
μg/ml (80 μM). A 10 ml culture of Msm was grown in 7H9 medium at 37 oC in a shaking incubator to
an OD600 of 1.0, which corresponds to a cell density of approximately 5-9 x 108 CFU/ml. The culture
was adjusted to a concentration of 109 CFU/ml by centrifugation at 4200 rpm for 10 minutes, 20 oC
and resuspended in 1 ml of 7H9 medium.
A second attempt was made following the above protocol, with higher concentrations of FA as
follows: 50x MIC (4.05 mM) and 100x MIC (8.1 mM). After incubation for 5 days, four colonies arose
at 50x MIC, while there was no visible growth in the plates containing 100x MIC of FA. The colonies
were isolated and inoculated into 200 μl of 7H9 medium, then incubated at 37 oC with shaking at
120 rpm overnight. These were then passaged into fresh 10 ml of 7H9 and incubated at 37 oC with
shaking overnight. 1 ml aliquots of the log-phase cultures were made up to 33% glycerol and stored
at -80 oC, while the remaining cultures were used to screen the colonies for the MIC of FA.
6.4.2 Generation of FAR Mtb mutants
To generate FAR strains of Mtb, the MIC of FA in 7H9 medium was established as 2.5 μg/ml (5 μM). A
10 ml culture of Mtb was grown in 7H9 medium at 37 oC in a shaking incubator to an OD600 of 1.0,
which corresponds to a cell density of approximately 5-9 x 108 CFU/ml. The culture was adjusted to a
concentration of 109 CFU/ml by centrifugation at 4200 rpm for 10 minutes, 20 oC and resuspended in
1 ml of 7H9 medium. A 100 μl aliquot of this was spread onto 7H10 agar plates containing FA at the
following concentrations above MIC in duplicate: 5X MIC (25 μM), 10X MIC (50 μM) 15X MIC (75
μM), 20X MIC (100 μM) and 25X MIC (125 μM). Two controls were plated; 7H10 plates containing
175
RIF at a concentration of 2 g/ml and standard 7H10 plates (without drug) consisting of serially
diluted culture, from 100 to 10-7, also in duplicate. After spreading the inoculum using sterile loops,
the plates were left to dry for an hour at ambient temperature before storing in plastic sleeves at 37
oC for 21 days. At the end of the incubation period, single colonies arose at several concentrations of
FA: 10X MIC, 20X MIC and 25X MIC. Single colonies were isolated and inoculated in 200 l of 7H9
medium and incubated for 5 days at 37 oC in a shaking incubator then passaged into 10 ml of fresh
medium, with subsequent incubation under similar conditions. Within 5 days, the cultures had
reached mid-log phase and 1 ml aliquots of undiluted culture were stored at -80 oC for further use.
The remaining cultures were used to screen against FA to establish the shift in MIC.
In addition to FA, selected FA analogues as well as a panel of standard anti-TB drugs and
experimental compounds were also tested against wild-type and GKFA isolates of Mtb to identify
any potent compounds against the GKFA isolates.
DNA was extracted from the GKFA isolate and subjected to both whole genome and targeted
sequencing. Mtb fusA (EF-G) was amplified by PCR and sequenced against wild-type Mtb H37Rv
(MA) as the reference strain.
6.4.3 DNA extraction, purification and amplification
6.4.3.1 CTAB (cetyltrimethylammonium bromide, ICN Biomedicals, Aurora, Ohio) genomic DNA
isolation from Msm and Mtb
The reagent CTAB, which lends its name to the DNA extraction procedure commonly applied in the
isolation of genomic DNA, was prepared as follows: 4.1 g NaCl was dissolved in 80 ml of Merck
Millipore-filtered distilled water (dH2O). While stirring, 10 g of N-cetyl-N, N, N-trimethyl ammonium
bromide (CTAB) was added. The solution was heated to 65 oC and the volume adjusted to 100 ml,
filter-sterilized while still warm and stored at room temperature.
6.4.3.2 DNA extraction procedure
A 10 ml culture of each of the mutant Msm or Mtb strains was grown to approximately 108 CFU/ml,
corresponding to an OD600 of 1.0. The culture was divided into two 5 ml aliquots which were
centrifuged at 3200 rpm, 4 oC for 10 minutes. The medium was discarded, and the pellet was
resuspended in 0.5 ml TE (1 mM Tris-HCl and 1 mM Na2EDTA, pH 7.4) buffer in 1.5 ml vials. 50 l of
10 mg/ml lysozyme was added and the vials incubated overnight in a shaking incubator at 37 oC.
