Supporting Information
SI Materials and Methods
Generation of Influenza A Group 2 Neutralizing Antibodies. Fresh peripheral blood
mononuclear cells (PBMC) were obtained with written consent from four healthy donors seven
days after vaccination with 2007-2008 seasonal influenza vaccine (VAXIGRIP®, Sanofi Pasteur)
containing A/Solomon Islands/3/2006 (H1N1), A/Wisconsin/67/2005 (H3N2), and
B/Malaysia/2506/2004. B-cell receptor (BCR) positive memory B cells sorted on the
CD19+CD27+ phenotype were isolated and immortalized with Bcl-6 and Bcl-xL, essentially as
described previously (1). The immortalized memory B cells were stained with allophycocyanin
(APC)-labeled H3 hemagglutinin (HA) (A/Wisconsin/67/2005) and H3 HA reactive cells were
sorted into limiting dilution cultures. After cell recovery and expansion, binding of supernatants
to recombinant H1 (A/Brisbane/59/2007), H3 (A/Wisconsin/67/2005), and H7
(A/Netherlands/219/2003) HAs was analyzed by solid phase enzyme-linked immunosorbent
assay (ELISA). Subsequently, immunoglobulins were purified from the B cell supernatants and
in vitro neutralizing activity against A/Wisconsin/67/2005 (H3N2) was measured using a virus
neutralization assay (VNA). H3N2 neutralizing antibodies were reformatted into fully human
IgG1 antibodies by cloning the heavy and light chain variable regions (VH and VL) into a single
IgG1 expression vector. PER.C6® cells were transfected with the IgG1 expressing constructs and
expressed antibodies were purified from culture supernatants using POROS® MabCaptureTM A
Perfusion Chromatography® (Applied Biosystems). Reformatted antibodies were assessed for
binding to recombinant H1, H3, and H7 HA by solid phase ELISA, for binding to recombinant
H1, H3, and H7 HA expressed on PER.C6® cells through the use of fluorescence-activated cell
sorting (FACS), and for neutralizing activity against a panel of influenza A viruses using VNAs.
1
Preparation of Viruses and Recombinant Hemagglutinins. Wildtype influenza viruses
A/Hong Kong/1/1968 (H3N2), mouse-adapted A/Hong Kong/1/1968 (H3N2),
A/Johannesburg/33/1994 (H3N2), A/Panama/2007/1999 (H3N2), A/Hiroshima/52/2005 (H3N2),
A/Wisconsin/67/2005 (H3N2), A/Brisbane/10/2007 (H3N2), A/Perth/16/2009 (H3N2),
A/Victoria/361/2011 (H3N2), A/mallard/Netherlands/12/2000 (H7N3), mouse-adapted
A/chicken/Netherlands/621557/2003 (H7N7), A/chicken/Germany/N/1949 (H10N7), A/New
Caledonia/20/1999 (H1N1), A/Solomon Islands/3-2006 IVR-143 (H1N1), and
A/Brisbane/59/2007 (H1N1) were grown in PER.C6® cells by standard viral culture techniques.
For the challenge experiments, batches of mouse-adapted A/Hong Kong/1/1968 (H3N2) (2) and
mouse-adapted A/chicken/Netherlands/621557/2003 (H7N7) were grown in embryonated
chicken eggs. Recombinant soluble HAs of subtypes H1 (A/Brisbane/59/2007), H3
(A/Wisconsin/67/2005), and H7 (A/Netherlands/219/2003) used for ELISA were produced using
a baculovirus expression system and were purchased from Protein Sciences Corp (CT, USA).
Recombinant soluble biotinylated HAs for the Kd measurements, as well as matured HA for
crystallization and electron microscopy (EM) studies, were produced using a baculovirus
expression system as described previously (3). To produce cell surface-expressed HA, coding
regions of full-length recombinant HA of A/Brisbane/59/2007 (H1N1), A/Hong Kong/1/1968
(H3N2), A/Hong Kong/24/1985 (H3N2), A/Wisconsin/67/2005 (H3N2) or
A/Netherlands/219/2003 (H7N7) were synthesized and cloned into pcDNA-based vectors.
HEK293 or PER.C6® cells were transfected with the recombinant HA expressing constructs
using Lipofectamine (Invitrogen).
2
In vitro Virus Neutralization Assay (VNA). Madin-Darby canine kidney (MDCK) cells were
maintained in Dulbecco’s Modified Eagle Medium (DMEM) supplemented with 10% fetal calf
serum (FCS) at 37°C. Prior to the experiment, cells were seeded at 40,000 cells/well in 96-well
flat bottom plates, washed twice with phosphate-buffered saline (PBS) and incubated in DMEM
supplemented with 2 mM L-glutamine and 3 µg/mL trypsin-ethylenediaminetetraacetic acid
(EDTA). Two-fold serially diluted antibody containing supernatant or purified IgG1 was mixed
with an equal volume of virus, and incubated for 2 hours at 37°C. After the incubation, the
mixture (approximately 100 TCID50 [tissue culture infectious dose]) was added to confluent
MDCK monolayers in quadruplicate. Cells were cultured for 72 hours after which the
supernatant was added to an equal volume of 1% turkey red blood cells and incubated for 1 hour
at room temperature in 96-well V-bottom plates. The absence of hemagglutination was defined
as neutralization. Antibody titers required to reduce virus replication by 50% (IC50) were
determined using the Spearman-Kärber formula. As a positive control, virus-inoculated cells
were taken along and mock-inoculated cells were included as a negative control. The HA
sequences of the viruses used for VNA are available in FASTA format in Figure S6.
Kd Determination. Kd values were determined by bio-layer interferometry using an Octet RED
instrument (ForteBio, Inc.), as described previously (3). Biotinylated HAs were loaded onto
streptavidin-coated biosensors in 1x kinetics buffer (1x PBS, pH 7.4, 0.01% bovine serum
albumin [BSA], and 0.002% Tween 20) for 600 sec. For the measurement of kon, association of
CR8043 Fab was measured for 180-600 sec by exposing the sensors to four to six concentrations
of Fab in 1x kinetics buffer. For the measurement of koff, dissociation of CR8043 Fab was
measured for 180-600 sec in 1x kinetics buffer. Experiments were performed at 30°C. The ratio
3
of koff to kon determines the Kd. The sequences of all proteins used for Kd determination are
available in FASTA format in Figure S6. All binding traces and curves used for fitting are
reported in Figure S7.
Prophylactic Efficacy Studies in Mice. All experiments were approved prior to commencement
by the ethical review committee of the Central Veterinary Institute (Lelystad, the Netherlands) in
accordance with Dutch law. Female specific pathogen free (SPF) 129 X1/SvJ (Jackson
Laboratories) and female BALB/c (Charles River Laboratories) mice aged six to eight weeks
were used in the H3N2 and H7N7 experiments, respectively. Groups of eight mice were injected
intravenously with 30, 10, 3, or 1 mg/kg CR8043, or 30 mg/kg CR3014 (4) in a volume of 200
µL one day prior to intranasal lethal challenge with 25 LD50 (lethal dose) of either mouse-
adapted A/Hong Kong/1/1968 (H3N2) or A/chicken/Netherlands/621557/2003 (H7N7). Animals
were monitored for survival and weighed daily.
