environmental auditing: federal compliance guide sample

Sample Environmental Auditing:

Federal Compliance Guide

www.stpub.com

http://www.stpub.com/


http://www.stpub.com/environmental-auditing-federal-compliance-guide-online

© STP

ENVIRONMENTAL AUDITING: Federal Compliance Guide

© STP

Environmental Auditing: Federal Compliance Guide

A tool for assessing a facility’s compliance with federal environmental regulations

© STP

Users of This Guide Include

• Manufacturing companies • Service facilities • Utilities • Exploration companies • Regulatory agencies • Oil and gas companies • Chemical companies • EHS auditors • And many more…

© STP

Features of This Guide

• Field-tested by recognized experts • Helps ensure compliance • Helps avoid citations and

fines • Allows experienced auditors

to expedite their assessment • Allows less experienced

auditors to review detailed instructions

http://www.stpub.com/publications/environmental/environmental-sdea

© STP

Features of This Guide

• Saves time and reduces compliance and audit costs • Demonstrates due diligence • Customizable to site-specific

requirements • Applicability Tables • Pre-audit Preparation • Rulebooks • Scoresheets • State differences summaries

available

© STP

Comprehensive Topic Areas

• Air quality • Asbestos • Drinking water • Facility management

systems • Hazardous materials • Hazardous wastes • Oil and petroleum

© STP

Comprehensive Topic Areas

• PCBs • Pesticides • Radiation (NRC licenses) • Solid wastes • Toxic Substances Control

Act (TSCA) • Underground storage tanks • Wastewater

© STP

State Differences Summaries

This guide is complemented by a set of Environmental State Differences Summaries and Checklists: • 49 states covered • Puerto Rico included

http://www.stpub.com/environmental-state-differences-summaries-and-checklists-online

© STP

State Differences Summaries

A full environmental auditing guide for California is available separately

http://www.stpub.com/environmental-auditing-integrated-california-and-federal-compliance-guide-online

© STP

Features – Applicability Tables

Use multi-level questions to quickly determine which regulations and sections of the rulebooks apply to specific facilities or operations

© STP

Sample Applicability Table

. . .

GENERAL APPLICABILITY CHECKLIST Applies Exempt.

. ..

. .

Y NSection 2 Exemption: Do facility discharges consist only of one or more of the followingtypes of discharges: q q• discharges from a vessel of sewage; effluent (wastewaters) from properly functioning

marine engines, laundry, shower, and/or galley sinks; or other discharges incidental tonormal operation of a vessel;NOTE: This exclusion does not apply to the following vessel discharges:

– overboard discharges of rubbish, trash, garbage, or other such materials;– other discharges when the vessel is operating in a capacity other than as a means of

transportation, such as when used as an energy or mining facility, a storage facility,or a seafood processing facility; or

– other discharges when the vessel is secured to the bed of the ocean, contiguous zone,or waters of the U.S. for the purpose of mineral or oil exploration or development.

• discharges of dredged fill material into waters of the U.S. that is subject to a Section 404permit under the Clean Water Act;

• discharges of pollutants that occur during an environmental release response and whileunder the direction of the On-Scene Coordinator designated pursuant to 40 CFR 300 or33 CFR 153.10(e);

• discharges of pollutants from nonpoint-source agricultural and silvicultural activities,including storm water runoff from orchards, cultivated crops, pastures, rangelands, andforest lands, except as covered in 40 CFR 122.23, 40 CFR 122.24 or 40 CFR 122.25;

• return flows from irrigated agriculture;• discharges from a water transfer that occurs between waters of the U.S. and does not

introduce any pollutants during the transfer activity;• discharges into a privately owned treatment works, except if a permit is required for those

discharges by the authorizing agency under 40 CFR 122.44(m); and/or• discharges of pesticides that have been applied consistent with all FIFRA requirements

related to protecting water quality, where:

– pesticides were applied directly to waters of the United States in order to controlpests, such as mosquito larvae, aquatic weeds, or other pests that are present inwaters of the U.S.; or

– pesticides were applied to control pests that are present over waters of the U.S.,including near such waters, such as aerial applications or vegetation control at thewaters edge, and a portion of the pesticides are unavoidably deposited to waters ofthe U.S. in order to target the pests effectively.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 3: Are you required to conduct discharge monitoring or submit any dischargemonitoring reports? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 4: Does the facility treat only domestic wastes prior to discharge of wastewaters intowaters of the U.S.? q q.

.

Y NSection 4 Exemption: Are all discharges (e.g., sewage sludge and residual) from thetreatment works currently regulated by other permits issued pursuant to one of the following q qregulatory programs:

• the Solid Waste Disposal Act;• the Safe Drinking Water Act;• the Marine Protection, Research, and Sanctuaries Act;• the Clean Air Act; or• state-specific permit programs approved by EPA?

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 5: Is the facility a concentrated animal feeding operation (CAFO)?.

.

q q

© STP

Features – Pre-audit Preparation

Lists materials to be reviewed or prepared before conducting an audit

© STP

Sample Pre-audit Preparation

WASTEWATER.

Items to consider getting in advance:

Items to have facility personnel prepare or gather in advance:

.

.PART 2: PRE-AUDIT PREPARATION

• A site diagram, or sewer system diagram, that identifies the location of all process wastewaterand/or storm water discharge outfalls.

• NPDES general or individual process wastewater discharge permit, and permit application.

• NPDES storm water permit application or Notice of Intent (NOI) for coverage under a generalpermit.

• NPDES storm water permit, or a copy of the general permit issued by the EPA or authorized statepermitting authority.

• If applicable, the most recent “No Exposure” certification submitted by the facility, ordemonstration of the “no impact” permit exclusion for small construction sites.

• For industrial facilities or construction sites, the facility’s Storm Water Pollution Prevention Plan(SWPPP).

• For regulated MS4s, the facility’s storm water management program, including public outreach andeducation program materials.

• The facility’s annual storm water reports.

• POTW industrial user discharge permit and permit application.

• Injection well permits.

• DMRs and supporting documentation.

• Treatment plant operating records.

• Treatment bypass records.

• Baseline monitoring reports (if applicable).

• Injection well operating records.

© STP

Features – Rulebooks

Provide a comprehensive set of regulatory requirement statements, plus detailed guidance on compliance issues and inspection procedures

© STP

Sample Rulebook

WASTEWATER.

1. Facilities with Wastewater Discharges: General

.

.PART 3: RULEBOOK.

.Part A: Process Wastewater Discharges

.

1.1 Determine if there have been any changes in the facility’s wastewater discharges since the lastreview, including changes in the volume of the discharge, associated with facility expansion ormodification, production changes, or process or raw materials changes. Determine if any ofthese changes require modifications to the facility’s wastewater discharge permit(s). (GMP)

Guide Note• Obtain copies of the previous wastewater discharge review and determine if noncompliance issues have been

resolved (GMP).• Determine if changes have been reported to the appropriate agency or POTW. Determine if the POTW was

notified in advance of any substantial changes in the discharge being sent to that system (40 CFR 403.12(j)).

1.2 The facility should maintain current and effective regulations on wastewater dischargerequirements. (GMP)

Guide Note• Determine if a copy of the current wastewater discharge regulations is maintained at the facility.

1.3 All points of wastewater discharge from the facility must be identified. (40 CFR 122.21(g))

Guide Note• Interview the facility manager and staff to determine the location of all sanitary and industrial discharges.

Identify these discharge points on a base map.• Determine from interviews if all sources within the facility that contribute to the total wastewater discharge

have been identified.• Verify that the facility has a copy of its current discharge permit(s), sewer ordinance, or other agreement.• Obtain site sewer drawings for sanitary and industrial plants, and identify the entities that receive the

discharge(s) (i.e., surface waters, POTWs, private treatment works, and groundwater).

1.4 The facility should ensure that unauthorized materials are not put down the sewer or otherwisedischarged to treatment works or surface waters. (GMP)

Guide Note• Verify that internal procedures for preventing unauthorized materials from being discharged are effective

(GMP).

© STP

Features – Scoresheets

Enable quick recording of a facility’s compliance status for each requirement Scoresheets are customizable

© STP

Sample Scoresheet

WASTEWATER.

Facilities with Wastewater Discharges: General

Facilities That Discharge to Surface Waters

.

.PART 4: SCORESHEET.

.Part A: Process Wastewater Discharges

SITE: DATE:Does not1.

. N/A Complies

.

.

.

. comply

1.1 Determine if there have been any changes in the facility’s wastewater discharges q q qsince the last review, including changes in the volume of the discharge, associatedwith facility expansion or modification, production changes, or process or rawmaterials changes. Determine if any of these changes require modifications to thefacility’s wastewater discharge permit(s). (GMP)

1.2 The facility should maintain current and effective regulations on wastewater q q qdischarge requirements. (GMP)

1.3 All points of wastewater discharge from the facility must be identified. (40 CFR q q q122.21(g))

1.4 The facility should ensure that unauthorized materials are not put down the sewer or q q qotherwise discharged to treatment works or surface waters. (GMP)

Does not2.. N/A Complies.... comply

2.1 All point source discharges must be covered by a valid NPDES permit, or be clearly q q qexempt. (40 CFR 122.1(b))

2.2 Certain exempt discharges do not need to be covered by an NPDES permit. (40 CFR q q q122.3)

2.3 The NPDES application must represent operations and conditions at the time of its q q qfiling, and must include all discharges to surface waters. (40 CFR 122 and 40 CFR403 – 471)

2.4 NPDES permits must represent current operations and conditions and include all q q qdischarges to surface waters. (40 CFR 122 and 40 CFR 403 – 471)

2.5 NPDES permits must be modified or revoked and reissued under certain q q qcircumstances. (40 CFR 122 and 40 CFR 403)

2.6 The NPDES permit must be renewed. (40 CFR 122.41(b)) q q q

2.7 The site may be required to have a BMP program if it falls into certain point source q q qcategories. (40 CFR 122.44(k), and 40 CFR 430.03 and 40 CFR 440.148)

2.8 Facilities that discharge certain toxic pollutants (40 CFR 401.15) into navigable q q qwaters must meet additional requirements. (40 CFR 129.5)

© STP

Formats

• Online single-user • Online multi-user • Loose-leaf • CD • Loose-leaf & CD • Multi-user through risk

management systems

© STP

Up to 4 updates per year

Sample Release Notes

EnvironmEntal auditing: FEdEral ComplianCE guidE

Release #169October 2012

nEw and notEworthy

• OnMay16,2012,EPApromulgatedtechnology-basedeffluentlimitationsguidelines(ELGs)andnewsourceperformancestandards(NSPS)undertheCleanWaterAct(CWA)fordischargesfromairportde-icingoperations(77FR29168).Theserequirements,publishedas40CFRPart449,applytowastewaterassociatedwiththedeicingofairfieldpavementatprimaryairports.Therulerequirescoveredairportstocomplywithrequirementsbasedonsubstitutionoflesstoxicpavementde-icersthatdonotcontainurea.TherulealsoestablishesNSPSforwastewaterdischargesassociatedwithaircraftde-icingforasubsetofnewairports.TheELGsandNSPSwillbeincorporatedintoNationalPollutantDischargeEliminationSystem(NPDES)permitsissuedbythepermittingauthority.TheeffectivedateofthisruleisJune15,2012.Thesetreatmentstandardswillbeaddressedinafutureupdate.

• OnAugust14,2012,EPAfinalizedthenewsourceperformancestandards(NSPS)fornitricacidplants(77FR48433).Nitricacidplantsincludeoneormorenitricacidproductionunits(NAPUs).Theserevisions,promulgatedin 40CFR60SubpartGa,includeachangetothenitrogenoxides(NOx)emissionlimit,whichappliestoeachNAPUcommencingconstruction,modification,orreconstructionafterOctober14,2011.Theserevisionsalsoincludeadditionaltestingandmonitoringrequirements.TheeffectivedateofthisruleisAugust14,2012.Thesenewsourceperformancestandardswillbeaddressedinafutureupdate.

© STP

Please enjoy this sample of Environmental Auditing: Federal Compliance Guide


HAZARDOUS WASTE.

Applicability of This Module

.PART 1: INTRODUCTION

Use the following General Applicability Checklist to determine whether a rulebook and its sectionsapply to your operation.

If you answer YES to the rulebook question, the rulebook applies to you unless you answer YES for arulebook exemption.

Once you determine that the rulebook does apply to your operation, you must answer the sectionquestions. If a section question does not exist, then that section applies if the rulebook applies. If youanswer YES to a section question, that section applies to you unless you answer YES for an exemptionfrom that section. If you answer YES to a rulebook or section exemption, then the rulebook or sectiondoes not apply.

. . .


. ..

. .

.

Rulebook A1: Conditionally Exempt Small Quantity GeneratorRequirements.

.