176
The contents of each vial were mixed using a vortex machine, then 70 μl of 10% Sodium dodecyl
sulfate (SDS) and 6 μl of 10 mg/ml proteinase K were added. The resulting solutions were left to
shake at 300 rpm 60 oC in a thermomixer for one hour, after which 100 μl of pre-heated 5M NaCl
was added to each vial and mixed thoroughly by manually inverting each vial. 80 μl of 10% CTAB was
added next, and the suspension mixed thoroughly by inverting by hand. The vials were then
incubated at 60 oC for 15 minutes with low-mode (300 rpm) shaking in the thermomixer, frozen for
15 minutes at -80 oC then left to thaw at ambient temperature before a second cycle of low-mode
shaking in a thermomixer at 60 oC.
6.4.3.3 DNA harvesting
The vials were left to cool at ambient temperature for 10 minutes before 700 μl of chloroform:
isoamyl alcohol (24:1 v/v)was added to each vial (to degrade residual proteins), which was then
inverted by hand 25 times to form a white suspension consisting of an aqueous and organic phase.
The vials were then centrifuged at 13200 rpm at ambient temperature and the upper (aqueous)
phase was transferred to a vial containing 700 μl of ice-cold isopropanol. Each vial was tilted upside
down 5 times to ensure homogeneity of the mixture. The vials were left to stand at 4 oC overnight
for DNA to precipitate, after which they were centrifuged for 10 minutes at ambient temperature.
The supernatant was discarded and the pellets washed with ice-cold 70% ethanol before
centrifuging at 13200 rpm and ambient temperature for 10 minutes. The supernatant (ethanol) was
discarded and the vials set to dry under vacuum in a speedvac DNA concentrator at 16100 g for 20
minutes. 55 μl of dH2O was added to each vial, mixed by aspiration using a pipette tip and incubated
at 42 oC in a heating block for 10 minutes prior to analysis by gel electrophoresis.
6.4.3.4 DNA analysis
To ensure the quality, purity and size of the genomic DNA, gel electrophoresis was carried out using
1% agarose gel in TE buffer at ambient temperature. Gels were prepared using 1x TAE (40 mM Tris-
acetic acid, 1 mM Na2EDTA pH 8.0), agarose powder (Sigma-Aldrich) and 0.5 µg/ml ethidium
bromide. To prepare samples for electrophoresis, 2 μl of DNA, 8 μl of dH2O and 2 μl of
tracking/loading dye (0.025% bromophenol blue in 30% glycerol) were mixed using a pipette. To
make up a sample for each well, were mixed by pipetting and each loaded into individual wells in the
agarose gel. Fragment sizes were assessed using lambda DNA molecular weight marker IV; Roche
Applied Science, Germany). Gels were electrophoresed in a Mini-Sub Cell GT mini gel horizontal
submarine unit (Bio-Rad) at 100 volts, until dye markers had migrated an appropriate distance
177
allowing visualisation of the DNA. Visualization was performed under UV light using ta Gel Doc
(WealTeach Keta Imaging System). Once the purity and size were ascertained, the DNA samples
were stored at -20 oC awaiting whole genome sequencing, while in the case of targeted sequencing,
PCR amplification and subsequent purification using NucleoSpin gel and PCR clean-up kit was
carried out prior to sequencing.
6.4.4 PCR amplification of genomic DNA
All PCR reactions were carried out in the MyCycler™ thermal cycler (Bio-Rad) with
oligonucleotide primers purchased from the Molecular and Cell Biology Department, University
of Cape Town.
6.4.5 Sequencing
Targeted sequencing of PCR products was carried out as a pay-for service by the Central Analytical
Facilities at Stellenbosch University. Whole genome sequencing was performed by Professor Tom R.
Ioerger and James C. Sacchettini at the Department of Computer Science, Texas A&M University in
Texas, USA.