Crystallization and X-ray Structure Determination and Refinement. CR8043 Fab was
generated by LysC cleavage (Roche) of CR8043 IgG. The Fab was purified by protein A and
protein G chromatography, followed by cation exchange and finally size exclusion
chromatography using a Superdex 200 16/60 column (GE Healthcare). Apo CR8043 Fab crystals
were grown using the automated Rigaku Crystalmation robotic system at the Joint Center for
Structural Genomics (JCSG) by sitting drop vapor diffusion. Crystals grew at 4ºC by mixing
concentrated Fab (15 mg/mL) with 20% (w/v) polyethylene glycol (PEG) 6000, 0.1 M 2-[4-(2-
hydroxyethyl)-1-piperazinyl]ethanesulfonic acid (HEPES) pH 6.5. Crystals were cryo-protected
in mother liquor supplemented with 20% (w/v) PEG 400, flash cooled, and stored in liquid
4
nitrogen until data collection. X-ray diffraction data for the apo CR8043 Fab were collected to
2.65 Å resolution at beamline 11-1 at the Stanford Synchrotron Radiation Lightsource (SSRL).
The data were processed in spacegroup P1 using XDS (5). The structure was determined by
molecular replacement with Phaser (6) using the variable and constant domains of the TR1.9 Fab
(PDB ID code 1VGE (7)) as search models; two Fab copies were found in the asymmetric unit.
The model was iteratively rebuilt using Coot (8) and refined in Phenix (9). Refinement
parameters included rigid body refinement (set for each Ig domain), simulated annealing, and
restrained refinement including TLS refinement (set for each Ig domain).
The CR8043-HK68/H3 HA complex was prepared by adding recombinant CR8043 Fab
to HA in a 3.2:1 molar ratio and the saturated complex was purified by gel filtration. Crystals of
the complex were grown by sitting drop vapor diffusion at 4ºC by mixing concentrated complex
(6.8 mg/mL) with 2.2 M ammonium sulfate, 0.1 M sodium acetate pH 5.5, 3% (w/v) PEG 400.
Crystals were cryo-protected in mother liquor supplemented with increasing concentrations of
glycerol (5% steps to a final concentration of 20%), flash cooled, and stored in liquid nitrogen
until data collection. X-ray diffraction data for the CR8043-HK68/H3 HA complex were
collected to 4.0 Å resolution at beamline 12-2 at SSRL and the data were processed in
spacegroup C2 using XDS (5). The structure was determined by molecular replacement with
Phaser (6) first using the HA trimer from A/Hong Kong/1/1968 (H3N2) (PDB ID code 4FNK
(10)) as the search model. Next, three copies of the high-resolution CR8043 Fab variable domain
were used as search models after fixing the position and orientation of the HA trimer. The
CR8043 Fab constant domains were manually placed after refinement. The model was iteratively
rebuilt using Coot (8) and refined in Phenix (9). Refinement parameters included rigid body
refinement (set for the HA trimer and the variable and constant domains of each Fab), restrained
5
refinement including TLS refinement (set for the HA trimer and the variable and constant
domains of each Fab), using the high-resolution HA and Fab as reference models.
Structural Analyses. Hydrogen bonds and van der Waals contacts were calculated using
HBPLUS and CONTACSYM, respectively (11, 12). Surface area upon Fab binding was
calculated using MS (13). MacPyMOL (DeLano Scientific) was used to render figures. Kabat
numbering was applied to the coordinate files using the AbNum server (14). The final
coordinates were validated using the JCSG quality control server (v2.8), which includes
MolProbity (15).
EM Structures of CR8043-HA Complexes. Complexes were prepared by mixing the HA with
saturating amounts of CR8043 Fab at room temperature for two hours. The complex was purified
by size exclusion chromatography using a Superdex 200 10/300 GL column (GE Healthcare) to
remove excess Fab. Four hundred mesh copper EM grids were coated with nitrocellulose and a
thin layer of carbon. Samples were applied (~8 µg/mL of Fab-HA complex diluted in TBS) to
freshly glow-discharged grids and stained with 2% uranyl formate. Micrographs were acquired
on a Tecnai Spirit transmission electron microscopy (TEM) (accelerating voltage of 120 kV)
fitted with a Tietz charge-coupled device camera (4096 x 4096 pixel images). A magnification of
52,000 x and a defocus of approximately -1.1 µm was used. The pixel size was previously
calibrated to be 2.05 Å using a two-dimensional catalase crystal. The stage was tilted from 0º to
55° (5° increments) to increase the number of observed orientations. The Leginon software
package (16, 17) was used to automate some steps of data acquisition.
6
Particles were selected using a difference-of-Gaussian algorithm provided in the Appion
package (18). Particle boxing was performed using Eman1.9 (19) and Spider (20); Xmipp (21)
was used to normalize the boxed images. The contrast transfer function was not corrected. Initial
classification was performed with Xmipp CL2D (22). Following classification, noisy class
averages were manually excluded.
Volumes were reconstructed using the ‘ali3d.py’ function in the Sparx package (23). An
initial volume comprised of the coordinates of the HA from PDB ID code 4GMS (24), which
were low-pass filtered to 30 Å and inputted into the reconstruction. Initial reconstructions used
particle stacks binned by 3 pixels and were refined for 20 rounds as the translational and angular
search increments were decreased. The resulting volume clearly localized the Fabs, showing
densities for the constant and variable domains. The volume was scaled to the unbinned box size
of 192 pixels and refined for 25 rounds. For the A/Bangkok/1/1979 reconstruction, 7,009
particles were included in the final reconstruction; for the A/Hong Kong/1/1968 reconstruction,
10,033 particles were included in the final reconstruction. Fourier shell correlation curves and
resolution estimates are included in Figure S2.
Volumes were visualized and interpreted using UCSF Chimera 1.8 (25). HA from PDB
ID code 4FNK (10) was docked into the volume maps as was a single copy of the crystal
structure of CR8043. This initial docking was refined with Situs (collage) (26). Symmetry-
related Fabs were then generated within Chimera. The corresponding crystal structure of HA in
complex with CR8043 was also docked into the EM map. Both models were very similar and
agreed with the EM data.
7
Sequence Analysis of the Antibody Epitopes. The full-length and non-redundant influenza A
HA sequences were downloaded from the Influenza Virus Resource at the National Center for
Biotechnology Information (NCBI) database (27). At the time of download (July 10, 2013), the
dataset includes 5,403 HA sequences from group 2 influenza A viruses. The sequences were
aligned using MUSCLE (28) and analyzed using GCG (Accelrys) and custom shell scripts
(available from the authors upon request). The sequence identity and conservation of the CR8043
epitope are reported in Table S4 and Table S6, respectively.
Antibody Binding Competition. Antibody binding competition was measured on an Octet QK
system (ForteBio, Inc.). Recombinant soluble HA was biotinylated at room temperature for 40
min using EZ-link sulfo-NHS-LC-LC-biotin (Pierce). A buffer exchange step to PBS was
performed using Amicon Ultra 0.5 mL centrifugal filters (Millipore). Biotinylated HA was
immobilized onto streptavidin biosensors at 37°C for 1200 sec. For analysis of antibody binding
to cleaved versus uncleaved H3 and H7 HA, the bound HA was either cleaved with 1:5 diluted
TrypLE™ Select (Gibco) for 600 seconds or untreated. Association of IgGs was measured for
900 sec at 37°C by exposing the biosensors to antibody in 1x kinetics buffer (ForteBio). The
degree of additional antibody binding was assessed by exposing the biosensors to the second
antibody (in 1x kinetics buffer) in the presence of the first antibody for 900 sec at 37°C.