Y NRULEBOOK: Does your facility generate in a calendar month 100 kg or less of hazardouswaste and accumulate less than 1,000 kg of hazardous waste at any time; and generate or q qaccumulate at any one time 1 kg or less of acute hazardous waste, or 100 kg or less of anyresidue or contaminated soil, waste, or other debris resulting from clean-up of a spill of anacute hazardous waste into or on any land or water?.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 3: Is your facility (or portion thereof that generates hazardous waste) only used as alaboratory? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 4: Is your facility an “eligible academic entity” that has chosen to manage its wastein accordance with the alternative set of hazardous waste generator requirements in 40 CFR q q262 Subpart K?.

.

.

.

Rulebook A2: Small Quantity Generator Requirements.

.

Y NRULEBOOK: Does your facility generate, in a calendar month, more than 100 kg ofhazardous waste but less than 1,000 kg of hazardous waste, and accumulate no more than q q6,000 kg of hazardous waste at any time?.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 3: Is the facility (or portion thereof that generates hazardous wastes) only used as alaboratory? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 10: Does your facility generate mixed hazardous/radioactive wastes?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................


.

.

.

Rulebook A3: Large Quantity Generator Requirements.

.

Y NRULEBOOK: Do you generate 1000 kg or more of hazardous waste; more than 1 kg ofacute hazardous waste; or more than 100 kg of residue or contaminated soil, waste, or other q qdebris contaminated with acute hazardous waste in any calendar month?.

.............................................................................................................................................................................................................................................................. ........................... ...........................

EAF 10/12 ©STP HW/Part 1 - 1

Hazardous Waste Introduction. . .


. ..

. .

Y NSection 3: Is the facility (or portion thereof that generates hazardous wastes) only used as alaboratory? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 6: Does your facility accumulate or treat VOC-containing wastes in containers ortanks? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 11: Does your facility generate mixed hazardous/radioactive wastes?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................


.

.

.

Rulebook B: TSD Facilities—General Requirements.

.

Y NRULEBOOK: Do you store hazardous wastes on-site for longer than 90 days, or treat ordispose of hazardous wastes on-site? q q.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 5: Does your facility store or treat hazardous wastes containing VOCs in containers,tanks, or surface impoundments? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 6: Does your facility have any process vents associated with distillation,fractionation, thin-film evaporation, solvent extraction, or air or steam stripping operations q qthat manage hazardous wastes with organic concentrations of at least 10 ppm by weight?.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 7: Does your facility have equipment associated with hazardous waste managementunits that contains or contacts hazardous wastes with organic concentrations of at least 10% q qby weight?.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 12: Does your facility treat or store hazardous wastes prior to ultimate disposal?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 13: Is your facility a land disposal facility that is the final disposal site for hazardouswastes? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 17: Does your facility transport hazardous waste?.

.

q qY NSection 17 Exemption: Does your facility perform any of the following:q q• On-site transportation of hazardous waste by generators or by owners or operators of

TSD facilities.• Transportation of used oil — those requirements are covered in Section 4 of Rulebook D

of this module, “Used Oil Management.”• Transportation of universal wastes — those requirements are covered in Section 4 of

Rulebook E of this module, “Universal Wastes.”• Transportation of military munitions — those requirements are covered in Section 13 of

Rulebook C of this module, “TSD Facilities — Specific Requirements.”• Transportation during an explosives or munitions emergency response conducted in

accordance with 40 CFR 264.1(g)(8)(i)(D) or (iv) or 40 CFR 265.1(c)(11)(i)(D) or (iv),and 40 CFR 270.1(c)(3)(i)(D) or (iii).

• Transportation of mixed wastes subject to a conditional exemption for hazardous wastetransportation and disposal activities under 40 CFR 266.305; see Section 11 of part A-3of this module, “Large Quantity Generator Requirements.”

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 18: Does your facility reclaim, or store for more than 10 days, hazardous secondarymaterials that were generated by another person and that are excluded from regulation as a q qhazardous waste?.

.

.

.

Rulebook C: TSD Facilities—Specific Requirements.

.

HW/Part 1 - 2 EAF 10/12 ©STP



. ..

. .

Y NRULEBOOK: Do you store hazardous wastes on site for longer than 90 days, or treat ordispose of hazardous wastes on-site? q q.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 1: Do you use surface impoundments to treat, store or dispose of hazardous wastes?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 2: Do you use waste piles to treat or store hazardous waste?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 3: Do you have a landfill or waste pile that is used to dispose of hazardous waste?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 4: Do you operate a hazardous waste incinerator?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 5: Do you operate under interim status and thermally treat hazardous waste indevices other than enclosed devices using controlled flame combustion? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 6: Do you burn or process hazardous wastes in a boiler or industrial furnace (BIF)?q qNOTE: “Burn” means burning of hazardous wastes for energy recovery or destruction;

“process” means processing of hazardous wastes for materials recovery or as an ingredient..

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 7: Do you operate under interim status and treat hazardous wastes by chemical,physical, or biological methods in units other than tanks, surface impoundments, and land q qtreatment facilities?.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 8: Do you treat or store hazardous waste in containment buildings?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 9: Do you treat or dispose of hazardous waste in land treatment units?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 10: Do you manage remediation wastes in a corrective action management unit(CAMU), temporary unit, or staging pile? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 11: Do you use drip pads to convey treated wood drippage, precipitation, and/orsurface water run-off to an associated collection system q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 12: Do you treat, store, or dispose of hazardous waste in miscellaneous units?NOTE: A “miscellaneous unit” is a hazardous waste management unit that is not a container, q qtank, surface impoundment, pile, land treatment unit, landfill, incinerator, boiler, industrialfurnace, underground injection well, containment building, CAMU, unit eligible for aresearch, development, and demonstration permit under 40 CFR 270.65, or staging pile..

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 13: Do you have waste military munitions?.

.

q q.

.

Rulebook D: Used Oil Management.

.

Y NRULEBOOK: Does your facility generate, collect, transport, process, or re-refine used oil;burn used oil for energy recovery; or market used oil fuel? q q.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 2: Do you generate used oil, or operate a used oil collection center or aggregationpoint? NOTE: A used oil aggregation point is a site that accepts used oil collected only from q qother used oil generation sites owned by that same person and to which used oil istransported in shipments of no more than 55 gallons, and/or accepts used oil from householddo-it-yourselfers..

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 3: Do you operate a used oil collection center or aggregation point?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................


Regulatory Summary



. ..

. .

Y NSection 4: Do you transport used oil, or operate a used oil transfer facility that stores used oilfor no more than 35 days? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 5: Does your facility process or re-refine used oil?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 6: Does your facility burn off-specification used oil for energy recovery?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 7: Do you direct shipments of off-specification used oil from your facility to a usedoil burner; or are you the first person to claim the used oil that is to be burned for energy q qrecovery meets the used oil fuel specifications?.

.

.

.

Rulebook E: Universal Wastes.

.

Y NRULEBOOK: Does your facility generate universal waste, collect and accumulate universalwastes received from other handlers, conduct off-site transportation of universal waste, or q qtreat, recycle, or dispose of universal waste? NOTE: Universal wastes are batteries, lamps,mercury-containing equipment, and pesticides..

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 2: Does your facility generate, or collect from other handlers, universal wastes, andaccumulate less than 5,000 kg or less total universal wastes at any time? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 3: Does your facility generate, or collect from other handlers, universal wastes andaccumulate 5,000 kg or more total universal wastes at any time? q q.

.

.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 4: Does your facility transport universal waste?.

.

q q.............................................................................................................................................................................................................................................................. ........................... ...........................

Y NSection 5: Does your facility treat, dispose of, or recycle a particular category of universalwaste? q q.

.

.

The Resource Conservation and Recovery Act (RCRA) and the Hazardous and Solid WasteAmendments of 1984 (HSWA) are the enabling legislation that authorize federal hazardous wasteregulations. These federal laws have been codified in 49 USC 6901 - 6965. The federal regulationsthat implement these laws are organized into the following major sections:• 40 CFR 260 Hazardous Waste Management System: General;• 40 CFR 261 Identification and Listing of Hazardous Waste;• 40 CFR 262 Standards Applicable to Generators of Hazardous Waste;• 40 CFR 263 Standards Applicable to Transporters of Hazardous Waste;• 40 CFR 264 Standards for Owners and Operators of Hazardous Waste Treatment, Storage .

and Disposal Facilities;• 40 CFR 265 Interim Status Standards for Owners and Operators of Hazardous Waste .

Treatment Storage and Disposal Facilities;• 40 CFR 266 Standards for the Management of Specific Hazardous Wastes and Facilities;• 40 CFR 267 Standards for Owners and Operators of Hazardous Waste Facilities Operating

Under a Standardized Permit;• 40 CFR 268 Land Disposal Restrictions;• 40 CFR 270 EPA Administered Permit Programs: The Hazardous Waste Permit Program;• 40 CFR 271 Requirements for Authorization of State Hazardous Waste Programs;• 40 CFR 273 Standards for Universal Waste Management;


Hazardous Waste Introduction

• 40 CFR 278 Criteria for the Management of Granular Mine Tailings (Chat) in Asphalt Concrete .and Portland Cement Concrete in Transportation Construction Projects Funded in .Whole or in Part by Federal Funds;

• 40 CFR 279 Standards for Managing Used Oil.

All hazardous waste generators and facilities must comply with these regulations unless a state has ahazardous waste management program and associated regulations of its own that are authorized by theU.S. Environmental Protection Agency (EPA). Many states have met EPA 40 CFR 271 requirementsand have been authorized to manage their own state programs. RCRA encourages states to developtheir own hazardous waste statutes and to operate regulatory programs in lieu of the federal EPA-managed program. Many of the states have adopted the EPA regulations by reference or havepromulgated regulations that are identical to EPA regulations. Several other states have developedhazardous waste regulatory programs that are substantially equivalent to the federal program, and afew states have implemented programs that differ substantially from the EPA program. In addition,EPA may directly enforce new regulations authorized by HSWA that do not have equivalent staterequirements.

This difference between individual state regulations and the federal program requires that auditorscheck the status of the state’s authorization and then determine which regulations actually apply atthat particular facility. Because the rulebook is based exclusively on the requirements of the federalRCRA/EPA program, it is necessary to determine in what ways the applicable state program differsfrom the RCRA/EPA program.

EPA’s Project XL gives regulated entities, both private and public, an opportunity to implement pilotprojects aimed at developing common sense, cost-effective strategies that will replace or modifyspecific regulatory requirements, on the condition that they produce and demonstrate superiorenvironmental performance. EPA is evaluating the results of each project to determine which specificelements of the project(s), if any, should be more broadly applied to other regulated entities. A pilotproject allowing consolidation of wastes at remote sites has been approved for New York Stateutilities, as detailed in Subpart I of 40 CFR 262. In addition, another project that establishes alaboratory environmental management standard applicable to three university laboratories has been setforth in Subpart J of 40 CFR 262.

Generator Requirements

Any facility that generates more than 100 kg (equivalent to 220 lb or half of a 45-gal drum) ofhazardous wastes a month (or 1 kg/month of acutely hazardous wastes; AHW) is required todetermine whether its wastes are hazardous, to properly hold or otherwise manage these wastes on-site, prepare transportation manifests, and properly ship the wastes offsite for treatment, storage, ordisposal. Other requirements include implementation of preparedness and prevention measures,preparation of a contingency plan, and training of workers. A facility that generates 100 kg or less ofhazardous wastes a month (or 1 kg/month AHW) is required to determine whether its wastes arehazardous, but is otherwise exempt from federal hazardous waste regulation provided it complies withthe limits on the quantity of wastes accumulated on-site.



Hazardous wastes are either those that appear in 40 CFR 261 as “listed” wastes (F, K, U, or P codes;see Tables 2 – 5 in this Introduction), or wastes that demonstrate characteristics of ignitability (havinga flashpoint less than 140(F), corrosivity (having a pH level less than 2.0 or greater that 12.5),reactivity, or toxicity (exceeding Toxicity Characteristic Leaching Procedure [TCLP] toxicity limits;see Table 1 in this Introduction). A number of exemptions from the definition of solid waste andhazardous waste have been established by EPA under 40 CFR 261, and generators should carefullyreview the exemptions to determine if any their wastestreams are exempt from the hazardous wasteregulations. Some exemptions contain specific conditions that a generator must meet, which mayinclude requirements for notification, accumulation or storage, sampling and analysis, waste analysisplans, contaminant limits, and recordkeeping.

A generator of hazardous wastes must obtain an EPA identification (ID) number, but does not need apermit if wastes are accumulated for less than 90 days. Small quantity generators (SQGs), facilitiesthat generate greater than 100 kg but less than 1,000 kg of hazardous wastes per month, may qualifyfor exceptions to the full scope of the regulations.

An alternative set of hazardous waste generator requirements has been established in 40 CFR 262Subpart K for laboratories owned by an “eligible academic entity,” which is a college or university, ora non-profit research institute that is owned by or has a formal written affiliation agreement with acollege or university, or a teaching hospital that is owned by or has a formal written affiliationagreement with a college or university. This Subpart provides a flexible and protective set ofregulations that address the unique issues associated with hazardous waste generation andaccumulation in laboratories at eligible academic entities. Compliance with these requirements isoptional, and eligible academic entities have the choice of managing their hazardous wastes inaccordance with the alternative regulations or remaining subject to the hazardous waste generatorregulations.