6.4.6 Targeted sequencing of MsmfusA1 and fusA2
In Msm, the translation elongation factor G (EF-G) is encoded by fusA1 (MSMEG_1400), while fusA2
(MSMEG_6535), which closely resembles fusA1, encodes EFG-2. Genomic DNA extracted from both
wild-type Msm and the four isolates was amplified and sequenced against both fusA1 and fusA2
using the following primers:
MsmfusA1 5’GCGTATCTGCTTCGTCAACA 3’ (forward primer)
MsmfusA1 5’ GATGCCGATGAAGTCGTTCT 3’ (reverse primer)
MsmfusA2 5’CTTCCTGCACTCTGTCCATA 3’ (forward primer)
MsmfusA2 5’ GCGCATGGATCTGATGTTCA 3’ (reverse primer)
For both fusA1 and fusA2, ~200 ng of the DNA template was used for each of four 50 μl reactions
containing 5 μl of 2 mM dNTPs, 1.5 μl of DMSO, 5 μl of buffer 10X with MgCl2), 5 μl of 10 μM each of
forward and reverse primers, 2 μl of Fastart Taq polymerase and dH20 to make up the volume to 50
μl. The reaction conditions included heating at 95 °C for 5 minutes, followed by 30 cycles of
incubations at 95 °C for 30 seconds, 65 °C for 30 s, 72 °C for 1 minute, and final extension at 72 °C for
7 minutes. The PCR products (2.1 kb for both genes) were analysed by gel electrophoresis using dye
178
markers III and IV for confirmation of appropriate size, then stored at -20 oC awaiting sequencing.
The PCR products were purified and sequenced at the Central Analytical Facilities at Stellenbosch
University as a pay-for service. Primers for sequencing were designed every 400 base pairs (bp),
starting and ending 100 bp upstream and downstream respectively (Appendix 2). The sequence data
were analysed using CLC Main Workbench version 7 to align the sequences of the strains generated,
using M. smegmatis mc2155 (wild- type) as the reference strain to identify Single Nuclear
Polymorphisms (SNPs).
6.4.7 Targeted sequencing of Mtb fusA1
MtufusA1 (Rv0684) which encodes EF-G in Mtb was amplified using the following primers:
MtufusA1 5’ CTACCACGAGGTTGACTCCT 3’ (forward primer)
MtufusA1 5’ GGTTGTATCTACTCGCCAGT 3’ (reverse primer)
~200ng of the DNA template was used for each of four 50 μl reactions containing 5 μl of 2 mM
dNTPs, 1.5 μl of DMSO, 5 μl of buffer 10x with MgCl2), 5 μl of 10 μM forward and reverse primers,
2 μl of Fastart Taq polymerase and dH2O to make up the volume to 50 μl. The reaction conditions
included heating at 95 °C for 5 minutes, followed by 30 cycles of incubations at 95 °C for 30 seconds,
61 °C for 30 s, 72 °C for 1 minute, and final extension at 72 °C for 7 minutes. The PCR products (2.1
kb) so obtained were analysed by gel electrophoresis using dye markers III and IV for confirmation of
appropriate size, then stored at -20 oC awaiting sequencing. Appendix 1 illustrates the wild-type and
FAR DNA amplicons. The PCR products were purified and sequenced at the Central Analytical
Facilities at Stellenbosch University, South Africa. Primers for sequencing were designed every 300
bp, starting and ending 100 bp upstream and downstream respectively (Appendix 2). The sequence
data was analysed using CLC Main Workbench version 7 to align the sequences of the strains
generated, using M. tuberculosis H37Rv (MA) (wild-type) as the reference strain to identify SNPs.
6.5 Competition assay
The assay was adapted from a method described by Bhatter et al.14 An aliquot each of the drug
susceptible (wild-type) and FAR strains was separately inoculated into 10 ml of 7H9 medium were
inoculated separately in two culture flasks, to achieve an OD600 that corresponds to an approximate
cell density of 105 CFU/ml. These served as controls to demonstrate the individual strains were not
retarded in growth. Simultaneously, aliquots of each strain in equal amounts (approximately 0.5 x
105 CFUs/ml each) were co-inoculated into a fresh flask containing 10 ml of 7H9 medium. The
separately inoculated cultures were serially diluted on days 0, 2, 4, 6, 8 and 14 and plated in
179
triplicate on agar plates (without FA). The mixed cultures were serially diluted and plated in triplicate
on 7H10 agar plates with and without FA at 10 µM on days 0, 2, 4, 6, 8 and 14. The agar plates were
incubated for 21 days before CFU enumeration.