Generation of Neutralization-Resistant Virus Variants. A/Hong Kong/1/1968 (H3N2) virus
was cultured in the presence of CR8043 IgG1 for multiple passages. As a reference, control
experiments without antibodies were performed in parallel. Serially diluted virus was first
incubated for 1 hour at 37°C with a concentration of antibody known to reduce the viral
8
infectious titer by 3 log units. The incubated mixture was absorbed by MDCK cells for 1 hour.
Infected cells were washed twice with PBS and replenished with infection medium
complemented with the same concentration of antibody. Cytopathic effect (CPE) and
hemagglutinating units (HAU) were determined 72 hours after infection and supernatants from
CPE and HAU positive wells infected with the highest virus dilution were harvested for a
subsequent round of infection. HA sequences of viruses obtained after multiple passages were
examined.
Conformational Change FACS Assay. Full-length recombinant influenza A subtype H3
(A/Hong Kong/1/1968, A/Hong Kong/24/1985, or A/Wisconsin/67/2005) HAs were expressed
on the surface of PER.C6® cells. To measure mAb binding to different HA structural forms and
conformations, cells were detached from the plastic support using PBS-EDTA and subsequently
treated with trypsin (TrypLETMSelect, Gibco) for 5 min at room temperature, washed (1% BSA
in PBS) and incubated for 15 min in citric acid-sodium phosphate buffer pH 4.9, washed, and
then incubated for 20 min in the presence of 50 mM dithiothreitol (DTT) in PBS at room
temperature. Cell samples collected after each processing step were incubated with CR8043 or
CR8057 IgG for 1 hour. Cells were then incubated for 30 min with phycoerythrin-conjugated
anti-human IgG (Southern Biotech) in 1% BSA. Alternatively, CR8043 was added before the
low pH step. Samples of consecutive treatments were split and stained with either phycoerythrin-
conjugated anti-human IgG or HA1 specific AlexaFluro488-conjugated CR8057. Stained cells
were analyzed using a FACS Canto with FACS Diva software (Beckton Dickinson).
9
Trypsin Cleavage Inhibition Assay. Recombinant, soluble A/Wisconsin/67/2005 (H3N2) HA
(0.4 µg) was incubated in the presence of 2.5 µg CR8043 or CR8057 IgG, or in the absence of
antibody in 4 mM Tris-HCl buffer at pH 8.0 containing 6.7 µg/mL Trypsin-EDTA (Gibco) and
1% N-dodecyl-β-maltoside (Sigma). Trypsin digestion was stopped at several time-points by
addition of 1% BSA. Samples were run on sodium dodecyl sulfate-polyacrylamide gel
electrophoresis (SDS-PAGE) (reduced) and blotted according to standard methods. HA0 bands
were detected using a rabbit anti-H3 HA polyclonal antibody (Protein Sciences Corp, CT, USA).
References
1. Kwakkenbos MJ, et al. (2010) Generation of stable monoclonal antibody-producing B cell receptor-positive human memory B cells by genetic programming. Nat Med 16:123-128.
2. Brown EG, Liu H, Kit LC, Baird S, Nesrallah M (2001) Pattern of mutation in the genome of influenza A virus on adaptation to increased virulence in the mouse lung: identification of functional themes. Proc Natl Acad Sci USA 98:6883-6888.
3. Ekiert DC, et al. (2011) A highly conserved neutralizing epitope on group 2 influenza A viruses. Science 333:843-850.
4. ter Meulen J, et al. (2004) Human monoclonal antibody as prophylaxis for SARS coronavirus infection in ferrets. Lancet 363:2139-2141.
5. Kabsch W (2010) XDS. Acta Crystallogr D Biol Crystallogr 66:125-132.6. McCoy AJ, et al. (2007) Phaser crystallographic software. J Appl Crystallogr 40:658-
674.7. Chacko S, Padlan EA, Portolano S, McLachlan SM, Rapoport B (1996) Structural studies
of human autoantibodies. Crystal structure of a thyroid peroxidase autoantibody Fab. J Biol Chem 271:12191-12198.
8. Emsley P, Lohkamp B, Scott WG, Cowtan K (2010) Features and development of Coot. Acta Crystallogr D Biol Crystallogr 66:486-501.
9. Adams PD, et al. (2010) PHENIX: a comprehensive Python-based system for macromolecular structure solution. Acta Crystallogr D Biol Crystallogr 66:213-221.
10. Ekiert DC, et al. (2012) Cross-neutralization of influenza A viruses mediated by a single antibody loop. Nature 489:526-532.
11. McDonald IK, Thornton JM (1994) Satisfying hydrogen bonding potential in proteins. J Mol Biol 238:777-793.
12. Sheriff S, Hendrickson WA, Smith JL (1987) Structure of myohemerythrin in the azidomet state at 1.7/1.3 Å resolution. J Mol Biol 197:273-296.
13. Connolly ML (1983) Analytical molecular surface calculation. J Appl Crystallogr 16:548-558.
10
14. Abhinandan KR, Martin AC (2008) Analysis and improvements to Kabat and structurally correct numbering of antibody variable domains. Mol Immunol 45:3832-3839.
15. Chen VB, et al. (2010) MolProbity: all-atom structure validation for macromolecular crystallography. Acta Crystallogr D Biol Crystallogr 66:12-21.
16. Suloway C, et al. (2005) Automated molecular microscopy: the new Leginon system. J Struct Biol 151:41-60.
17. Carragher B, et al. (2000) Leginon: an automated system for acquisition of images from vitreous ice specimens. J Struct Biol 132:33-45.
18. Lander GC, et al. (2009) Appion: an integrated, database-driven pipeline to facilitate EM image processing. J Struct Biol 166:95-102.
19. Ludtke SJ, Baldwin PR, Chiu W (1999) EMAN: semiautomated software for high-resolution single-particle reconstructions. J Struct Biol 128:82-97.
20. Frank J, et al. (1996) SPIDER and WEB: processing and visualization of images in 3D electron microscopy and related fields. J Struct Biol 116:190-199.
21. Marabini R, et al. (1996) Xmipp: an image processing package for electron microscopy. J Struct Biol 116:237-240.
22. Sorzano CO, et al. (2010) A clustering approach to multireference alignment of single-particle projections in electron microscopy. J Struct Biol 171:197-206.
23. Hohn M, et al. (2007) SPARX, a new environment for Cryo-EM image processing. J Struct Biol 157:47-55.
24. Lee PS, et al. (2012) Heterosubtypic antibody recognition of the influenza virus hemagglutinin receptor binding site enhanced by avidity. Proc Natl Acad Sci USA 109:17040-17045.
25. Pettersen EF, et al. (2004) UCSF Chimera--a visualization system for exploratory research and analysis. J Comput Chem 25:1605-1612.
26. Wriggers W (2010) Using Situs for the integration of multi-resolution structures. Biophys Rev 2:21-27.
27. Bao Y, et al. (2008) The influenza virus resource at the National Center for Biotechnology Information. J Virol 82:596-601.