Accumulation Point Management

An accumulation point is an area in or near the workplace where hazardous wastes are accumulatedprior to treatment or disposal. Accumulation in these areas is temporary and must not exceed 90 days(180 days for SQGs, or 270 days for SQGs who must transport the wastes 200 miles or more fortreatment, storage, or disposal) from the time the first wastes begin to accumulate in a container.Permits are not required for accumulation points, but certain controls relative to spill containment,signage, labeling, inspections, and training are required.

The regulations also allow accumulation of small amounts of hazardous wastes in containers at ornear the point where the wastes are generated without requiring compliance with the more-stringentrequirements that apply to accumulation points. Accumulation at these “satellite accumulation areas”is limited to 55 gal of hazardous wastes or 1 qt of AHW.

Satellite areas must be under the control of the operator of the process generating the waste and mustbe labeled. Additional requirements related to management of containers also apply. Once the55-gal/1-qt limit is reached, the container must be marked with date the limit was reached and eithertransferred to the hazardous waste accumulation point or sent offsite for treatment, storage, or disposalwithin 3 days. Wastes transferred to accumulation points must meet all applicable accumulation siterequirements, including the time limit for remaining at that location.



Transport Requirements

Any facility that ships hazardous wastes from their site must properly prepare those wastes forshipment. Containers of hazardous wastes shipped offsite must be properly labeled. The labels shouldidentify each waste and its hazard class. Shipments must be accompanied by hazardous wastemanifests. On March 4, 2005 (70 FR 10776) EPA revised the manifesting requirements to require theuse of a standardized manifest form in all states effective September 5, 2006.

In addition, hazardous waste shipments are subject to the full transportation requirements stipulated inthe U.S. Department of Transportation (DOT) hazardous materials transportation regulations (49CFR). DOT packaging requirements can be found in the HM-181 standards of the DOT regulations.

Persons who transport hazardous wastes must obtain an EPA identification number, comply withhazardous waste manifesting requirements, and respond to any discharges of hazardous waste thatoccur during transport.

Permitted Treatment, Storage, and Disposal (TSD) Facility Requirements

Operation of a hazardous waste treatment, storage, and/or disposal (TSD) facility is subject to detailedregulation and permitting under federal or state regulations. Owners or operators of new TSD facilitiesmust apply for a RCRA permit prior to treating, storing, or disposing of any hazardous waste bysubmitting Part A and Part B of the permit application at least 180 days before physical constructionis expected to commence. TSD facilities that have a RCRA Part B permit are subject to therequirements of 40 CFR 264. Existing facilities that were not issued a RCRA permit when theregulations were promulgated in 1980 were considered to have interim status and allowed to continueto operate if they complied with RCRA-mandated Interim Status Standards (ISS). These ISS (whichare contained in 40 CFR 265) are similar in scope to the Part B permit standards contained in 40 CFR264 but are generally less stringent and require fewer facility modifications or improvements. Mostinterim status facilities were required to be permitted or commence closure by November 9, 1992,however, a few facilities still continue to operate under interim status.

On September 8, 2005, EPA issued a final rule (effective October 11, 2005) that establishes a newtype of RCRA permit, called a standardized permit. The standardized permit streamlines thepermitting process by allowing certain types of facilities that treat or store hazardous waste to obtainand modify their permits more easily (the permitting process for standardized permits is found in 40CFR 270 Subpart J). The standardized permit is available to TSD facilities that meet either of thefollowing criteria:• The facility generates and then stores or non-thermally treats hazardous waste on-site in tanks,

containers, and/or containment buildings; or• The facility receives hazardous waste generated off-site by a generator under the same ownership

as the receiving facility, and then stores or non-thermally treats the hazardous waste in containers,tanks, and/or containment buildings.

TSD facilities operating under a RCRA standardized permit are subject to the requirements of 40 CFR267. The regulations applicable to facilities operating under a standardized permit generally mirror thePart B permit standards in 40 CFR 264.

Administrative and technical standards are applied to a particular facility through the RCRA permit.The administrative standards have a number of requirements, including the following:• Various plans must be developed to ensure that emergencies can be dealt with.• Wastes received at the facility must be properly identified and tracked.



• Operating personnel must be adequately trained to operate the facility and respond to emergencies.• The facility must be inspected routinely.• Records of operations must be compiled and maintained.• Reports of both routine and contingency operations must be made to the applicable regulatory

agency.• A plan for ceasing operations and closing the facility must be developed, kept on-hand, and

updated at least annually.• Facilities may be required to institute corrective action for releases of hazardous waste or

hazardous waste constituents from a solid waste management unit.

Technical standards that apply to TSD facilities fall into 2 classes: general standards that apply to allTSD facilities, and specific standards that apply to various types of facilities (i.e., container storageareas, tanks, surface impoundments, waste piles, land treatment facilities, incinerators, landfills,thermal treatment facilities, and chemical, physical, or biological treatment facilities).

Used Oil

On September 10, 1992, EPA issued a final rule regarding management of used oil. The agencydetermined that used oil destined for recycling or burning for energy recovery need not be regulatedas hazardous waste. The rule set management standards for used oil generators, collection stations,processors and rerefiners, transporters, burners, and marketers. Used oil generators must comply withrequirements for accumulation of their used oil in containers and tanks, labeling, release response, andoffsite shipment. Note that many states regulate used oil as special or hazardous wastes, and havemore-stringent regulations.

Universal Wastes

EPA issued its first universal waste regulation on May 11, 1995. These regulations are designed toencourage recycling and proper disposal of certain common hazardous wastes; as a result, they setforth less-stringent requirements for their management. Under the original regulation, universal wastesincluded certain batteries (such as nickel-cadmium and small sealed lead-acid batteries), pesticides,and mercury thermostats. On July 6, 1999, EPA issued a final rule that added waste lamps (such asfluorescent, high intensity discharge, neon, mercury vapor, high-pressure sodium, and metal halidelamps) to the list of regulated universal wastes effective January 6, 2000. Mercury-containingequipment was added to the list of regulated universal wastes on August 5, 2005. Mercury-containingequipment is a device or part of a device that contains elemental mercury integral to its function,including mercury thermostats.

The universal waste regulations establish requirements for notification, waste management, labeling,accumulation time limits, employee training, release response, offsite shipment, and waste tracking forhandlers of universal wastes. Separate requirements have been established for small quantity handlers(those who accumulate less than 5,000 kg at any time) and large quantity handlers (those whoaccumulate 5,000 kg or more at any time). The regulations also set standards for universal wastetransporters and destination facilities. States may adopt the entire federal universal waste rule orportions of it, including a petition provision that allows states to add wastes to their universal wasteprograms without EPA having to add such wastes at the federal level.



Military Munitions

On August 12, 1997, the final rule for military munitions took effect. This rule consolidates therequirements applicable solely to military munitions in a new subpart under 40 CFR Part 266 (SubpartM). Military munitions include all types of both conventional and chemical ammunition products andtheir components, produced by or for the military for national defense and security (includingmunitions produced by other parties under contract to or acting as an agent for the U.S. Department ofDefense [DOD], such as government owned/contractor operated operations). Subpart M identifieswhen military munitions become a solid waste and, if these wastes are also hazardous under the newsubpart or 40 CFR 261, the management standards that apply to them. Waste non-chemical militarymunitions that otherwise meet the definition of hazardous waste are not regulated under RCRA ashazardous wastes if they comply with the transportation standards for waste munitions shippedbetween military installations. Similarly, storage of waste non-chemical military munitions is alsoexempt from RCRA hazardous waste regulation provided that the standards given in Subpart M arefollowed. Waste military munitions that are chemical agents or chemical munitions that exhibit ahazardous waste characteristic, or that are listed hazardous wastes, are subject to the regulatoryrequirements of RCRA Subtitle C; there are no alternative management standards. Requirements foremergency response and for treatment and disposal of waste military munitions follow RCRAregulations for hazardous wastes.

In addition to subpart M, Subpart EE promulgated in 40 CFR 264 and 265 addresses all munitionsand explosives, not just military ones. These requirements address design and operating standards ofhazardous waste munitions and explosives storage units, and closure and post-closure care standardsfor these units.

Hazardous/Radioactive Mixed Wastes

Hazardous and radioactive mixed wastes, commonly referred to as simply “mixed wastes,” are RCRAhazardous wastes that contain radionuclides. Mixed wastes are subject to a dual regulatory framework:they are regulated by RCRA, as implemented by EPA or an authorized state for their hazardouscomponent; and by the Atomic Energy Act (AEA), as implemented by either the Department ofEnergy (DOE), the Nuclear Regulatory Commission (NRC), or an NRC Agreement State, for theirradiological component. Once wastes are determined to be mixed wastes, waste handlers must complywith both RCRA and AEA statutes and regulations. As a subset of hazardous wastes, mixed wastesare regulated by EPA in unauthorized states. States that are RCRA-authorized and have adoptedmixed waste authority regulate mixed wastes under their own hazardous waste program (which maycontain regulations more stringent than those in the federal RCRA program). Some states (referred toas “Agreement States”) have signed agreements with NRC enabling them to regulate source,byproduct, and small quantities of special nuclear materials within their boundaries. These states arerequired to adopt programs that are comparable with the NRC program, and may adopt requirementsthat are more stringent than or are in addition to the federal program.

EPA issued a final rule on May 16, 2001, aimed at providing increased flexibility to generators andfacilities that manage low-level mixed wastes (LLMW) and technologically-enhanced naturallyoccurring and/or accelerator-produced radioactive materials (NARM) containing hazardous wastes.Under this rule, EPA conditionally exempts LLMW from some RCRA storage and treatmentregulations, and conditionally exempts LLMW or eligible NARM from RCRA hazardous wastetransportation and disposal regulations. These wastes are exempt from RCRA requirements, includingpermitting, provided the facility meets specific conditions. The exempt wastes must then be managedas radioactive wastes in accordance with applicable NRC or NRC Agreement State regulations.


Key Compliance Definitions


Criteria for the Safe and Environmentally Protective Use of Granular Mine Tailings Known as“Chat”

Chat is a gravel-like waste created from lead and zinc mining activities that occurred in the Tri-StateMining District of Southwest Missouri, Southeast Kansas and Northeast Oklahoma. Chat is exemptfrom regulation as a hazardous waste under RCRA because it falls under an exemption forextraction/beneficiation wastes, but is subject to the Comprehensive Environmental Response andLiability Act (CERCLA) and to certain enforcement orders under RCRA. EPA issued a final rule inJuly 2007 that established mandatory criteria for the environmentally protective use of chat intransportation construction projects, where chat is used as an aggregate in asphalt and cement roadsurfaces. These criteria, along with specific certification and recordkeeping requirements, must be metby any transportation construction projects that are funded, wholly or in part, with federal funds. Thepurpose of the rule is to provide for the beneficial and environmentally safe use of chat in order toboth reduce chat piles and improve human health and the environment in the Tri-State area. Theseregulations, which are not covered within the scope of this guide, are found at 40 CFR 278.

Most of these definitions were obtained from the federal regulations cited previously. Those terms notspecifically defined in the regulations are defined here as they are used in this module.

Aboveground Tank or Aboveground Storage Tank (AST) – A device that meets the definition of tankin 40 CFR 260.10 and is situated in such a way that the entire surface area of the tank is completelyabove the plane of the adjacent surrounding surface and the entire surface area of the tank (includingthe tank bottom) can be visually inspected (40 CFR 260.10).

Accumulation Point – A designated area of a facility at which hazardous wastes are held temporarilyin tanks or containers for 90 days or less (40 CFR 262.34). See also Satellite Accumulation Area.

Active Range – A military range that is currently in service and is being regularly used for rangeactivities.

Acute or Acutely Hazardous Waste (AHW) – Any waste listed under 40 CFR 261.31 - 33 with ahazard code of “H.” These include EPA hazardous waste numbers F020, F021, F022, F023, F026, andF027 (see Table 2 in this introduction) and all P-listed wastes (see Table 4 in this introduction).

Agreement State – A state that has entered into an agreement with the NRC under subsection 274b ofthe Atomic Energy Act of 1954, as amended (68 Stat. 919), to assume responsibility for regulatingwithin its borders byproduct, source, or special nuclear material in quantities not sufficient to form acritical mass.

Ancillary Equipment – Any device (including but not limited to such devices as piping, fittings,flanges, valves, and pumps) that is used to distribute, meter, or control the flow of hazardous wastesfrom its point of generation to accumulation, storage or treatment tanks, or between hazardous wasteaccumulation, storage and treatment tanks to a point of disposal onsite, or to a point of shipment fortreatment or disposal offsite (40 CFR 260.10).