6.5.1 Calculation of relative fitness
For each competition experiment, the mean of three CFUs was used to calculate the relative
competitive fitness. At each time point, the CFU counts on FA-containing plates indicated the
number of FAR cells in the mixed cultures. The number of susceptible cells was calculated by
subtracting the number of resistant cells from the total cell numbers revealed by CFU counts of the
drug-free agar plates. To calculate the relative competitive fitness W of the drug resistant strains,
the formula below was used:
W = ( ln(Rf ÷ Ri) ) ÷ (ln(Sf ÷ Si)
Ri and Si denote resistant and susceptible cells at day 0 respectively, while Rf and Sf denote resistant
and susceptible cells at day 14 respectively.
Total CFU = cells from mixed cultures plated on plain agar.
Resistant cells = cells from mixed cultures plated on FA-supplemented agar.
Susceptible cells: Total CFU – resistant cells
The results reported were the mean of two independent experiments.
6.6 Cytotoxicity assays
6.6.1 Cytotoxicity assay in CHO
Compounds were screened for in vitro cytotoxicity against Chinese Hamster Ovarian (CHO) cells, a
mammalian cell line, using the 3-(4,5-dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide (MTT)
assay. The MTT assay is a colorimetric assay for the assessment of cellular growth and survival which
compares well with other available assays.15,16 The tetrazolium salt MTT was used to measure all
growth and chemosensitivity. The test samples were tested in triplicate on one occasion.
Stock solutions of the test samples were prepared by dissolving each compound in 100% DMSO to a
concentration of 20 mg/ml, which were then stored at -20 oC until use. Dilutions were prepared on
the day of the experiment. Emetine, a second-line antiprotozoal drug with low cytotoxicity, was used
as the reference drug in all experiments. The initial concentration of emetine was 100 μg/ml, which
was serially diluted in complete medium with 10-fold dilutions to give 6 concentrations, the lowest
being 0.001 μg/ml. The same dilution technique was applied to the all test samples. The highest
concentration of solvent to which the cells were exposed had no measurable effect on the cell
viability. The values of the concentration that inhibited 50% of the cell population (IC50) were
180
obtained from full dose-response curves, using non-linear dose-response curve fitting analysis
generated using GraphPad Prism v.4 software.
6.6.2 Cytotoxicity in THP-1 cells
6.6.2.1 Maintenance of THP-1 cells
Cytotoxicity and intracellular drug efficacy studies were carried out using THP-1 cells (ATCC TIB-202)
from stocks maintained by the MMRU at -196 oC in liquid Nitrogen. These consisted of 1ml vials each
containing 1 x 105 cells/ml suspended in RPMI culture medium (Sigma-Aldrich) supplemented with
10% foetal bovine serum (FBS) or foetal calf serum (FCS). The FBS and FCS were procured heat-
inactivated and sterilized by filtration using 0.22 µm filters prior to addition to RPMI. 10% DMSO was
added as a cryopreservant. All experiments were carried out under sterile conditions in a biosafety
cabinet. Cells were passaged a maximum of 3 times and maintained without antibiotics and
antimycotics. Initial passage involved thawing a single vial of frozen stock of THP-1 cells thawed at
room temperature and added to 9 ml of culture medium in a vented T25 culture flask (Corning®).
The cell culture was incubated at 37 oC with 5% CO2. Every 3 days, cells were washed, counted and
split to achieve the appropriate volume of culture corresponding to the scale of the assays. To wash
the cells, cultures were centrifuged at 100 g or 150 g for 5 minutes at 20 oC then the old cell culture
medium was replaced with a fresh aliquot. To count cells, 10 µl of a 1:1 ratio of cell culture to trypan
blue® was added to each chamber in a counting slide, and counted using a TC20 ™ automated cell
counter (Bio-Rad). Only cultures with a minimum of 90% viability were used. Upon attaining a cell
count of 1 x 106 cells/ml, cultures were split into separate flasks containing an appropriate volume of
fresh medium, depending on the volume of culture required.