28. Edgar RC (2004) MUSCLE: multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Res 32:1792-1797.
11
Table S1. Characteristics of influenza A group 2 neutralizing monoclonal antibodies
mAb ID Donor
Clone BCR H3
HA Reactivity
Clone supernatant Recombinant IgG1VH
Gene Famil
y
Number of VH
Somatic Mutation
s
VL
Gene Family
Number of VL
Somatic Mutation
s
HA Binding ELISA
H3N2 VNA
HA Binding ELISA
HA Binding FACS VNA
CR8020 2 + H3, H7 + H3, H7 H3, H7 H3, H7, H10 1-18 12 K3-20 7
CR8021 2 + H3, H7 + H3, H7 H3 H3 3-23 8 K4-01 4
CR8038 2 + H3 + H3 ND H3 3-23 7 K4-01 3
CR8039 3 + H3 + H3 H3 H3 4-59 8 L2-08 2
CR8041 2 + H3 + H3, H7 H3, H7 H3, H7, H10 1-18 12 K3-20 3
CR8043 2 + H3, H7 + H3, H7 H3 H3, H10 1-3 14 K4-01 8
CR8049 1 + H3 + H3 H3 H3 2-26 11 L3-21 11
CR8050 1 + H3 + H3 H3 H3 4-34 14 K3-20 8
CR8052 4 + H3 + H3 H3 - 4-61 8 K1-39 11
CR8055 2 + H3 + - H3 H3 3-33 13 K6-21 9
CR8057 1 + H3 + H3 H3 H3 3-53 16 L2-14 13
ND, not determined.
12
Table S2. X-ray data collection and refinement statistics
Data collection CR8043 Fab CR8043-HK68/H3 complexBeamline SSRL 11-1 SSRL 12-2Wavelength (Å) 0.97945 0.97950Space group P1 C2Unit cell parameters a = 60.0, b = 68.6, c = 72.4 a = 241.5, b = 142.4, c = 170.7
(Å, º) α = 78.7, β = 78.9, γ = 86.2 α = γ = 90.0, β = 133.5Resolution (Å) 50 – 2.65 (2.77 – 2.65) a 50 – 4.0 (4.20 – 4.00) a
Observations 74,100 234,117Unique reflections 31,483 (4,065) a 34,622 (4,271) a
Rmerge (%) b 8.6 (51.5) a 20.1 (82.6) a
Rpim (%) b 7.1 (42.8) a 8.3 (34.3) a
I/sigma 9.0 (1.8) a 6.4 (2.2) a
Completeness (%) 97.1 (93.8) a 97.7 (90.8) a
Multiplicity 2.4 (2.3) a 6.8 (6.5) a
Refinement statisticsResolution 44.4 – 2.65 43.8 – 4.0Reflections (total) 31,427 34,531Reflections (test) 1,577 1,730Rcryst (%) c 17.5 24.0Rfree (%) d 23.2 29.2Protein atoms 6,720 21,392Carbohydrate atoms – 280Waters 9 0Other 21 0Average B-value (Å2)Overall 53 69Wilson 55 93RMSD from ideal geometryBond length (Å) 0.009 0.006Bond angles (°) 1.36 1.23Ramachandran statistics (%) e
Favored 96.9 97.3Outliers 0.2 0.2PDB ID 4NM4 4NM8
a Numbers in parenthesis refer to the highest resolution shell.b Rmerge = Σhkl Σi | Ihkl,i - <Ihkl> | / Σhkl Σi Ihkl,I and Rpim = Σhkl [1/(n-1)]1/2 Σi | Ihkl,i - <Ihkl> | / Σhkl Σi Ihkl,I, where Ihkl,i
is the scaled intensity of the ith measurement of reflection h, k, l, < Ihkl> is the average intensity for that reflection, and n is the redundancy.c Rcryst = Σ | Fo - Fc | / Σ | Fo | x 100, where Fo and Fc are the observed and calculated structure factors, respectively.d Rfree was calculated as for Rcryst, but on a random test set comprising 5% of the data excluded from refinement.e Calculated using MolProbity (15).
13
Table S3. In vitro neutralizing activity of CR8043 and CR8057 against H3N2 viruses
Isolate
IC50 (µg/mL)CR8043 CR8057
MN HAI MN HAIA/Hong Kong/1/1968 0.8 >10 >40 >10A/Johannesburg/33/1994 1.2 >10 >40 >10A/Panama/2007/1999 4.2 >10 0.01 0.028A/Hiroshima/52/2005 1.8 >10 0.003 0.055A/Wisconsin/67/2005 1.6 >10 0.005 0.005
MN, microneutralization; HAI, hemagglutination inhibition
14
Table S4. Sequence identity of CR8043 epitope by subtypeR
esid
ue
Con
sens
usa
HK
68/H
3 Se
quen
ce Group 2 Percent Identity
(Simple)b
Group 2 Percent Identity
(Weighted)c
Percent Identity by Subtype
H3 (4027)d
H4 (486)d
H7 (607)d
H10 (273)d
H14 (5)d
H15 (6)d
21 P P 77.3 29.7 95.5 45.7 3.6 (A/S)e
33.7 (S)e
0.0(E)e
0.0 (A)e
325 E E 99.5 83.0 99.6 99.6 99.8 99.3 0.0 (D/G)e 100.0
326 K K 83.6 69.1 97.1 97.5 19.8 (N/I)e
0.0 (V/I)e 100.0 100.0
15 E E 90.9 66.6 100.0 0.2 (Q)e 100.0 99.3 0.0
(Q)e 100.0
16 G G 99.9 99.8 100.0 99.8 100.0 99.3 100.0 100.0
18 V I 62.8 30.9 75.9 0.4 (I)e
10.4 (I)e 98.9 0.0
(I)e0.0 (I)e
19 D D 96.8 96.1 99.0 99.6 79.7 98.2 100.0 100.0
25 R R 99.7 99.5 100.0 99.8 97.9 99.3 100.0 100.0
32 T T 58.9 59.8 60.1 100.0 0.0 (E)e 98.5 100.0 0.0 (Q)e
34 Q Q 79.5 33.2 100.0 0.2 (T)e 0.0 (T)e 99.3 0.0
(T)e0.0 (T)e
38 L L 83.0 49.9 99.3 100.0 0.0 (Y)e
0.0 (Y)e 100.0 0.0
(Y)e
aMost common residue at position by simple majority across all group 2 sequences. HA1 residues are listed first, followed by HA2 residues.bPercent of all group 2 sequences that are identical to the consensus sequence.cPercent of all group 2 sequences that are identical to the consensus sequence, but weighted to correct for the under/over-representation of some subtypes in the dataset (the mean of the percent conservation values for each individual subtype).dNumber of sequences available for subtype at time of download.eMost common residue in this subtype.