Average Volatile Organic (VO) Concentration – The mass-weighted average volatile organicconcentration of a hazardous waste as determined in accordance with the requirements of 40 CFR265.1084.



Battery – A device consisting of one or more electrically-connected electrochemical cells that isdesigned to receive, store, and deliver electrical energy. An electrochemical cell is a system consistingof an anode, cathode, and an electrolyte, plus such connections (electrical and mechanical) as may beneeded to allow the cell to deliver or receive electrical energy. The term battery also includes anintact, unbroken battery from which the electrolyte has been removed.

Cathode Ray Tube or CRT – A vacuum tube, composed primarily of glass, which is the visual orvideo display component of an electronic device. A used, intact CRT means a CRT whose vacuumhas not been released. A used, broken CRT means glass removed from its housing or casing whosevacuum has been released.

Chemical Agents and Munitions – Defined in 50 USC 1521(j)(1) as an agent or munition that, throughits chemical properties, produces lethal or other damaging effects on human beings, except that suchterm does not include riot control agents, chemical herbicides, smoke, and other obscuration materials.

Closure Device – A cap, hatch, lid, plug, seal, valve, or other type of fitting that blocks an opening ina cover such that when the device is secured in the closed position, it prevents or reduces air pollutantemissions to the atmosphere. Closure devices include devices that are detachable from the cover (e.g.,a sampling port cap), manually operated (e.g., a hinged access lid or hatch), or automatically operated(e.g., a spring-loaded pressure relief valve).

Component – Either the storage tank or ancillary equipment of the tank system (40 CFR 260.10).

Conditionally Exempt Small Quantity Generator (CESQG) – A generator that produces no more than100 kg/month of hazardous wastes and no more than 1 kg/month of AHW (40 CFR 261.5).

Consolidation Site – A site to which hazardous wastes, initially collected at a remote site, aretransported.

Container – Any portable device in which materials are stored, transported, treated, disposed of, orotherwise handled (40 CFR 260.10).

Containment Building – A hazardous waste management unit that is used to store or treat hazardouswastes under the provisions of 40 CFR 264 or 265 Subpart DD (40 CFR 260.10).

Continuous Seal – A seal that forms a continuous closure to cover completely the space between theedge of the floating roof and the wall of a tank. A continuous seal may be a vapor-mounted seal,liquid-mounted seal, or metallic shoe seal. A continuous seal may be constructed of a series offastened segments.

Corrosion Expert – A person who, by reason of his/her knowledge of the physical sciences and theprinciples of engineering and mathematics acquired by a professional education and related practicalexperience, is qualified to engage in the practice of corrosion control on buried or submerged metalpiping systems and metal tanks. Such a person must be certified as being qualified by the NationalAssociation of Corrosion Engineers (NACE) or be a registered professional engineer who hascertification and licensing that includes education and experience in corrosion control and/or buried orsubmerged metal piping systems or tanks (40 CFR 260.10).

Cover – A device that provides a continuous barrier over the hazardous wastes managed in a unit toprevent or reduce air pollutant emissions to the atmosphere. A cover may have openings (such asaccess hatches, sampling ports, and gauge wells) that are necessary for operation, inspection,maintenance, and repair of the covered unit. A cover may be a separate piece of equipment that can



be detached and removed from the unit, or may be formed by structural features permanentlyintegrated into the unit’s design.

CRT Collector – A person who receives used, intact CRTs for recycling, repair, resale, or donation.

CRT Processing – All of the following activities:• receiving broken or intact CRTs;• intentionally breaking intact CRTs or further breaking or separating broken CRTs; and• sorting or otherwise managing glass removed from CRT monitors.

Destination Facility – A facility that treats, disposes of, or recycles a particular category of universalwastes, except for certain management activities allowed to be conducted by handlers. A facility atwhich a particular category of universal wastes is only accumulated is not a destination facility forpurposes of managing that category of universal wastes.

Disposal – The discharge, deposit, injection, dumping, spilling, leaking, or placing of any solid wastesor hazardous wastes into or on any land or water so that such solid wastes or hazardous wastes or anyconstituent thereof may enter the environment or be emitted into the air or discharged into any waters,including groundwater (40 CFR 260.10).

Disposal Facility – A facility or part of a facility at which hazardous wastes are intentionally placedinto or on any land or water and at which the wastes will remain after closure. The term disposalfacility does not include a CAMU into which remediation wastes are placed (40 CFR 260.10).

Drip Pad – An engineered structure that consists of a curbed, free-draining base and that isconstructed of nonearthen materials and designed to convey preservative kick-back or drippage fromtreated wood, precipitation, and surface water runon to an associated collection system at woodpreserving plants (40 CFR 260.10).

Elementary Neutralization Unit – A device that meets the definition in 40 CFR 261.10 of tank, tanksystem, container, transport vehicle, or vessel and that is used to neutralize only those hazardouswastes that exhibit corrosivity (as defined in 40 CFR 261.22) or are listed in Subpart D of 40 CFR261 only because of corrosivity.

Eligible Academic Entity – A college or university, or a non-profit research institute that is owned byor has a formal written affiliation agreement with a college or university, or a teaching hospital that isowned by or has a formal written affiliation agreement with a college or university (40 CFR 262.200).

Enclosure – A structure that surrounds a tank or container, captures organic vapors emitted from thetank or container, and vents the captured vapors through a closed-vent system to a control device.

Existing Tank System or Existing Component – A tank system or component, used for theaccumulation, storage, or treatment of hazardous wastes, that is in operation or for which installationcommenced on or prior to July 14, 1986. Installations are considered to have commenced:• if the owner or operator obtained all federal, state, and local approvals or permits necessary to

begin physical construction of the site or installation of the tank system; and• if either (40 CFR 260.10):

1) continuous onsite physical construction of the site or installation program has begun; or2) the owner or operator has entered into contractual obligations for physical construction of the

site or installation of the tank system to be completed within a reasonable time, and thoseobligations cannot be canceled or modified without substantial loss.



Explosives or Munitions Emergency – A situation involving the suspected or detected presence of anyof the following that creates an actual or potential imminent threat to human health (including safety)or the environment (including property), as determined by an explosives or munitions emergencyresponse specialist:• unexploded ordnance (UXO);• damaged or deteriorated explosives or munitions;• an improvised explosive device (IED);• other potentially explosive material or device; or• other potentially harmful military chemical munitions or device.

Such situations may require immediate and expeditious action by an explosives or munitionsemergency response specialist to control, mitigate, or eliminate the threat.

Explosives or Munitions Emergency Response – All immediate response activities by an explosivesand munitions emergency response specialist to control, mitigate, or eliminate the actual or potentialthreat encountered during an explosives or munitions emergency. An explosives or munitionsemergency response may include the following:• in-place render-safe procedures;• treatment or destruction of the explosive or munitions; and/or• transportation of those items to another location to be rendered safe, treated, or destroyed.

Any reasonable delay in the completion of an explosives or munitions emergency response caused bya necessary, unforeseen, or uncontrollable circumstance will not terminate the explosives or munitionsemergency. Explosives and munitions emergency responses can occur on either public or private landsand are not limited to responses at RCRA facilities.

Explosives or Munitions Emergency Response Specialist – An individual trained in chemical orconventional munitions or explosives handling, transportation, render-safe procedures, or destructiontechniques. Explosives or munitions emergency response specialists include:• DOD personnel;• emergency explosive ordnance disposal (EOD) personnel;• technical escort union (TEU) personnel;• DOD-certified civilian or contractor personnel; and• other civilian or federal, state, or local government personnel similarly trained in explosives or

munitions emergency responses.

External Floating Roof – A pontoon-type or double-deck type cover that rests on the surface ofmaterial that is managed in a tank with no fixed roof.

Facility – All contiguous land, structures, and other appurtenances, as well as improvements on theland, used for treating, storing, or disposing of hazardous wastes, or for managing hazardoussecondary materials prior to reclamation. A facility may consist of several treatment, storage, ordisposal operational units (e.g., 1 or more landfills, surface impoundments, or combinations). For thepurpose of implementing corrective action under 40 CFR 264.101, facility means all contiguousproperty under the control of the owner or operator seeking a permit under Subtitle C of RCRA. Thisdefinition also applies to facilities implementing corrective action under RCRA Section 3008(h) (40CFR 260.10).

Fixed Roof – A cover that is mounted on a unit in a stationary position and does not move withfluctuations in the level of the material managed in the unit.



Floating Roof – A cover consisting of a double deck, pontoon single deck, or internal floating coverthat rests upon and is supported by the materials being contained, and that is equipped with acontinuous seal.

Generator – Any person, by site, whose acts or processes produce hazardous wastes identified orlisted in 40 CFR 261 or whose act first causes a hazardous waste to become subject to regulation(40 CFR 260.10).

Good Management Practice (GMP) – Practices that, although not mandated by law, are encouraged topromote safe operating procedures.

Hard-Piping – Pipe or tubing that is manufactured and properly installed in accordance with relevantstandards and good engineering practices.

Hazardous Secondary Material – A secondary material (e.g., spent material, by-product, or sludge)that, when discarded, would be identified as hazardous waste under 40 CFR 261.

Hazardous Secondary Material Generator – Any person whose act or process produces hazardoussecondary materials at the generating facility. For purposes of this definition, “generating facility”means all contiguous property owned, leased, or otherwise controlled by the hazardous secondarymaterial generator. A facility that collects hazardous secondary materials from other persons is not thehazardous secondary material generator.

Hazardous Waste – A waste that is classed as hazardous either by being specifically listed in theregulations (see Tables 2 – 5 in this introduction) or by exhibiting one or more of the characteristicsof a hazardous waste.

In Light Material Service – (in reference to a container) – Used to manage a material for which bothof the following conditions apply:• The vapor pressure of one or more of the organic constituents in the material is greater than

0.3 kilopascals (kPa) at 20 C.• The total concentration of the pure organic constituents having a vapor pressure greater than

0.3 kPa at 20 C is equal to or greater than 20% by weight.

Inactive Range – A military range that is not currently being used but that is still under militarycontrol and considered by the military to be a potential range area, provided that it has not been put toa new use that is incompatible with range activities.

Individual or Single Generation Site – The contiguous site on which one or more hazardous wastesare generated. An individual generation site, such as a large manufacturing plant, may have one ormore sources of hazardous waste, but is considered a single or individual generation site if the site orproperty is contiguous (40 CFR 260.10).

Intermediate Facility – Any facility that stores hazardous secondary materials for more than 10 days,other than a hazardous secondary material generator or a reclaimer of such material.

Internal Floating Roof – A cover that rests or floats on the surface of the material (but not necessarilyin complete contact with it) inside a tank that has a fixed roof.

Laboratory – An area owned by an eligible academic entity where relatively small quantities ofchemicals and other substances are used on a non-production basis for teaching or research (ordiagnostic purposes at a teaching hospital) and are stored and used in containers that are easily



manipulated by one person. Photo laboratories, art studios, and field laboratories are consideredlaboratories. Areas such as chemical stockrooms and preparatory laboratories that provide a supportfunction to teaching or research laboratories (or diagnostic laboratories at teaching hospitals) are alsoconsidered laboratories (40 CFR 262.200).

Laboratory Clean-Out – An evaluation of the inventory of chemicals and other materials in alaboratory that are no longer needed or that have expired and the subsequent removal of thosechemicals or other unwanted materials from the laboratory. A clean-out may occur for severalreasons; it may be on a routine basis (e.g., at the end of a semester or academic year) or as a result ofa renovation, relocation, or change in laboratory supervisor/occupant (40 CFR 262.200).

Laboratory Worker – A person who handles chemicals and/or unwanted material in a laboratory andmay include, but is not limited to, faculty, staff, post-doctoral fellows, interns, researchers,technicians, supervisors/managers, and principal investigators. A person does not need to be paid orotherwise compensated for his/her work in the laboratory to be considered a laboratory worker.Undergraduate and graduate students in a supervised classroom setting are not laboratory workers (40CFR 262.200).

Lamp or Universal Waste Lamp – The bulb or tube portion of an electric lighting device. A lamp isspecifically designed to produce radiant energy, most often in the ultraviolet, visible, and infra-redregions of the electromagnetic spectrum. Examples of common universal waste electric lamps include,but are not limited to, fluorescent, high-intensity discharge, neon, mercury vapor, high-pressuresodium, and metal halide lamps.

Land-Based Unit – An area where hazardous secondary materials are placed in or on the land beforerecycling, but does not include land-based production units.

Land Disposal – Any placement of hazardous wastes in an area for disposal purposes, except in aCAMU or staging pile. Such an area may include a landfill, surface impoundment, waste pile,injection well, land treatment facility, salt dome formation, salt bed formation, underground mine orcave, or concrete vault or bunker intended for disposal purposes (40 CFR 268.2).

Land Treatment Facility – A facility or part of a facility at which hazardous wastes are applied ontoor incorporated into the soil surface. Such facilities are disposal facilities if the wastes will remainafter their closure (40 CFR 260.10).