All assays were conducted in 96-well format (96-well flat-bottom microtiter plate (PGRE655180,
Lasec, SA), by seeding 100 µl of cell culture were a final count of 1 x 104 cells/ml per well. As the
outer wells are prone to evaporation, culture medium without cells was added to these wells. In
order for the cells to differentiate and adhere to the surface of the wells, the RPMI medium was
supplemented with phorbol myristate acetate (PMA) to a concentration of 200 nM, and the plates
were incubated over 24 hours. After cell differentiation, cells were washed twice with PBS, and cells
from representative wells were counted. To detach cells from the wells, 100 µl of chilled 5 mM EDTA
dissolved in PBS was added and the plates incubated for 15-20 minutes at room temperature prior
to cell counting.
181
6.6.3 Macrophage cytotoxicity assay
Two-fold serial dilution of the compounds was performed in RPMI medium to a final concentration
of 200 M for each compound. Each compound was tested in triplicate by adding 100 μl of RPMI
containing compound to each well. The assay plates were incubated for 72 hours, after which 20 μl
of alamar blue was added to each well. After 24 hours, the cells were assessed for growth and
inhibition by visual inspection, defined as the lowest concentration of compound that inhibited
visible growth. The lowest concentration of drug which prevented the colour change of alamar blue
(from blue to pink) was considered the MIC that inhibited more than 90% of the bacterial population
(IC90).
6.7 Macrophage efficacy assay
6.7.1 Infection of THP-1 with Mtb
From a 1 ml freezer stock, Mtb was maintained in 7H9/OADC and sub-cultured once to attain an
OD600 of 0.5 (corresponds to approximately 1x 108 CFU/ml) on the day of infection. The culture was
washed twice by centrifugation at 4000 rpm and resuspended in RPMI medium. To achieve a
multiplicity of infection (MOI) of 10 bacilli:1 macrophage, the Mtb culture was diluted 100-fold to
achieve approximate 1 x 106 CFU/ml. 100 µl of this culture was added to each well of the assay plate
containing THP-1 cells. The plates were incubated for 3 to 4 hours at 37 oC with 5% CO2 to enable
uptake of bacteria by the macrophages.
Preparation of compounds
Prior to the experiment, a 10 mM stock solution of each test compound in DMSO was diluted using
RPMI culture medium, ensuring a final concentration of DMSO ≤ 0.5%. The concentrations tested for
each compound were 1X, 2X, and 5X MIC. Isoniazid at 2X MIC and untreated cells were used as
positive and negative controls respectively.
Treatment with compound
The cells were viewed under the microscope at 40x and 100x magnification to ensure bacterial
uptake. The cells were then washed twice with PBS before addition of 100 µl of RPMI medium
containing the test compounds. The cells were incubated at 37 oC with 5% CO2.The cell culture
containing compounds was replenished every two days. At days 0, 2, 4 and 6, cells were washed
twice with PBS and lysed using distilled water with 0.05% Tween®80. The plates were incubated at
room temperature for at least 10 minutes to ensure lysis. The lysates were serially diluted 10-fold in
182
standard 7H9 growth medium and plated on 7H10.The plates were then incubated for 21 to 28 days
prior to CFU enumeration.
6.8 Evaluation of mycobacterial metabolism of FA and selected FA analogues
Three flasks each containing 50 ml of GAST/Fe were inoculated with Mtb H37Rv MA and grown to
an O.D600 of 0.5, after which the cultures were centrifuged at 4000 rpm for 10 minutes at room
temperature. The supernatant was discarded and the pellets resuspended in an equal volume of PBS
(0.05% Tween®80) pH 7.4. After a second cycle of centrifugation, the supernatant was discarded and
the pellets were resuspended in a 10-fold lower volume of PBS. The bulk culture was split into 5 ml
aliquots in tubes (Corning™ Falcon™) ensure triplicate samples for each compound to be tested. For
the heat-killed cultures, the washing procedure above was preceded by heating the GAST/Fe
cultures in a water bath at 80 oC for 1 hour.
10 mM DMSO stocks of each compound were diluted to achieve a concentration of 0.5X MIC and a
DMSO ≤ 1% in the final PBS cultures. After each compound was added in triplicate, the samples were
incubated at 37 oC in a shaking incubator. At 0, 6, 12, 24 and 48 hours, 100 µl was transferred from
each sample tube to a deep well 96-well plate (Nunc™) containing 300 µl of ice-cold acetonitrile
containing 200 nM of ME-29 (Figure 6.4), a fusidic acid derivative well-characterized by LC-MS as an
internal standard. This was carried out in order to precipitate protein and extract the compounds.