15
Table S5. In vitro neutralizing activity of CR8043 and CR8020 against H3N2 escape mutants
IsolateHA2 position IC50 (µg/mL)
19 25 33 34 CR8043 CR8020A/Hong Kong/1/1968 wildtype D R G Q 0.8 1.8Arg25Met mutant D M G Q >40 1.1Gln34Arg mutant D R G R >40 >40Asp19Asn mutant N R G Q 18.1 >40Gly33Glu mutant D R E Q 30 >40
16
Table S6. Sequence conservation of CR8043 epitope by subtypeR
esid
ue
Con
sens
usa
HK
68/H
3 Se
quen
ce Group 2 Percent
Conservation (Simple)b
Group 2 Percent
Conservation (Weighted)c
Percent Conservation by Subtype
H3 (4027)d
H4 (486)d
H7 (607)d
H10 (273)d
H14 (5)d
H15 (6)d
21 P P 77.3 29.8 95.5 45.7 3.6 (A/S)e
33.7 (S)e
0.0 (E)e
0.0 (A)e
325 E E 99.5 93.1 99.6 99.6 99.8 99.3 60.0 100.0
326 K K 85.5 69.8 99.4 99.6 19.8 (N/I)e
0.0 (V/I)e 100.0 100.0
15 E E 99.9 99.9 100.0 99.8 100.0 99.3 100.0 100.0
16 G G 99.9 99.9 100.0 99.8 100.0 99.3 100.0 100.0
18 V I 95.4 98.8 93.9 99.8 100.0 99.3 100.0 100.0
19 D D 99.9 99.8 99.9 99.8 100.0 99.3 100.0 100.0
25 R R 100.0 99.9 100.0 99.8 100.0 99.3 100.0 100.0
32 T T 58.9 59.8 60.1 100.0 0.0 (E)e 98.5 100.0 0.0
(Q)e
34 Q Q 79.5 33.3 100.0 0.2 (T)e
0.0 (T)e 99.3 0.0
(T)e0.0 (T)e
38 L L 83.4 50.0 99.7 100.0 0.0 (Y)e 0.0 (Y)e 100.0 0.0
(Y)e
aMost common residue at position by simple majority across all group 2 sequences. HA1 residues are listed first, followed by HA2 residues.bPercent of all group 2 sequences that are identical to the consensus sequence or have conservative substitutions.cPercent of all group 2 sequences that are identical to the consensus sequence or have conservative substitutions, but weighted to correct for the under/over-representation of some subtypes in the dataset (the mean of the percent conservation values for each individual subtype).dNumber of sequences available for subtype at time of download.eMost common residue in this subtype.
17
Fig. S1. Sequence alignment of variable regions of CR8020 and CR8041. CR8020 residues contacting H3 HA and corresponding CR8041 residues are depicted in red.
18
Fig. S2. Negative stain EM reconstructions of CR8043 Fab in complex with influenza H3 HA. (A) Side and top view of CR8043 with A/Bangkok/1/1979 (H3N2) HA. The crystal structure of the same complex has been docked into the EM density (gray mesh). The Fab is in red, HA1 in green and HA2 in blue. Example of (B) CR8043-HA (Bangkok79/H3) and (C) CR8043-HA (HK68/H3) CL2D reference free class averages (left) and FSC curves for the final reconstructions (right).
19
Fig. S3. Antibody binding competition of CR8020, CR8043 or CR8057 (100 nM) with immobilized A/Wisconsin/67/2005 (H3N2) HA pre-saturated with CR8020, CR8043, or CR8057 (100 nM), as measured by bio-layer interferometry.
20
Fig. S4. Representative electron density at the CR8043-HA interface. The CR8043 variable heavy and light chains are colored cyan and orange and the HA1 and HA2 are colored yellow and red. The 2Fo-Fc electron density map (blue mesh) is contoured at 1σ.
21
Fig. S5. Similar interacting residues between CR8043 and CR8020 are illustrated on the surface of the HK68/H3 HA. HA footprints of CR8043, CR8020, or the antibody overlaps are colored red, blue, or yellow, respectively. The interacting residues of CR8043 and CR8020 are colored green and orange, respectively.
22
Fig. S6. Sequences of HA proteins used in this study.
HA sequences of viruses used in neutralization studies.
>A/Hong Kong/1/1968 (H3N2)MKTIIALSYIFCLALGQDLPGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIWSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIESIRNGNYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVVLLGFIMWACQRGNIRCNICI
>A/Johannesburg/33/1994 (H3N2)MKTIIALSYILCLVFAQKLPGNDNSTATLCLGHHAVPNGTLVKTITNDQIEVTNATELVQSSPTGRICDSPHRILDGKNCTLIDALLGDPHCDGFQNKEWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFINENFNWTGVAQDGKSYACKRGSVNSFFSRLNWLHKLEYKYPALNVTMPNNGKFDKLYIWGVHHPSTDSDQTSLYVRASGRVTVSTKRSQQTVIPDIGYRPWVRGQSSRISIHWTIVKPGDILLINSTGNLIAPRGYFKIRNGKSSIMRSDAPIGNCSSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRLVEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFERTRKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVVLLGFIMWACQKGNIRCNICI
>A/Panama/2007/1999 (H3N2)MKTIIALSYILCLVFAQKLPGNDNSTATLCLGHHAVSNGTLVKTITNDQIEVTNATELVQSSSTGRICDSPHQILDGENCTLIDALLGDPHCDGFQNKEWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVAQNGTSSACKRRSNKSFFSRLNWLHQLKYKYPALNVTMPNNEKFDKLYIWGVHHPSTDSDQISIYAQASGRVTVSTKRSQQTVIPNIGSSPWVRGVSSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQINGKLNRLIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFERTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVVLLGFIMWACQKGNIRCNICI
>A/Hiroshima/52/2005 (H3N2)MKTIIALSYILCLAFAQKLPGNDNSTATLCLGHHAVPNGTIVKTITNDQIEVTNATELVQSSSTGGICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACKRRSNNSFFSRLNWLTQLKFKYPALKVTMPNNEKFDKLYIWGVHHPVTDNDQIFLYAQASGRITVSTKRSQQTVIPNIGSRPRVRNIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGIGQAADLKSTQAAINQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDIKIDLWSYNAELLVALENQHTIDLTDSEMNKLFERTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVALLGFIMWACQKGNIRCNICI
>A/Wisconsin/67/2005 (H3N2)MKTIIALSYILCLVFAQKLPGNDNSTATLCLGHHAVPNGTIVKTITNDQIEVTNATELVQSSSTGGICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNDESFNWTGVTQNGTSSSCKRRSNNSFFSRLNWLTQLKFKYPALNVTMPNNEKFDKLYIWGVHHPVTDNDQIFLYAQASGRITVSTKRSQQTVIPNIGSRPRIRNIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGIGQAADLKSTQAAINQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFERTK
23
KQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVALLGFIMWACQKGNIRCNICI>A/Brisbane/10/2007 (H3N2)MKTIIALSYILCLVFTQKLPGNDNSTATLCLGHHAVPNGTIVKTITNDQIEVTNATELVQSSSTGEICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACIRRSNNSFFSRLNWLTHLKFKYPALNVTMPNNEKFDKLYIWGVHHPGTDNDQIFPYAQASGRITVSTKRSQQTVIPNIGSRPRVRNIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGIGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVALLGFIMWACQKGNIRCNICI
>A/Perth/16/2009 (H3N2)MKTIIALSYILCLVFAQKLPGNDNSTATLCLGHHAVPNGTIVKTITNDQIEVTNATELVQSSSTGEICDSPHQILDGKNCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACIRRSKNSFFSRLNWLTHLNFKYPALNVTMPNNEQFDKLYIWGVHHPGTDKDQIFLYAQASGRITVSTKRSQQTVSPNIGSRPRVRNIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGRGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVALLGFIMWACQKGNIRCNICI
>A/Victoria/361/2011 (H3N2)MKTIIALSHILCLVFAQKLPGNDNSTATLCLGHHAVPNGTIVKTITNDQIEVTNATELVQNSSIGEICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACIRRSNNSFFSRLNWLTQLNFKYPALNVTMPNNEQFDKLYIWGVHHPVTDKDQIFLYAQSSGRITVSTKRSQQAVIPNIGYRPRIRNIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQSTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGRGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVALLGFIMWACQKGNIRCNICI
>A/mallard/Netherlands/12/2000 (H7N3)MNTQILVFALMAIIPTNADKICLGHHAVSNGTKVNTLTERGVEVVNATETVERTNVPRICSKGKRTVDLGQCGLLGTITGPPQCDQFLEFSADLIIERREGSDVCYPGKFVNEEALRQILRESGGIDKETMGFTYSGIRTNGATSACRRSGSSFYAEMKWLLSNTDNAAFPQMTKSYKNTRKDPALIIWGIHHSGSTTEQTKLYGSGNKLITVGSSNYQQSFVPSPGARPQVNGQSGRIDFHWLILNPNDTVTFSFNGAFIAPDRASFLRGKSMGIQSGVQVDANCEGDCYHSGGTIISNLPFQNINSRAVGKCPRYVKQESLLLATGMKNVPEIPKGRGLFGAIAGFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLNRLIEKTNQQFELIDNEFTEVEKQIGNVINWTRDSMTEVWSYNAELLVAMENQHTIDLADSEMNKLYERVKRQLRENAEEDGTGCFEIFHKCDDDCMASIRNNTYDHSKYREEAMQNRIQIDPVKLSSGYKDVILWFSFGASCFILLAIAMGLVFICVKNGNMRCTICI
>A/chicken/Netherlands/621557/2003 (H7N7)MNTQILVFALVAIIPTNADKICLGHHAVSNGTKVNTLTERGVEVVNATETVERTNVPRICSKGKRTVDLGQCGLLGTITGPPQCDQFLEFSADLIIERREGSDVCYPGKFVNEEALRQILRESGGIDKETMGFTYSGIRTNGATSACRRSGSSFYAEMKWLLSNTDNAAFPQMTKSYKNTRKDPALIIWGIHHSGSTTEQTKLYGSGNKLITVGSSNYQQSFVPSPGARPQVNGQSGRIDFHWLILNPNDTVTFSFNGAFIAPDRASFLRGKSMGIQSEVQVDANCEGDCYHSGGTIISNLPFQNINSRAVGKCPRYVKQESLLLATGMKNVPEIPKRRRRGLFGAIAGFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLNRLIEKTNQQFELIDNEFTEVEKQIGNVINWTRDSMTEVWSYNAELLVAMENQHTIDLADSEMNKLYERVKRQLRENAEEDGTGCFEIFHKCDDDCMASIRNNTYDHSKYREEAIQNRIQIDPVKLSSGYKDVILWFSFGASCFILLAIAMGLVFICVKNGNMRCTICI
24
>A/chicken/Germany/N/1949 (H10N7)MYKVVVIIALLGAVKGLDRICLGHHAVANGTIVKTLTNEQEEVTNATETVESTNLNKLCMKGRSYKDLGNCHPVGMLIGTPVCDPHLTGTWDTLIERENAIAHCYPGATINEEALRQKIMESGGISKMSTGFTYGSSINSAGTTKACMRNGGDSFYAELKWLVSKTKGQNFPQTTNTYRNTDTAEHLIIWGIHHPSSTQEKNDLYGTQSLSISVESSTYQNNFVPVVGARPQVNGQSGRIDFHWTLVQPGDNITFSHNGGLIAPSRVSKLTGRGLGIQSEALIDNSCESKCFWRGGSINTKLPFQNLSPRTVGQCPKYVNQRSLLLATGMRNVPEVVQGRGLFGAIAGFIENGWEGMVDGWYGFRHQNAQGTGQAADYKSTQAAIDQITGKLNRLIEKTNTEFESIESEFSETEHQIGNVINWTKDSITDIWTYQAELLVAMENQHTIDMADSEMLNLYERVRKQLRQNAEEDGKGCFEIYHTCDDSCMESIRNNTYDHSQYREEALLNRLNINSVKLSSGYKDIILWFSFGASCFVLLAVVMGLVFFCLKNGNMRCTICI
>A/New Caledonia/20/1999 (H1N1)MKAKLLVLLCTFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCLLKGIAPLQLGNCSVAGWILGNPECELLISKESWSYIVETPNPENGTCYPGYFADYEELREQLSSVSSFERFEIFPKESSWPNHTVTGVSASCSHNGKSSFYRNLLWLTGKNGLYPNLSKSYVNNKEKEVLVLWGVHHPPNIGDQRALYHTENAYVSVVSSHYSRRFTPEIAKRPKVRDQEGRINYYWTLLEPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNAPMDECDAKCQTPQGAINSSLPFQNVHPVTIGECPKYVRSAKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLERRMENLNKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNNECMESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFWMCSNGSLQCRICI
>A/Solomon Islands/3/2006 (H1N1)MKVKLLVLLCTFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCLLKGIAPLQLGNCSVAGWILGNPECELLISRESWSYIVEKPNPENGTCYPGHFADYEELREQLSSVSSFERFEIFPKESSWPNHTTTGVSASCSHNGESSFYKNLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHHPPNIGDQRALYHTENAYVSVVSSHYSRKFTPEIAKRPKVRDREGRINYYWTLLEPGDTIIFEANGNLIAPRYAFALSRGFGSGIINSNAPMDECDAKCQTPQGAINSSLPFQNVHPVTIGECPKYVRSAKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLERRMENLNKKVDDGFIDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNDECMESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSRVLLVSLGAISFWMCSNGSLQCRICI
>A/Brisbane/59/2007 (H1N1)MKVKLLVLLCTFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLENSHNGKLCLLKGIAPLQLGNCSVAGWILGNPECELLISKESWSYIVEKPNPENGTCYPGHFADYEELREQLSSVSSFERFEIFPKESSWPNHTVTGVSASCSHNGESSFYRNLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHHPPNIGDQKALYHTENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTLLEPGDTIIFEANGNLIAPRYAFALSRGFGSGIINSNAPMDKCDAKCQTPQGAINSSLPFQNVHPVTIGECPKYVRSAKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLERRMENLNKKVDDGFIDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNDECMESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFWMCSNGSLQCRICI
25
Sequences of HA proteins used for Kd determination. The sequences listed below represent the full-length ORF as cloned in the baculovirus transfer vector. Most of the N-terminal signal peptide (MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFA) is presumably removed during secretion, leaving four non-native residues (ADPG) at the N-terminus of HA1. The C-terminal biotinylation site, thrombin cleavage site, trimerization domain, and His6 tag are retained on all proteins.