Landfill – A disposal facility or part of a facility where hazardous wastes are placed in or on land thatis not a land treatment facility, a surface impoundment, an injection well, a salt dome or salt bedformation, an underground mine, a cave, or a CAMU (40 CFR 260.10).

Large Quantity Handler of Universal Waste (LQHUW) – A universal waste handler that accumulates5,000 kg or more total of universal wastes at any time. This designation as an LQHUW is retainedthrough the end of the calendar year in which 5,000 kg or more total of universal wastes isaccumulated (40 CFR 273.6).

Leak Detection System – A system capable of detecting either of the following:• the failure of either the primary or secondary containment structure; or• the presence of either a release of hazardous wastes or accumulated liquids in the secondary

containment structure.



Such a system must employ operational controls (e.g., daily visual inspections for releases into thesecondary containment system of ASTs) or consist of an interstitial monitoring device designed todetect continuously and automatically the failure of the primary or secondary containment structure orthe presence of a release of hazardous wastes into the secondary containment structure (40 CFR260.10).

Low-Level Mixed Waste (LLMW) – A waste that contains both low-level radioactive waste and RCRAhazardous waste.

Low-Level Radioactive Waste (LLW) – A radioactive waste which contains source, special nuclear, orbyproduct material, and which is not classified as high-level radioactive waste, transuranic waste,spent nuclear fuel, or byproduct material as defined in section 11e.(2) of the Atomic Energy Act.

Malfunction – Any sudden, infrequent, and not reasonably preventable failure to operate in a normalor usual manner of air pollution control equipment, process equipment, or a process. Failures that arecaused in part by poor maintenance or careless operation are not malfunctions.

Manifest – The shipping document designated as EPA Form No. 8700-22 and, if necessary, EPAForm No. 8700-22A, originated and signed by the generator in accordance with the instructionsincluded in the Appendix to 40 CFR 262 (40 CFR 260.10).

Manifest Tracking Number – The alphanumeric identification number (i.e., a unique three letter suffixpreceded by nine numerical digits), which is pre-printed in Item 4 of the manifest by a registeredsource (40 CFR 260.10).

Maximum Organic Vapor Pressure – The sum of the individual organic constituent partial pressuresexerted by the materials contained in a tank, at the maximum vapor pressure-causing conditionsreasonably expected to occur in the tank. (Vapor pressure-causing conditions include temperature,agitation, pH effects of combining wastes, etc.) For the purpose of 40 CFR 265 Subpart CC,maximum organic vapor pressure is determined using the procedures specified in 40 CFR265.1084(c).

Metallic Shoe Seal – A continuous seal that is constructed of metal sheets that are held verticallyagainst the wall of the tank by springs, weighted levers, or other mechanisms and that is connected tothe floating roof by braces or other means. A flexible coated fabric (envelope) spans the annular spacebetween the metal sheet and the floating roof.

Mercury-Containing Equipment – A device or part of a device (including thermostats, but excludingbatteries and lamps) that contains elemental mercury integral to its function.

Military – The following parties, who handle military munitions:• the DOD;• the Armed Services;• the U.S. Coast Guard (USCG);• the National Guard;• the U.S. Department of Energy (DOE); or• other parties under contract or acting as an agent for the above parties.

Military Munitions – All ammunition products and components produced or used by or for the DODor the U.S. Armed Services for national defense and security, including military munitions under thecontrol of the DOD, the USCG, the DOE, and National Guard personnel. The term military munitions



includes: confined gaseous, liquid, and solid propellants, explosives, pyrotechnics, chemical and riotcontrol agents, smokes, and incendiaries used by DOD components, including bulk explosives andchemical warfare agents, chemical munitions, rockets, guided and ballistic missiles, bombs, warheads,mortar rounds, artillery ammunition, small arms ammunition, grenades, mines, torpedoes, depthcharges, cluster munitions and dispensers, demolition charges, and devices and components thereof.

Military munitions – do not include wholly inert items, IEDs, and nuclear weapons, nuclear devices,and nuclear components of nuclear devices. However, the term does include non-nuclear componentsof nuclear devices managed under DOE’s nuclear weapons program after all sanitization operationsunder the Atomic Energy Act of 1954, as amended, have been completed.

Military Range – Designated land and water areas set aside, managed, and used for either of thefollowing purposes:• to conduct research on, develop, test, and evaluate military munitions and explosives, other

ordnance, or weapon systems; or• to train military personnel in the use and handling of military munitions and explosives, other

ordnance, or weapon systems.

Ranges include firing lines and positions, maneuver areas, firing lanes, test pads, detonation pads,impact areas, and buffer zones with restricted access and exclusionary areas.

Miscellaneous Unit – A hazardous waste management unit where hazardous wastes are treated, stored,or disposed of and that is not a container, tank, surface impoundment, pile, land treatment unit,landfill, incinerator, boiler, industrial furnace, underground injection well with appropriate technicalstandards under 40 CFR 146, containment building, CAMU, or unit eligible for a research,development, and demonstration permit under 40 CFR 270.65 (40 CFR 260.10).

Mixed Waste – A waste that contains both RCRA hazardous waste and source, special nuclear, orbyproduct material subject to the Atomic Energy Act of 1954.

Movement – Hazardous waste transported to a facility in an individual vehicle (40 CFR 260.10).

Munitions Emergency – See Explosives Emergency.

Munitions Emergency Response – See Explosives Emergency Response.

Munitions Emergency Response Specialist – See Explosives Emergency Response Specialist.

Naturally Occurring and/or Accelerator-Produced Radioactive Material (NARM) – Radioactivematerials that:• are produced by an accelerator; or• are naturally occurring and are not source, special nuclear, or byproduct materials (as defined by

the AEA).

NARM is regulated by the states under state law, or by DOE (as authorized by the AEA) under DOEorders.

New Tank System or New Tank Component – A tank system or component that will be used for thestorage or treatment of hazardous wastes and for which installation commenced after July 14, 1986.However, for the purposes of 40 CFR 264.193(g)(2) and 265.193(g)(2), a tank system is considerednew if construction commenced after July 14, 1986 (see also Existing Tank System) (40 CFR 260.10).



NRC License – A license issued by the NRC, or NRC Agreement State, to users that manageradionuclides regulated by NRC, or NRC Agreement States, under authority of the Atomic EnergyAct of 1954, as amended.

Onground Tank – A device meeting the definition of tank in 40 CFR 260.10 that is situated in such away that the bottom of the tank is on the same level as the adjacent surrounding surface and that theexternal tank bottom cannot be visually inspected (40 CFR 260.10).

Onsite – The same or geographically contiguous property. This property may be divided by a publicor private right-of-way, provided that access between the separate portions is provided by crossingdirectly as opposed to going along the right-of-way. Noncontiguous properties owned by the sameperson but connected by a right-of-way that he/she controls and to which the public does not haveaccess are also considered onsite property (40 CFR 260.10).

Pile – Any noncontainerized accumulation of solid, nonflowing hazardous wastes that is used fortreatment or storage and that is not a containment building (40 CFR 260.10).

Remediation Wastes – All solid and hazardous wastes and all media (including groundwater, surfacewater, soils, and sediments) and debris that are managed for the purpose of implementing cleanup(40 CFR 260.10).

Restricted Wastes – Any category of hazardous wastes that is prohibited from land disposal either byregulation or by statute (RCRA Section 3004 and 40 CFR 268).



Safety Device – A closure device that functions exclusively to prevent physical damage or permanentdeformation to a unit or its air emission control equipment by venting gases or vapors directly to theatmosphere during unsafe conditions resulting from an unplanned, accidental, or emergency event.Safety devices include pressure relief valves, frangible discs, and fusible plugs. For the purpose of40 CFR 264 Subpart CC and 265 Subpart CC, a safety device is not used for routine venting of gasesor vapors from the vapor headspace underneath a cover (such as occurs during filling of the unit or toadjust the pressure in the vapor headspace in response to normal daily diurnal ambient temperaturefluctuations). A safety device is designed to remain in a closed position during normal operations andopen only when the internal pressure, or another relevant parameter, exceeds the device thresholdsetting applicable to the air emissions control equipment. The device threshold setting must bedetermined by the owner or operator based on manufacturer’s recommendations, applicableregulations, fire protection and prevention codes, standard engineering codes and practices, or otherrequirements for the safe handling of flammable, ignitable, explosive, reactive, or hazardous materials.

Satellite Accumulation Area – An area where up to 55 gal of hazardous wastes or 1 qt of acutelyhazardous wastes are initially collected, said area being at or near the area where the wastes aregenerated. Once these limits are reached, the wastes must be transferred to the hazardous wasteaccumulation point or sent offsite for treatment, storage, or disposal within 3 days. The 90-day clock(or 180-day clock for SQGs) at the hazardous waste accumulation point begins on the day that theapplicable quantity limit is reached (see Accumulation Point) (40 CFR 262.34(c)).

Single Generation Site – See Individual Generation Site.

Single-seal System – A floating roof having one continuous seal. This seal may be vapor-mounted orliquid-mounted, or may be a metallic shoe seal.

Small Quantity Generator (SQG) – A generator that produces hazardous wastes in quantities of morethan 100 kg/month but less than 1,000 kg/month (40 CFR 262.34(d) and 262.44).

Small Quantity Handler of Universal Waste (SQHUW) – A universal waste handler who does notaccumulate more than 5,000 kg total of universal wastes at any time (40 CFR 273.6).

Soil – Materials that are primarily geologic in origin, such as silt, loam, or clay, and that areindigenous to the natural geologic environment. Soil DOES NOT include wastes withdrawn fromactive hazardous waste management units (40 CFR 268 proposed).

Storage – The holding of hazardous wastes for a temporary period, at the end of which the hazardouswastes are treated, disposed of, or stored elsewhere (40 CFR 260.10).

Sump – Any pit or reservoir that meets the definition of tank (including those troughs and trenchesconnected to it) and serves to collect hazardous wastes for transport to hazardous waste TSD facilities.When used in relation to landfill, surface impoundment, and waste pile rules, sump means any linedpit or reservoir that serves to collect liquids drained from a leachate collection and removal system orleak detection system for subsequent removal from the system (40 CFR 260.10).

Surface Impoundment (SI) – A facility or part of a facility that is a natural topographic depression,man-made excavation, or diked area formed primarily of earthen materials (although it may be linedwith man-made materials), that is designed to hold an accumulation of liquid wastes or wastescontaining free liquids, and that is not an injection well. Examples of surface impoundments areholding, storage, settling, and aeration pits, ponds, and lagoons (40 CFR 260.10).



Tank – A stationary device designed to contain an accumulation of hazardous waste and constructedprimarily of nonearthen materials (e.g., wood, concrete, steel, plastic) that provide structural support(40 CFR 260.10).

Tank System – A hazardous waste storage or treatment tank and its associated ancillary equipment andcontainment system (40 CFR 260.10).

Thermal Treatment – The treatment of hazardous wastes in a device that uses elevated temperature asthe primary means to change the chemical, physical, or biological character or composition of thehazardous wastes (40 CFR 260.10).

Thermostat – A temperature control device that contains metallic mercury in an ampule attached to abimetal sensing element, and mercury-containing ampules that have been removed from thesetemperature control devices in compliance with 40 CFR 273. Thermostats are included within theuniversal waste mercury-containing devices category.

Trained Professional – A person who has completed the applicable RCRA training requirements of 40CFR 265.16 for large quantity generators, or is knowledgeable about normal operations andemergencies in accordance with 40 CFR 262.34(d)(5)(iii) for small quantity generators andconditionally exempt small quantity generators. A trained professional may be an employee of theeligible academic entity or may be a contractor or vendor who meets the requisite trainingrequirements (40 CFR 262.200).

Transfer Facility – Any transportation related facility including loading docks, parking areas, storageareas and other similar areas where shipments of hazardous waste or hazardous secondary materialsare held during the normal course of transportation.

Transportation – The movement of hazardous waste by air, rail, highway, or water.

Transporter – A person engaged in offsite transportation of hazardous wastes by air, rail, highway, orwater (40 CFR 260.10).

Treatability Study – A study in which a hazardous waste is subjected to a treatment process todetermine:• whether the waste is amenable to the treatment process;• what pretreatment, if any, is required;• the optimal process conditions needed to achieve the desired treatment;• the efficiency of a treatment process for a specific waste or wastes; or• the characteristics and volumes of residuals from a particular treatment process.

Treatment – Any method, technique, or process (including neutralization) designed to change thephysical, chemical, or biological character or composition of any hazardous wastes for any of thefollowing reasons (40 CFR 260.10):• to neutralize such wastes;• to recover energy or material resources from the wastes;• to render such wastes nonhazardous or less hazardous; safer to transport, store, or dispose of; or

amenable for recovery or storage; or• to reduce such wastes in volume.

Treatment Zone – A soil area of the unsaturated zone of a land treatment unit within which hazardousconstituents are degraded, transformed, or immobilized (40 CFR 260.10).