Figure 6.4: Structure of ME-29.
The plates were centrifuged at 4000 rpm for 10 minutes at 4 oC, and then stored at -20 oC awaiting
LC-MS analysis.
183
Prior to LC-MS analysis, the 96-well plates were centrifuged at 5000 g and the supernatants
transferred to HPLC vials. LC-MS/MS analysis was performed using an ABsciex 4000 QTrap Mass
spectrometer coupled to an Agilent 1200 HPLC. Chromatography was performed on Kinetex C6
Phenyl column (4.6 x 50 mm, 5 µM particles) using 5 mM ammonium acetate in water as the
aqueous mobile phase and 5mM ammonium acetate in acetonitrile as the organic mobile phase. The
MS runs were performed in electrospray positive mode, monitoring transitions from the derivatives
of interest, as well as fusidic acid, 3-ketofusidic acid and fusidic acid lactone, so as to allow for the
detection of any metabolites formed during incubation. Analyst 1.5 was used for instrument control
and data acquisition, and data processing was performed with Microsoft Excel 2013. The ratio of the
analyte to internal standard with time was then plotted to give a measure of the stability of the
compound over time.
184
6.9 References
(1) McCrone, W. C. Anal. Chem. 1949, 21, 436–441.
(2) Vitez, I. M.; Newman, A. W.; Davidovich, M.; Kiesnowski, C. Thermochim. Acta 1998, 324,
187–196.
(3) de Souza, M. V. N.; Pais, K. C.; Kaiser, C. R.; Peralta, M. A.; de L. Ferreira, M.; Lourenço, M. C.
S. Bioorg. Med. Chem. 2009, 17 (4), 1474–1480.
(4) Tukulula, M. PhD Thesis, University of Cape Town, 2012.
(5) González Cabrera, D.; Douelle, F.; Feng, T.-S.; Nchinda, A. T.; Younis, Y.; White, K. L.; Wu, Q.;
Ryan, E.; Burrows, J. N.; Waterson, D.; Witty, M. J.; Wittlin, S.; Charman, S. ; Chibale, K. J.
Med. Chem. 2011, 54 (21), 7713–7719.
(6) Lipinski, C. A.; Lombardo, F.; Dominy, B. W.; Feeney, P. J. Adv. Drug Deliv. Rev. 2001, 46 (1–3),
3–26.
(7) Bevan, C. D.; Lloyd, R. S. Anal. Chem. 2000, 72 (8), 1781–1787.
(8) Snapper, S. B.; Melton, R. E.; Mustafa, S.; Kieser, T.; Jacobs, W. R. Mol. Microbiol. 1990, 4 (11),
1911–1919.
(9) Ioerger, T. R.; Feng, Y.; Ganesula, K.; Chen, X.; Dobos, K. M.; Fortune, S.; Jacobs, W. R.;
Mizrahi, V.; Parish, T.; Rubin, E.; Sassetti, C.; Sacchettini, J. C. J. Bacteriol. 2010, 192 (14),
3645–3653.
(10) Collins, L. A.; Franzblau, S. G. Antimicrob. Agents Chemother. 1997, 41 (5), 1004–1009.
(11) Collins, L. A.; Torrero, M. N.; Franzblau, S. G. Antimicrob. Agents Chemother. 1998, 42 (2),
344–347.
(12) Naran, K. PhD Thesis, University of Cape Town, 2015.
(13) Ramón-García, S.; Ng, C.; Anderson, H.; Chao, J. D.; Zheng, X.; Pfeifer, T.; Av-Gay, Y.; Roberge,
M.; Thompson, C. J. Antimicrob. Agents Chemother. 2011, 55 (8), 3861–3869.
(14) Bhatter, P.; Chatterjee, A.; D’souza, D.; Tolani, M.; Mistry, N. PLoS One 2012, 7 (3), e33507.
(15) Mosmann, T. J. Immunol. Methods 1983, 65 (1–2), 55–63.