>A/duck/Ukraine/1/1963 (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTIVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGRACTLIDALLGDPHCDVFQNETWDLFVERSNAFSNCYPYDIPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSSACKRGPANGFFSRLNWLTKSESAYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTDLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGQPGRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPGKQTRGLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINRKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLADSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDIYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Hong Kong/1/1968 (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTGRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Hong Kong/1/1968 mutant I18M (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWEGMMDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTGRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Hong Kong/1/1968 mutant D19N (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWEGMINGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTGRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
26
>A/Hong Kong/1/1968 mutant R25M (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWEGMIDGWYGFMHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTGRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Hong Kong/1/1968 mutant T32E (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWEGMIDGWYGFRHQNSEGEGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTGRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Hong Kong/1/1968 mutant T32I (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWEGMIDGWYGFRHQNSEGIGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTGRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Hong Kong/1/1968 mutant T32R (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWEGMIDGWYGFRHQNSEGRGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTGRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Hong Kong/1/1968 mutant Q34T (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGTAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTGRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
27
>A/Hong Kong/1/1968 mutant Q34R (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGRAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTGRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Victoria/3/1975 (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGKICNNPHRILDGINCTLIDALLGDPHCDGFQNEKWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFINEGFNWTGVTQNGGSSACKRGPDSGFFSRLNWLYKSGSTYPVQNVTMPNNDNSDKLYIWGVHHPSTDKEQTNLYVQASGKVTVSTKRSQQTIIPNVGSRPWVRGLSSRISIYWTIVKPGDILVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIGTCSSECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Leningrad/360/1986 (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGRICDSPHRILDGKNCTLIDALLGDPHCDGFQNEKWDLFIERSKAFSNCYPYDVPDYASLRSLVASSGTLEFINEGFNWTGVTQSGGSYTCKRGSVNSFFSRLNWLYESEYKYPALNVTMPNNGKFDKLYIWGVHHPSTEKEQTNLYVRASGRVTVSTKRSQQTVIPNIGSRPWVRGLSSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRTGKSSIMRSDAPIGTCSSECITPNGSIPNDKPFQNVNKITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRLIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQYTIDLTDSEMNKLFEKTRKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Beijing/353/1989 (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGRICDSPHRILDGKNCTLIDALLGDPHCDGFQNKEWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFINEDFNWTGVAQSGESYACKRGSVKSFFSRLNWLHESEYKYPALNVTMPNNGKFDKLYIWGVHHPSTDREQTNLYVRASGRVTVSTKRSQQTVIPNIGSRPWVRGLSSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRTGKSSIMRSDAPIGTCSSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRLIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Shangdong/9/1993 (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGRICGSPHRILDGKNCTLIDALLGDPHCDGFQNKEWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFINEDFNWTGVAQDGGSYACKRGSVNSFFSRLNWLHKLEYKYPALNVTMPNNGKFDKLYIWGVHHPSTDSDQTSLYVRASGRVTVSTKRSQQTVTPNIGSRPWVRGQSSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRNGKSSIMRSDAPIGNCSSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRLIEKTNEKFQQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
28
>A/Moscow/10/1999 (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGRICDSPHQILDGENCTLIDALLGDPHCDGFQNKEWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVAQNGTSSACKRRSINSFFSRLNWLHQLKYRYPALNVTMPNNDKFDKLYIWGVHHPSTDSDQTSLYTQASGRVTVSTKRSQQTVIPNIGSRPWVRGISSRISIYWTIVKPGDILLIKSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMMDGWYGFRHQNSEGTGQAADLKSTQAAINQINGKLNRLIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFERTRKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Panama/2007/1999 (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVSNGTLVKTITNDQIEVTNATELVQSSSTGRICDSPHQILDGENCTLIDALLGDPHCDGFQNKEWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVAQNGTSSACKRRSNKSFFSRLNWLHQLKYKYPALNVTMPNNEKFDKLYIWGVLHPSTDSDQISLYAQASGRVTVSTKRSQQTVIPNIGSRPWVRGVSSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQINGKLNRLIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFERTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Brisbane/10/2007 (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTIVKTITNDQIEVTNATELVQSSSTGEICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACIRRSNNSFFSRLNWLTHLKFKYPALNVTMPNNEKFDKLYIWGVHHPGTDNDQIFPYAQASGRITVSTKRSQQTVIPNIGSRPRVRNIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGIGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Perth/16/2009 (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTIVKTITNDQIEVTNATELVQSSSTGEICDSPHQILDGKNCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACIRRSKNSFFSRLNWLTHLNFKYPALNVTMPNNEQFDKLYIWGVHHPGTDKDQIFLYAQASGRITVSTKRSQQTVSPNIGSRPRVRNIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGRGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/Victoria/361/2011 (H3N2)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGATLCLGHHAVPNGTIVKTITNDQIEVTNATELVQNSSIGEICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACIRRSNNSFFSRLNWLTHLNFKYPALNVTMPNNEQFDKLYIWGVHHPGTDKDQIFLYAQSSGRITVSTKRSQQAVIPNIGSRPRIRNIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQSTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGRGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
29