Underground Injection – The subsurface emplacement of fluids through a bored, drilled, or drivenwell, or through a dug well where the depth of the dug well is greater than the largest surfacedimension (see also Injection Well) (40 CFR 260.10).

Underground Tank or Underground Storage Tank (UST) – A device meeting the definition of tank in40 CFR 260.10 whose entire surface area is totally below the surface of and covered by the ground(40 CFR 260.10).

Unexploded Ordnance (UXO) – Military munitions that have been primed, fused, armed, or otherwiseprepared for action and that have been fired, dropped, launched, projected, or placed in such a manneras to constitute a hazard to operations, installation, personnel, or material but remain unexplodedeither by malfunction, design, or any other cause.

Unfit-for-Use Tank System – A tank system that has been determined through an integrity assessmentor other inspection to be no longer capable of storing or treating hazardous wastes without posing athreat of release of hazardous wastes to the environment (40 CFR 260.10).

Universal Waste – Any hazardous wastes that are subject to universal waste requirements, includingbatteries, lamps, pesticides, and mercury-containing equipment (40 CFR 273.6).

Unwanted Material – Any chemical, mixtures of chemicals, products of experiments or other materialfrom a laboratory that is no longer needed, wanted or usable in the laboratory and that is destined forhazardous waste determination by a trained professional. Unwanted materials include reactive acutelyhazardous unwanted materials and materials that may eventually be determined not to be solid wastepursuant to 40 CFR 261.2, or a hazardous waste pursuant to 40 CFR 261.3. If an eligible academicentity elects to use another equally effective term in lieu of “unwanted material,” as allowed by 40CFR 262.206(a)(1)(i), the equally effective term has the same meaning and is subject to the samerequirements as “unwanted material” under 40 CFR 262 Subpart K (40 CFR 262.200).

Used Oil – For the purposes of used oil regulations under 40 CFR 279, used oil is defined as any oilthat has been refined from crude oil, or any synthetic oil that has been used and, as a result of suchuse, is contaminated by physical or chemical impurities, including the following:• mixtures of used oil and hazardous waste that solely exhibits a hazardous waste characteristic

identified in 40 CFR 261 Subpart C and mixtures of used oil and hazardous waste that is listed insubpart D solely because it exhibits a characteristic of hazardous waste identified in subpart C, ifthe resulting mixture does not exhibit any characteristics of hazardous waste identified undersubpart C of 40 CFR 261;

• mixtures of used oil and a waste that is hazardous solely because it exhibits the characteristic ofignitability (e.g., ignitable-only mineral spirits), provided that the resulting mixture does not exhibitthe characteristic of ignitability under 40 CFR 261.21;

• mixtures of used oil and CESQGs hazardous waste regulated under 40 CFR 261.5;• materials containing or otherwise contaminated with used oil that are burned for energy recovery;• used oil drained or removed from materials containing or otherwise contaminated with used oil;• mixtures of used oil and fuels or other fuel products;• materials produced from used oil that are burned for energy recovery (e.g., used oil fuels); or• used oil which is intentionally introduced into a hydrocarbon recovery system (e.g., by pouring

collected used oil into the wastewater treatment system).

Used Oil Aggregation Point – Any site or facility that accepts, aggregates, and/or stores used oilcollected only from other used oil generation sites owned or operated by the owner or operator of theaggregation point, from which the generation site’s used oil is transported to the aggregation point in



shipments of no more than 55 gallons. Used oil aggregation points may also accept used oil fromhousehold do-it-yourselfers.

Used Oil Burner – A facility where used oil not meeting the specification requirements in 40 CFR279.11 is burned for energy recovery in devices identified in section 40 CFR 279.61(a) (boilers,hazardous waste incinerators, industrial furnaces).

Used Oil Collection Center – Any site or facility that is registered/ licensed/ permitted/ recognized bya state/county/municipal government to manage used oil and accepts, aggregates, and stores used oilcollected from used oil generators, regulated under RCRA Subpart C who bring used oil to thecollection center in shipments of no more than 55 gallons under the provisions of 40 CFR 279.24.Used oil collection centers may also accept used oil from household do-it-yourselfers.

Used Oil Fuel Marketer – Any person who does either of the following:• directs a shipment of off-specification used oil from that person’s facility to a used oil burner; or• first claims that used oil that is to be burned for energy recovery meets the used oil fuel

specifications set forth in 40 CFR 279.11.

Used Oil Generator – Any person, by site, whose act or process produces used oil or whose act firstcauses used oil to become subject to regulation.

Used Oil Processor/Rerefiner – A facility that processes used oil.

Used Oil Transfer Facility – Any transportation-related facility including loading docks, parkingareas, storage areas, and other areas where shipments of used oil are held for more than 24 hours andnot longer than 35 days during the normal course of transportation. Transfer facilities that store usedoil for more than 35 days are subject to regulation under RCRA Subpart F.

Used Oil Transporter – This includes any person who transports used oil, any person who collectsused oil from more than one generator and transports the collected oil, and owners and operators ofused oil transfer facilities. Used oil transporters may consolidate or aggregate loads of used oil forpurposes of transportation but, with the following exception, may not process used oil. Transportersmay conduct incidental processing operations that occur in the normal course of used oiltransportation (e.g., settling and water separation) as long as these incidental processing operations arenot designed to produce (or make more amenable from production of) used oil-derived products orused oil fuel.

Volatile Organic (VO) Concentration – The fraction by weight of the volatile organic compoundscontained in a hazardous waste expressed in terms of parts per million (ppmw) as determined bydirect measurement or by knowledge of the waste in accordance with the requirements of 40 CFR265.1084. For the purpose of determining the VO concentration of a hazardous waste, organiccompounds with a Henry's law constant value of at least 0.1 mole-fraction-in-the-gas-phase per mole-fraction-in the liquid-phase (0.1 Y/X) at 25 C must be included. (A Henry’s law constant with a valueof 0.1 Y/X can also be expressed as 1.8 x 10-6 atmospheres/gram-mole/m3.)

Wastewater Treatment Unit – A device for which all of the following are true:• The device is part of a wastewater treatment facility that is subject to regulation under either CWA

Section 402 or 307(b).• The device meets the definition of tank or tank system in 40 CFR 260.10.


Reference Tables


• The device receives and treats or stores an influent wastewater that is a hazardous waste as definedin 40 CFR 261.3; generates and accumulates a wastewater treatment sludge that is a hazardouswaste as defined in 40 CFR 261.3; or treats or stores a wastewater treatment sludge that is ahazardous waste as defined in 40 CFR 261.3.

Working Container – A small container (i.e., two gallons or less) that is in use at a laboratory bench,hood, or other work station, to collect unwanted material from a laboratory experiment or procedure(40 CFR 262.200).

Zone of Engineering Control – An area under the control of a facility owner/operator that, upondetection of a hazardous waste release, can be readily cleaned up prior to the release of hazardouswastes or hazardous constituents to groundwater or surface water (40 CFR 260.10).

Table 1: Maximum concentration of contaminants for the “toxicity”characteristic, as determined by the TCLP (“D” list)

HW No. Contaminant CAS No. Regulatory Level (mg/L)

Arsenic 7440-38-2 5.0D004

D005 Barium 7440-39-3 100.0

D0018 Benzene 71-43-2 0.5

D006 Cadmium 7440-43-9 1.0

D019 Carbon tetrachloride 56-23-5 0.5

D020 Chlordane 57-74-9 0.03

D021 Chlorobenzene 108-90-7 100.0

D022 Chloroform 67-66-3 6.0

D007 Chromium 7440-47-3 5.0

D023 o-Cresol 95-48-7 200.0**

D024 m-Cresol 108-39-4 200.0**

D025 p-Cresol 106-44-5 200.0**

D026 Cresol ------------ 200.0**

D016 2,4-D 94-75-7 10.0

D027 1,4-Dichlorobenzene 106-46-7 7.5

D028 1,2-Dichloroethane 107-06-2 0.5

D029 1,1-Dichloroethylene 75-35-4 0.7

D030 2,4-Dinitrotoluene 121-14-2 0.13*

D012 Endrin 72-20-8 0.02

D031 Heptachlor (and its epoxide) 76-44-8 0.008

D032 Hexachlorobenzene 118-74-1 0.13*

D033 Hexachlorobutadiene 87-68-3 0.5

D034 Hexachloroethane 67-72-1 3.0

D008 Lead 7439-92-1 5.0

D013 Lindane 58-89-9 0.4

D009 Mercury 7439-97-6 0.2

D014 Methoxychlor 72-43-5 10.0

D035 Methyl ethyl ketone 78-93-3 200.0

D036 Nitrobenzene 98-95-3 2.0



Table 1: Maximum concentration of contaminants for the “toxicity”characteristic, as determined by the TCLP (“D” list)

HW No. Contaminant CAS No. Regulatory Level (mg/L)

D037 Pentachlorophenol 87-86-5 100.0

D038 Pyridine 110-86-1 5.0*

D010 Selenium 7782-49-2 1.0

D011 Silver 7740-22-4 5.0

D039 Tetrachloroethylene 127-18-4 0.7

D015 Toxaphene 8001-35-2 0.5

D040 Trichloroethylene 79-01-6 0.5

D041 2,4,5-Trichlorophenol 95-95-4 400.0

D042 2,4,6-Trichlorophenol 88-06-2 2.0

D017 2,4,5-TP (Silvex) 93-72-1 1.0

D043 Vinyl Chloride 74-01-4 0.2

* Quantitation limit is greater than the calculated regulatory level. The quantitation limit therefore becomes the regulatory level.

** If o-, m-, and p-Cresol concentrations cannot be differentiated, the total cresol (D026) concentration is used. The regulatory levelof total cresol is 200 milligrams per liter (mg/L).

Table 2: Hazardous waste generated by generic processes (“F” list)EPA HazardHazardous wasteWaste No. Code

The following spent halogenated solvents used in degreasing: tetrachloroethylene, (T)F001trichloroethylene, methylene chloride, 1,1,1-trichloroethane, carbon tetrachloride, andchlorinated fluorocarbons; all spent solvent mixtures/blends used in degreasing thatcontain, before use, a total of 10% or more (by volume) of 1 or more of the abovehalogenated solvents or those solvents listed in F002, F004, and F005; and still bottomsfrom the recovery of these spent solvents and spent solvent mixtures.

F002 The following spent halogenated solvents: tetrachloroethylene, methylene chloride, (T)trichloroethylene, 1,1,1-trichloroethane, chlorobenzene, 1,1,2-trichloro-1,2,2trifluoroethane, ortho-dichlorobenzene, trichlorofluoromethane, and 1,1,2- trichloro-ethane; all spent solvent mixtures/blends containing, before use, a total of 10% or more(by volume) of 1 or more of the above halogenated solvents or those listed in F001,F004, and F005; and still bottoms from the recovery of these spent solvents and spentsolvent mixtures.

F003 The following spent non-halogenated* solvents: xylene, acetone, ethyl acetate, ethyl (I)benzene, ethyl ether, methyl isobutyl ketone, n-butyl alcohol, cyclohexanone, andmethanol; all spent solvent mixtures/blends containing, before use, only the above spentnon-halogenated solvents; and all spent solvent mixtures/blends containing, before use, 1or more of the above non-halogenated solvents, and a total of 10% or more (by volume)of 1 or more of those solvents listed in F001, F002, F004, and F005; and still bottomsfrom the recovery of these spent solvents and spent solvent mixtures.

F004 The following spent non-halogenated solvents: cresols, cresylic acid, and nitrobenzene; (T)all spent solvent mixtures/blends containing, before use, a total of 10% or more (byvolume) of 1 or more of the above non-halogenated solvents or those solvents listed inF001, F002, and F005; and still bottoms from the recovery of those spent solvents andspent solvent mixtures.

F005 The following spent non-halogenated solvents: toluene, methyl ethyl ketone, carbon (I,T)*disulfide, isobutanol, pyridine, benzene, 2-ethoxyethanol, and 2-nitropropane; all spentsolvent mixtures/blends containing, before use, a total of 10% more (by volume) of 1 ormore of the above non-halogenated solvents or those solvents listed in F001, F002, andF004; and still bottoms from the recovery of these spent solvents and spent solventmixtures.




F006 Wastewater treatment sludges from electroplating operations except from the following (T)processes: 1) sulfuric acid anodizing of aluminum; 2) tin plating on carbon steel; 3) zincplating (segregated basis) on carbon steel; 4) aluminum or zinc-aluminum plating oncarbon steel; 5) cleaning/stripping associated with tin, zinc and aluminum plating oncarbon steel; and 6) chemical etching and milling of aluminum.

F007 Spent cyanide plating bath solutions from electroplating operations. (R,T)

F008 Plating bath residues from the bottom of plating baths from electroplating operations (R,T)where cyanides are used in the process.

F009 Spent stripping and cleaning bath solutions from electroplating operations where (R,T)cyanides are used in the process.