(16) Rubinstein, L. V; Shoemaker, R. H.; Paull, K. D.; Simon, R. M.; Tosini, S.; Skehan, P.; Scudiero,
D. A.; Monks, A.; Boyd, M. R. J. Natl. Cancer Inst. 1990, 82 (13), 1113–1118.
185
Appendix 1: genomic DNA amplified from the FAR Mtb mutant strain GKFA
186
Appendix 2: Primers used for targeted sequencing of PCR amplicons
Primers for sequencing PCR product of MsmfusA1
Primer ID Sequence 5’3’ Length Forward/reverse
MsmfusA1_F1 GGTGTGAAGAACCGCAAGCA 20 forward
MsmfusA1_F2 CAGCGTCGTGAGAAGACCAT 20 forward
MsmfusA1_F3 CAGAAGGACGTGCTTACCGA 20 forward
MsmfusA1_F4 GCGTATCTGCTTCGTCAACA 20 forward
MsmfusA1_F5 GCACTGCTGGAGAAGTACTT 20 forward
MsmfusA1_F6 GGCAAGCTGTTCCAGATGCA 20 forward
MsmfusA1_R1 GGCACCGGTGATCATGTTCT 20 reverse
MsmfusA1_R2 GATGTGTTCAGTTGTGCGGT 20 reverse
MsmfusA1_R3 CAGGTCACCGATCACTTCA 19 reverse
MsmfusA1_R4 GATGAGCACCTTCGCGAACT 20 reverse
MsmfusA1_R5 CTTGTTGGCGTGCATCTGGA 20 reverse
MsmfusA1_R6 CCTTGT TCTTGAACGCGCT 19 reverse
MsmfusA1_R7 CGATGAAGTCGTTCTCGGCA 20 reverse
Primers for sequencing PCR product of MsmfusA2
Primer ID Sequence 5’3’ Length Forward/reverse
MsmfusA2_F1 GACCTGAACAAGGTCCGCA 19 Forward
MsmfusA2_F2 GCAGCGCGTTCAAGAACAA 19 Forward
MsmfusA2_F3 GGTCTGAAGGACACCACCA 19 Forward
MsmfusA2_F4 GAGTTCAAGGTCGAGGCCA 19 Forward
MsmfusA2_F5 CTGGTGAACCTGAAGGTGA 19 Forward
MsmfusA2_F6 GCGAACTACTCCATGGTGTT 20 Forward
MsmfusA2_R1 GATGATCTCCTTCGACACGT 20 Reverse
MsmfusA2_R2 CCTTCTTCAACGCCTGTGAA 20 Reverse
MsmfusA2_R3 GACCTTGTTCTCGAACTCGT 20 Reverse
MsmfusA2_R4 GCTTCTCCTGGTCACTCTT 19 Reverse
MsmfusA2_R5 GGAACCGGATTCCACGACA 19 Reverse
MsmfusA2_R6 CGAAGTACTTCTCCAGCAGT 20 Reverse
MsmfusA2_R7 GATCTGGTTGTTGTTCCAGA 20 Reverse
187
Primers for sequencing PCR product of MtbfusA1
Primer ID Sequence 5’3’ Length Forward/reverse
MtbfusA1_F1 CTCATGTCCTGAAGGGACTT 20 Forward
MtbfusA1_F2 GAGAGTTGCAAAGGTGTGGT 20 Forward
MtbfusA1_F3 CTCGAACTTCTCGACATCAT 20 Forward
MtbfusA1_F4 CATCGAACAAAACCCGGAGA 20 Forward
MtbfusA1_F5 GGTTTCGAGTTCGTCGACAA 20 Forward
MtbfusA1_F6 CGACGAAGATCAACCTGCT 19 Forward
MtbfusA1_R1 GCGCATGGATCTGATGTTC 19 Reverse
MtbfusA1_R2 GACATCGAACGCAGATCGAT 20 Reverse
MtbfusA1_R3 GTGACACCCTTCTCCATCT 19 Reverse
MtbfusA1_R4 GCTGATGATGTCGAGAAGTT 20 Reverse
MtbfusA1_R5 CACCACACCTTTGCAACTCT 20 Reverse
MtbfusA1_R6 GTTCACCTTGATCCCGTTGT 20 Reverse
MtbfusA1_R7 CGATGTGACCTACAGCACAA 20 Reverse
188
Appendix 3: Checkerboard assay plate of FA tested against the Mtb fusA knockdown strain
189
Appendix 4: COSY NMR spectrum of AW23