>A/duck/Czechoslovakia/1956 (H4N6)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGPVICMGHHAVANGTMVKTLADDQVEVVTAQELVESQNLPELCPSPLRLVDGQTCDIINGALGSPGCDHLNGAEWDVFIERPNAVDTCYPFDVPEYQSLRSILANNGKFEFIAEEFQWNTVKQNGKSGACKRANVNDFFNRLNWLVKSDGNAYPLQNLTKINNGDYARLYIWGVHHPSTDTEQTNLYKNNPGRVTVSTKTSQTSVVPNIGSRPLVRGQSGRVSFYWTIVEPGDLIVFNTIGNLIAPRGHYKLNNQKKSTILNTAIPIGSCVSKCHTDKGSLSTTKPFQNISRIAVGDCPRYVKQGSLKLATGMRNIPEKASRGLFGAIAGFIENGWQGLIDGWYGFRHQNAEGTGTAADLKSTQAAIDQINGKLNRLIEKTNDKYHQIEKEFEQVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDVTDSEMNKLFERVRRQLRENAEDKGNGCFEIFHKCDNNCIESIRNGTYDHDIYRDEAINNRFQIQGVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/chicken/Netherlands/219/2003 (H7N7)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGDKICLGHHAVSNGTKVNTLTERGVEVVNATETVERTNVPRICSKGKRTVDLGQCGLLGTITGPPQCDQFLEFSADLIIERREGSDVCYPGKFVNEEALRQILRESGGIDKETMGFTYSGIRTNGTTSACRRSGSSFYAEMKWLLSNTDNAAFPQMTKSYKNTRKDPALIIWGIHHSGSTTEQTKLYGSGNKLITVGSSNYQQSFVPSPGARPQVNGQSGRIDFHWLILNPNDTVTFSFNGAFIALDRASFLRGKSMGIQSEVQVDANCEGDCYHSGGTIISNLPFQNINSRAVGKCPRYVKQESLLLATGMKNVPEIPKRRRRGLFGAIAGFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLNRLIEKTNQQFELIDNEFTEVERQIGNVINWTRDSMTEVWSYNAELLVAMENQHTIDLADSEMNKLYERVKRQLRENAEEDGTGCFEIFHKCDDDCMASIRNNTYDHSKYREEAIQNRIQIDPVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/chicken/Germany/N/1949 (H10N7)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGDRICLGHHAVANGTIVKTLTNEQEEVTNATETVESTNLNKLCMKGRSYKDLGNCHPVGMLIGTPVCDPHLTGTWDTLIERENAIAHCYPGATINEEALRQKIMESGGISKMSTGFTYGSSINSAGTTKACMRNGGDSFYAELKWLVSKTKGQNFPQTTNTYRNTDTAEHLIIWGIHHPSSTQEKNDLYGTQSLSISVESSTYQNNFVPVVGARPQVNGQSGRIDFHWTLVQPGDNITFSHNGGLIAPSRVSKLTGRGLGIQSEALIDNSCESKCFWRGGSINTKLPFQNLSPRTVGQCPKYVNQRSLLLATGMRNVPEVVQGRGLFGAIAGFIENGWEGMVDGWYGFRHQNAQGTGQAADYKSTQAAIDQITGKLNRLIEKTNTEFESIESEFSETEHQIGNVINWTKDSITDIWTYQAELLVAMENQHTIDMADSEMLNLYERVRKQLRQNAEEDGKGCFEIYHTCDDSCMESIRNNTYDHSQYREEALLNRLNINSVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/mallard/Astrakhan/263/1982 (H14N5)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGPIICLGHHAVENGTSVKTLTDNHVEVVSAKELVETNHTDELCPSPLKLVDGQDCDLINGALGSPGCDRLQDTTWDVFIERPTAVDTCYPFDVPDYQSLRSILASSGSLEFIAEQFTWNGVKVDGSSSACLRGGRNSFFSRLNWLTKATNGNYGPINVTKENTGSYVRLYLWGVHHPSSDNEQTDLYKVATGRVTVSTRSDQISIVPNIGSRPRVRNQSGRISIYWTLVNPGDSIIFNSIGNLIAPRGHYKISKSTKSTVLKSDKRIGSCTSPCLTDKGSIQSDKPFQNVSRIAIGNCPKYVKQGSLMLATGMRNIPGKQAKGLFGAIAGFIENGWQGLIDGWYGFRHQNAEGTGTAADLKSTQAAIDQINGKLNRLIEKTNEKYHQIEKEFEQVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDVTDSEMNKLFERVRRQLRENAEDQGNGCFEIFHQCDNNCIESIRNGTYDHNIYRDEAINNRIKINPVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
>A/shearwater/Western Australia/2576/1979 (H15N9)MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPGDKICLGHHAVANGTKVNTLTERGVEVVNATETVEITGIDKVCTKGKKAVDLGSCGILGTIIGPPQCDLHLEFKADLIIERRNSSDICYPGRFTNEEALRQIIRESGGIDKESMGFRYSGIRTDGATSACKRTVSSFYSEMKWLSSSMNNQVFPQLNQTYRNTRKEPALIVWGVHHSSSLDEQNKLYGTGNKLITVGSSKYQQSFSPSPGARPKVNGQAGRIDFHWMLLDPGDTVTFTFNGAFIAPDRATFLRSNAPSGIEYNGKSLGIQSDAQIDESCEGECFYSGGTINSPLPFQNIDSRAVGKCPRYVKQSSLPLALGMKNVPEKIRTRGLFGAIAGFIENGWEGLIDGWYGFRHQNAQGQGTAADYKSTQAAIDQITGKLNRLIEKTNKQFELIDNEFTEVEQQIGNVINWTRDSLTEIWSYN
30
AELLVAMENQHTIDLADSEMNKLYERVRRQLRENAEEDGTGCFEIFHRCDDQCMESIRNNTYNHTEYRQEALQNRIMINPVSGGGGLNDIFEAQKIEWHERLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHH
31
Fig. S7. Binding curves for reported Kd values for CR8043. Blue curves are the experimental trace obtained from bio-layer interferometry experiments, and red curves are the best global fits to the data used to calculate the Kd values reported in Figure 2.
A/duck/Ukraine/1/1963 (H3N2), Kd = 4.7 nM
These data were fit with a 2:1 binding model, yielding apparent Kd1 = 4.7 nM and Kd2 = 100 nM. The dominant binding process (accounting for the majority of the shift in observed wavelength) corresponds to the higher affinity process (Kd1 = 4.7 nM). The lower affinity process may reflect a non-specific interaction. Therefore, we report the affinity for this interaction as 4.7 nM in Figure 2.
A/Hong Kong/1/1968 (H3N2), Kd = 2.5 nM
A/Hong Kong/1/1968 mutant I18M, Kd = 3.0 nM
A/Hong Kong/1/1968 mutant D19N, Kd = 7.5 nM
32
A/Hong Kong/1/1968 mutant R25M, Kd = 760 nM
These data were fit with a 2:1 binding model, yielding apparent Kd1 = 780 nM and Kd2 = 740 nM (although kon and koff differ for the two binding processes). As these two binding processes have similar affinities, we report the affinity as the average of Kd1 and Kd2, ~760 nM, in Figure 2.
A/Hong Kong/1/1968 mutant T32E, Kd = 1.0 nM
A/Hong Kong/1/1968 mutant T32I, Kd = 2.3 nM
A/Hong Kong/1/1968 mutant T32R, Kd = 19 nM
A/Hong Kong/1/1968 mutant Q34T, Kd = 120 nM
33
A/Hong Kong/1/1968 mutant Q34R, Kd = 350 nM
A/Hong Kong/1/1968 mutant L38Y, Kd = 0.9 nM
A/Victoria/3/1975 (H3N2), Kd = 0.5 nM
A/Leningrad/360/1986 (H3N2), Kd = 1.3 nM
A/Beijing/353/1989 (H3N2), Kd = 2.6 nM
34
A/Shangdong/9/1993 (H3N2), Kd = 0.4 nM
A/Moscow/10/1999 (H3N2), Kd = 6.4 nM
A/Panama/2007/1999 (H3N2), Kd = 5.4 nM
These data were fit with a 2:1 binding model, yielding apparent Kd1 = 5.4 nM and Kd2 = 190 nM. The dominant binding process (accounting for the majority of the shift in observed wavelength) corresponds to the higher affinity process (Kd1 = 5.4 nM). The lower affinity process may reflect a non-specific interaction. Therefore, we report the affinity for this interaction as 5.4 nM in Figure 2.
A/Brisbane/10/2007 (H3N2), Kd = 0.7 nM
35
A/Perth/16/2009 (H3N2), Kd = 28 nM
A/Victoria/361/2011 (H3N2), Kd = 35 nM
A/duck/Czechoslovakia/1956 (H4N6), Kd = 390 nM
A/chicken/Netherlands/219/2003 (H7N7), Kd = 190 nM
These data were fit with a 2:1 binding model, yielding apparent Kd1 = 130 nM and Kd2 = 250 nM (although kon and koff differ for the two binding processes). As these two binding processes have similar affinities, we report the affinity as the average of Kd1 and Kd2, ~190 nM, in Figure 2.
A/chicken/Germany/N/1949 (H10N7), Kd = 0.7 nM
36
A/mallard/Astrakhan/263/1982 (H14N5), Kd = 480 nM
These data were fit with a 2:1 binding model, yielding apparent Kd1 = 500 nM and Kd2 = 460 nM (although kon and koff differ for the two binding processes). As these two binding processes have similar affinities, we report the affinity as the average of Kd1 and Kd2, ~480 nM, in Figure 2.
A/shearwater/West Australia/2576/1979 (H15N9), Kd = 350 nM
These data were fit with a 2:1 binding model, yielding apparent Kd1 = 350 nM and Kd2 = 11 nM. The dominant binding process (accounting for the majority of the shift in observed wavelength) corresponds to the lower affinity process (Kd1 = 350 nM). The higher affinity process may reflect a non-specific interaction. Therefore, we report the affinity for this interaction as 350 nM in Figure 2.
37