F010 Quenching bath residues from oil baths from metal heat treating operations where (R,T)cyanides are used in the process.

F011 Spent cyanide solutions from salt bath pot cleaning from metal heat treating operations. (R,T)

F012 Quenching waste water treatment sludges from metal heat treating operations where (T)cyanides are used in the process.

F019 Wastewater treatment sludges from the chemical conversion coating of aluminum except (T)from zirconium phosphating in aluminum can washing when such phosphating is anexclusive conversion coating process. Wastewater treatment sludges from themanufacturing of motor vehicles using a zinc phosphating process will not be subject tothis listing at the point of generation if the wastes are not placed outside on the landprior to shipment to a landfill for disposal and are either: disposed in a Subtitle Dmunicipal or industrial landfill unit that is equipped with a single clay liner and ispermitted, licensed or otherwise authorized by the state; or disposed in a landfill unitsubject to, or otherwise meeting, the landfill requirements in 40 CFR 258.40, 264.301 or265.301. For the purposes of this listing, motor vehicle manufacturing is defined inparagraph (b)(4)(i) of this section and (b)(4)(ii) of this section describes therecordkeeping requirements for motor vehicle manufacturing facilities (see 40 CFR261.31(b)(4)).

F020 Wastes (except wastewater and spent carbon from hydrogen chloride purification) from (H)the production or manufacturing use (as a reactant, chemical intermediate, or componentin a formulating process) of tri- or tetrachlorophenol, or of intermediates used toproduce their pesticide derivatives. (This listing does not include wastes from theproduction of Hexachlorophene from highly purified 2,4,5-trichlorophenol.)

F021 Wastes (except wastewater and spent carbon from hydrogen chloride purification) from (H)the production or manufacturing use (as a reactant, chemical intermediate, or componentin a formulating process) of pentachlorophenol, or of intermediates used to produce itsderivatives.

F022 Wastes (except wastewater and spent carbon from hydrogen chloride purification) from (H)the manufacturing use (as a reactant, chemical intermediate, or component in aformulating process) of tetra-, penta-, or hexachlorobenzenes under alkaline conditions.

F023 Wastes (except wastewater and spent carbon from hydrogen chloride purification) from (H)the production of materials on equipment previously used for the production ormanufacturing use (as a reactant, chemical intermediate, or component in a formulatingprocess) of tri- and tetrachlorophenols. (This listing does not include wastes fromequipment used only for the production or use of Hexachlorophene from highly purified2,4,5-trichlorophenol.)

F024 Process wastes, including but not limited to, distillation residues, heavy ends, tars, and (T)reactor clean-out wastes, from the production of certain chlorinated aliphatichydrocarbons by free radical catalyzed processes. These chlorinated aliphatichydrocarbons are those having carbon chain lengths ranging from 1 to and including 5,with varying amounts and positions of chlorine substitution. (This listing does notinclude wastewaters, wastewater treatment sludges, spent catalysts, and wastes listed in40 CFR 261.31 or 261.32).




F025 Condensed light ends, spent filters and filter aids, and spent desiccant wastes from the (T)production of certain chlorinated aliphatic hydrocarbons, by free radical catalyzedprocesses. These chlorinated aliphatic hydrocarbons are those having carbon chainlengths ranging from 1 to and including 5, with varying amounts and positions ofchlorine substitution.

F026 Wastes (except wastewater and spent carbon from hydrogen chloride purification) from (H)the production of materials on equipment previously used for the manufacturing use (asa reactant, chemical intermediate, or component in a formulating process) of tetra-,penta-, or hexachlorobenzene under alkaline conditions.

F027 Discarded unused formulations containing tri-, tetra-, or pentachlorophenol discarded (H)unused formulations containing compounds derived from these chlorophenols. (Thislisting does not include formulations containing Hexachlorophene synthesized fromprepurified 2,4,5-trichlorophenol as the sole component.)

F028 Residues resulting from the incineration or thermal treatment of soil contaminated with (T)EPA hazardous waste numbers F020, F021, F022, F023, F026, and F027.

F032 Wastewaters (except those that have not come into contact with process contaminants), (T)process residuals, preservative drippage, and spent formulations from wood preservingprocesses generated at plants that currently use or have previously used chlorophenolicformulations (except potentially cross-contaminated wastes that have had the F032 wastecode deleted in accordance with 40 CFR 261.35 or potentially cross-contaminatedwastes that are otherwise currently regulated as hazardous wastes (i.e., F034 or F035),and where the generator does not resume or initiate use of chlorophenolic formulations).This listing does not include K001 bottom sediment sludge from the treatment ofwastewater from wood preserving processes that use creosote and/or pentachlorophenol.

F034 Wastewaters (except those that have not come into contact with process contaminants), (T)process residuals, preservative drippage, and spent formulations from wood preservingprocesses generated at plants that use creosote formulations. This listing does notinclude K001 bottom sediment sludge from the treatment of wastewater from woodpreserving processes that use creosote and/or pentachlorophenol.

F035 Wastewaters (except those that have not come into contact with process contaminants), (T)process residuals, preservative drippage, and spent formulations from wood preservingprocesses generated at plants that use inorganic preservatives containing arsenic orchromium. This listing does not include K001 bottom sediment sludge from thetreatment of wastewater from wood preserving processes that use creosote and/orpentachlorophenol.

F037 Petroleum refinery primary oil/water/solids separation sludge –Any sludge generated (T)from the gravitational separation of oil/water/solids during the storage or treatment ofprocess wastewaters and oily cooling wastewaters from petroleum refineries. Suchsludges include, but are not limited to, those generated in oil/water/solids separators;tanks and impoundments; ditches and other conveyances; sumps; and storm water unitsreceiving dry weather flow. Sludge generated in storm water units that do not receivedry weather flow, sludges generated from non-contact once-through cooling waterssegregated for treatment from other process or oily cooling waters, sludges generated inaggressive biological treatment units as defined in 40 CFR 261.31(b)(2) (includingsludges generated in 1 or more additional units after wastewaters have been treated inaggressive biological treatment units) and K051 wastes are not included in this listing.This listing does include residuals generated from processing or recycling oil-bearinghazardous secondary materials excluded under 40 CFR 261.4(a)(12)(i), if those residualsare to be disposed of.




F038 Petroleum refinery secondary (emulsified) oil/water/solids separation sludge – Any (T)sludge and/or float generated from the physical and/or chemical separation ofoil/water/solids in process wastewaters and oily cooling wastewaters from petroleumrefineries. Such wastes include, but are not limited to, all sludges and floats generatedin: induced air flotation (IAF) units, tanks and impoundments, and all sludges generatedin dissolved air flotation (DAF) units. Sludges generated in storm water units that do notreceive dry weather flow, sludges generated from non-contact once-through coolingwaters segregated for treatment from other process or oily cooling waters, sludges andfloats generated in aggressive biological treatment units as defined in 40 CFR261.31(b)(2) (including sludges and floats generated in 1 or more additional units afterwastewaters have been treated in aggressive biological treatment units) and F037, K048,and K051 wastes are not included in this listing.

F039 Leachate (liquids that have percolated through land disposed wastes) resulting from the (T)disposal of more than 1 restricted waste classified as hazardous under 40 CFR 261,Subpart D (Leachate resulting from the disposal of 1 or more of the following EPAhazardous wastes and no other hazardous wastes retains its EPA hazardous wastenumber(s): F020, F021, F022, F026, F027, and/or F028).

NOTES:

* (I,T) should be used to specify mixtures that are ignitable and contain ignitable and toxic constituents.• For the purposes of the F037 and F038 listings, oil/water/solids is defined as oil and/or water and/or solids.• For the purposes of the F037 and F038 listings, aggressive biological treatment units are defined as units that employ 1

of the following 4 treatment methods: activated sludge; trickling filter; rotating biological contactor for the continuousaccelerated biological oxidation of wastewaters; or high-rate aeration. High-rate aeration is a system of surfaceimpoundments or tanks in which intense mechanical aeration is used to completely mix the wastes and enhancebiological activity. High-rate aeration units employ a minimum of 6 horsepower per million gallons of treatmentvolume, and either the hydraulic retention time of the unit is no longer than 5 days, or the hydraulic retention time isno longer than 30 days and the unit does not generate a sludge that is a hazardous waste by the toxicity characteristic.Generators and TSD facilities have the burden of proving that their sludges are exempt from listing as F037 and F038wastes under this definition. Generators and TSD facilities must maintain, in their operating or other onsite records,documents and data sufficient to prove that the unit is an aggressive biological treatment unit and the sludges sought tobe exempted were actually generated in the aggressive biological treatment unit.

• For the purposes of the F037 listing, sludges are considered to be generated at the moment of deposition in the unit,where deposition is defined as at least a temporary cessation of lateral particle movement.

• For the purposes of the F038 listing, sludges are considered to be generated at the moment of deposition in the unit,where deposition is defined as at least a temporary cessation of lateral particle movement and floats are considered tobe generated at the moment they are formed in the top of the unit.



Table 3: Hazardous waste from specific sources (“K” list)Wood Preservation

K001(T) Bottom sediment sludge from the treatment of wastewaters from wood-preserving processes that use creosoteand/or pentachlorophenol.

Inorganic Pigments

K002(T) Wastewater treatment sludge from the production of chrome yellow and orange pigments.

K003(T) Wastewater treatment sludge from the production of molybdate orange pigments.

K004(T) Wastewater treatment sludge from the production of zinc yellow pigments.

K005(T) Wastewater treatment sludge from the production of chrome green pigments.

K006(T) Wastewater treatment sludge from the production of chrome oxide green pigments (anhydrous and hydrated).

K007(T) Wastewater treatment sludge from the production of iron blue pigments.

K008(T) Oven residues from the production of chrome oxide green pigments.

Organic chemicals

K009(T) Distillation bottoms from the production of acetaldehyde from ethylene.

K010(T) Distillation side cuts from the production of acetaldehyde from ethylene.

K011(R,T) Bottom stream from the wastewater stripper in the production of acrylonitrile.

K013(R,T) Bottom stream from the acrylonitrile column in the production of acrylonitrile.

K014(T) Bottoms from the acetonitrile purification column in the production of acrylonitrile.

K015(T) Still bottoms from the distillation of benzyl chloride.

K016(T) Heavy ends or distillation residues from the production of carbon tetrachloride.

K017(T) Heavy ends (still bottoms) from the purification column in the production of epichlorohydrin.

K018(T) Heavy ends from the fractionation column in ethyl chloride production.

K019(T) Heavy ends from the distillation of ethylene dichloride production.

K020(T) Heavy ends from the distillation of vinyl chloride in vinyl chloride monomer production.

K021(T) Aqueous spent antimony catalyst waste from flouromethanes production

K022(T) Distillation bottom tars from the production of phenol/acetone from cumene.

K023(T) Distillation light ends from the production of phthalic anhydride from naphthalene.

K024(T) Distillation bottoms from the production of phthalic anhydride from naphthalene.

K025(T) Distillation bottoms from the production of nitrobenzene by the nitration of benzene.

K026(T) Stripping still tails from the production of methyl ethyl pyridines.

K027(R,T) Centrifuge and distillation residues from toluene diisocyanate production.

K028(T) Spent catalyst from the hydrochlorinator reactor in the production of 1,1,1-trichloroethane.

K029(T) Waste from the product steam stripper in the production of 1,1,1-trichloroethane.

K030(T) Column bottoms or heavy ends from the combined production of trichloroethylene and perchloroethylene.

K083(T) Distillation bottoms from aniline production.

K085(T) Distillation or fractionation column bottoms from the production of chlorobenzenes.

K093(T) Distillation light ends from the production of phthalic anhydride from ortho-xylene.

K094(T) Distillation bottoms from the production of phthalic anhydride from ortho-xylene.

K095(T) Distillation bottoms from the production of 1,1,1-trichloroethane.

K096(T) Heavy ends from the heavy ends column from the production of 1,1,1-trichloroethane.

K103(T) Process residues from aniline extraction from the production of aniline.

K104(T) Combined wastewater streams from generated from nitrobenzene/aniline production.

K105(T) Separated aqueous stream from the reactor product washing step in the production of chlorobenzenes.

K107(C,T) Column bottoms from product separation from the production of 1,1-dimethylhydrazine (UDMH) fromcarboxylic acid hydrazides.



Table 3: Hazardous waste from specific sources (“K” list)

K108(I,T) Condensed column overheads from product separation and condensed reactor vent gases for the productionof UDMH from carboxylic acid hydrazides.

K109(T) Spent filter cartridges from the product purification from the production of UDMH from carboxylic acidhydrazides.

K110(T) Condensed column overheads from intermediate separation from the production of UDMH from carboxylicacid hydrazides.

K111(C,T) Product washwaters from the production of dinitrotoluene via nitration of toluene.

K112(T) Reaction by-product water from the drying column in the production of toluenediamine via hydrogenation ofdinitrotoluene.

K113(T) Condensed liquid light ends from the purification of toluenediamine via hydrogenation of dinitrotoluene.

K114(T) Vicinals from the purification of toluenediamine in the production of toluenediamine via hydrogenation ofdinitrotoluene.

K115(T) Heavy ends from the purification of toluenediamine in the production of toluenediamine via hydrogenation ofdinitrotoluene.

K116(T) Organic condensate from the solvent recovery in the production of toluene diisocyanate via phosgenation oftoluenediamine.

K117(T) Wastewater from reactor vent gas scrubber in the production of ethylene dibromide via bromination ofethylene.

K118(T) Spent adsorbent solids from the purification of ethylene dibromide in the production of ethylene dibromidevia bromination of ethylene.

K136(T) Still bottoms from the purification of ethylene dibromide in the production of ethylene dibromide viabromination of ethylene.

K149(T) Distillation bottoms from the production of alpha- (or methyl-) chlorinated toluenes, ring-chlorinatedtoluenes, benzyl chlorides, and compounds with mixtures of these functional groups. (This waste does not include stillbottoms from the distillation of benzyl chloride.)

K150(T) Organic residuals, excluding spent carbon adsorbent, from the spent chlorine gas and hydrochloric acidrecovery processes associated with the production of alpha- (or methyl-) chlorinated toluenes, ring-chlorinated toluenes,benzyl chlorides, and compounds with mixtures of these functional groups.

K151(T) Wastewater treatment sludges, excluding neutralization and biological sludges, generated during the treatmentof wastewaters from the production of alpha- (or methyl-) chlorinated toluenes, ring-chlorinated toluenes, benzylchlorides, and compounds with mixtures of these functional groups.

K156(T) Organic waste (including heavy ends, still bottoms, light ends, spent solvents, filtrates, and decantates) fromthe production of carbamates and carbamoyl oximes. (This listing does not apply to wastes generated from themanufacture of 3-iodo-2- propynyl n- butylcarbamate.)

K157(T) Wastewaters (including scrubber waters, condenser waters, washwaters, and separation waters) from theproduction of carbamates and carbamoyl oximes. (This listing does not apply to wastes generated from the manufactureof 3-iodo-2- propynyl n- butylcarbamate.).

K158(T) Bag house dusts and filter/separation solids from the production of carbamates and carbamoyl oximes. (Thislisting does not apply to wastes generated from the manufacture of 3-iodo-2- propynyl n- butylcarbamate.).

K159(T) Organics from the treatment of thiocarbamate wastes.

K161(R,T) Purification solids (including filtration, evaporation, and centrifugation solids), bag house dust and floorsweepings from the production of dithiocarbamate acids and their salts. (This listing does not include K125 or K126.)




K174(T) Wastewater treatment sludges from the production of ethylene dichloride or vinyl chloride monomer(including sludges that result from commingled ethylene dichloride or vinyl chloride monomer wastewater and otherwastewater), unless the sludges meet the following conditions: (i) they are disposed of in a subtitle C or non-hazardouslandfill licensed or permitted by the state or federal government; (ii) they are not otherwise placed on the land prior tofinal disposal; and (iii) the generator maintains documentation demonstrating that the waste was either disposed of in anon-site landfill or consigned to a transporter or disposal facility that provided a written commitment to dispose of thewaste in an off site landfill. Respondents in any action brought to enforce the requirements of subtitle C must, upon ashowing by the government that the respondent managed wastewater treatment sludges from the production of vinylchloride monomer or ethylene dichloride, demonstrate that they meet the terms of the exclusion set forth above. In doingso, they must provide appropriate documentation (e.g., contracts between the generator and the landfill owner/operator,invoices documenting delivery of waste to landfill, etc.) that the terms of the exclusion were met.

K175(T) Wastewater treatment sludges from the production of vinyl chloride monomer using mercuric chloridecatalyst in an acetylene-based process.

K181(T) Nonwastewaters from the production of dyes and/or pigments (including nonwastewaters commingled at thepoint of generation with nonwastewaters from other processes) that, at the point of generation, contain mass loadings ofany of the constituents identified in 40 CFR 261.32(c) of that are equal to or greater than the corresponding 40 CFR261.32(c) levels, as determined on a calendar year basis. These wastes will not be hazardous if the nonwastewaters are:(i) disposed in a Subtitle D landfill unit subject to the design criteria in 40 CFR 258.40, (ii) disposed in a Subtitle Clandfill unit subject to either 40 CFR 264.301 or40 CFR 265.301, (iii) disposed in other Subtitle D landfill units that meet the design criteria in 40 CFR 258.40, 40 CFR264.301, or 40 CFR 265.301, or (iv) treated in a combustion unit that is permitted under Subtitle C, or an onsitecombustion unit that is permitted under the Clean Air Act. For the purposes of this listing, dyes and/or pigmentsproduction is defined in 40 CFR 261.32(b)(1). The process for demonstrating that a facility’s nonwastewaters are notK181 is described in 40 CFR 261.32(d). This listing does not apply to wastes that are otherwise identified as hazardousunder 40 CFR 261.21-261.24 and 261.31-261.33 at the point of generation. Also, the listing does not apply to wastesgenerated before any annual mass loading limit is met.

Inorganic Chemicals

K071(T) Brine purification muds from the mercury cell process in chlorine production, where separately prepurifiedbrine is not used.

K073(T) Chlorinated hydrocarbon waste from the purification step of the diaphragm cell process using graphite anodesin chlorine production.

K106(T) Wastewater treatment sludge from the mercury cell process in chlorine production.

K176(E) Baghouse filters from the production of antimony oxide, including filters from the production ofintermediates (e.g., antimony metal or crude antimony oxide).

K177(T) Slag from the production of antimony oxide that is speculatively accumulated or disposed, including slagfrom the production of intermediates (e.g., antimony metal or crude antimony oxide).

K178(T) Residues from manufacturing and manufacturing-site storage of ferric chloride from acids formed during theproduction of titanium dioxide using the chloride-ilmenite process.

Pesticides

K031(T) By-product salts generated in the production of Methanearsonic Acid (MSMA) in the production ofchlordane.

K032(T) Wastewater treatment sludge from the production of chlordane.

K033(T) Wastewater and scrub water from the chlorination of cyclopentadiene in the production of chlordane.

K034(T) Filter solids from the filtration of hexachlorocyclapentadiene in the production of chlordane.

K035(T) Wastewater treatment sludges generated in the production of creosote.

K036(T) Still bottoms from toluene reclamation distillation in the production of disulfoton.

K037(T) Wastewater treatment sludges from the production of disulfoton

K038(T) Wastewater from the washing and stripping of phorate production.

K039(T) Filter cake from the filtration of diethylphosphorodithioic acid in the production of phorate.

K040(T) Wastewater treatment sludge from the production of phorate.

K041(T) Wastewater treatment sludge from the production of toxaphene.




K042(T) Heavy ends of distillation residues from the distillation of tetrachlorobenzene in the production of 2,4,5-T.

K043(T) 2,6-Dichlorophenol waste from the production of 2,4-D.

K097(T) Vacuum stripper discharge from the chlordane chlorinator in the production of chlordane.

K098(T) Untreated process wastewater from the production of toxaphene.

K099(T) Untreated wastewater from the production of 2,4-D.

K123(T) Process wastewater (including supermates, filtrates, and washwaters) from the production ofethylebisdithiocarbamic acid and it salt.

K124(C,T) Reactor vent scrubber water from the production of ethylebisdithiocarbamic acid and it salts.

K125(T) Filtration, evaporation, and centrifugation solids from the production of ethylebisdithiocarbamic acid and itsalts.

K126(T) Baghouse dust and floor sweepings in milling and packaging operations from the production or formulationof ethylebisdithiocarbamic acid and it salts.

K131(C,T) Wastewater from the reactor and spent sulfuric acid from the acid dryer from the production of methylbromide.

K132(T) Spent absorbent and wastewater separator solids from the production of methyl bromide.

Explosives

K044(R) Wastewater treatment sludges from the manufacturing and processing of explosives.

K045(R) Spent carbon from the treatment of wastewater containing explosives.

K046(T) Wastewater treatment sludges from the manufacturing, formulation, and loading of lead-based initiatingcompounds.

K047(R) Pink/red water from trinitrotoluene (TNT) operations.

Petroleum Refining

K048(T) DAF float from the petroleum industry.

K049(T) Slop oil emulsion solids from the petroleum refining industry.

K050(T) Heat exchanger bundle cleaning sludge from the petroleum refining industry.

K051(T) American Petroleum Institute (API) separator sludge from the petroleum refining industry.

K052(T) Tank bottoms (leaded) from the petroleum refining industry.

K169(T) Crude oil storage tank sediment from petroleum refining operations.

K170(T) Clarified slurry oil tank sediment and/or in-line filter/separation solids from petroleum refining operations.

K171(I,T) Spent hydrotreating catalyst from petroleum refining operations, including guard beds used to desulfurizefeeds to other catalytic reactors (this listing does not include inert support media).

K172(I,T) Spent hydrorefining catalyst from petroleum refining operations, including guard beds used to desulfurizefeeds to other catalytic reactors (this listing does not include inert support media).

Iron and Steel

K061(T) Emission control dust/sludge from the primary production of steel in electric furnaces.

K062(C,T) Spent pickle liquor generated by steel finishing operations from facilities within the iron and steel industry(Standard Industrial Classification (SIC) codes 331 and 332).

Primary Aluminum

K088(T) Spent potliners from primary aluminum reduction.

Secondary Lead

K069(T) Emission control dust/sludge from secondary lead smelting. (This listing is stayed administratively for sludgegenerated from secondary acid scrubber systems. The stay will remain in effect until further administrative action istaken. If EPA takes further action affecting this stay, EPA will publish a notice of the action in the Federal Register.)

K100(T) Waste leaching solution from acid leaching of emission control dust sludge from secondary lead smelting.

Veterinary Pharmaceuticals

K084(T) Wastewater treatment sludges generated during the production of veterinary pharmaceuticals from arsenic ororgano-arsenic compounds.




K101(T) Distillation tar residues from the distillation of aniline-based compounds in the production of veterinarypharmaceuticals from arsenic or organo-arsenic compounds.

K102(T) Residue from the use of activated carbon for decolorization in the production of veterinary pharmaceuticalsfrom arsenic or organo-arsenic compounds.

Ink Formulation

K086(T) Solvent washes and sludges, caustic washes and sludges, or water washes and sludges from cleaning tubs andequipment used in the formulation of ink from pigments, driers, soaps, and stabilizers containing chromium and lead.

Coking

K060(T) Ammonia still lime sludge from coking operations.

K087(T) Decanter tank tar sludge from coking operations.

K141(T) Process residues from the recovery of coal tar, including, but not limited to, collecting sump residues fromthe production of coke from coal or the recovery of coke byproducts produced from coal. This listing does not includeK087 (decanter tank tar sludges from coking operations).

K142(T) Tar storage tank residues from the production of coke from coal or from the recovery of coke by-productsproduced from coal.

K143(T) Process residues from the recovery of light oil, including, but not limited to, those generated in stills,decanters, and wash oil recovery units from the recovery of coke by-products produced from coal.

K144(T) Wastewater sump residues from light oil refining, including but not limited to, intercepting or contaminationsump sludges from the recovery of coke by-products produced from coal.

K145(T) Residues from napthalene collection and recovery operations from the recovery of coke by-products producedfrom coal.

K147(T) Tar storage tank residues from coal tar refining.

K148(T) Residues from coal tar distillation, including but not limited to, still bottoms.

Table 4: Hazardous waste “P” listHW No. CAS No. Substance

107-20-0 Acetaldehyde, chloroP023

P002 591-08-2 Acetamide, N-(aminothioxomethyl)-

P057 640-19-7 Acetamide, 2-fluoro

P058 62-74-8 Acetic acid, fluoro, sodium salt

P002 591-08-2 1-Acetyl-2-thiourea

P003 107-02-8 Acrolein

P070 116-06-2 Aldicarb

P203 1646-88-4 Aldicarb sulfone

P004 309-00-2 Aldrin

P005 107-18-6 Allyl alcohol

P006 20859-73-8 Aluminum phosphide (R,T)

P007 2763-96-4 5-(Aminomethyl)-3-isoxazolol

P008 504-24-5 4-Aminopyridine

P009 131-74-8 Ammonium picrate (R)

P119 7803-55-6 Ammonium vanadate

P099 506-61-6 Argentate(1-), bis(cyano-C)-potassium

P010 7778-39-4 Arsenic Acid H(3)AsO(4)

P012 1327-53-3 Arsenic oxide As(2)O(3)

P011 1303-28-2 Arsenic oxide As(2)O(5)

P011 1303-28-2 Arsenic pentoxide




P012 1327-53-3 Arsenic trioxide

P038 692-42-2 Arsine, diethyl-

P036 696-28-6 Arsonous dichloride, phenyl-

P054 151-56-4 Aziridine

P067 75-55-8 Aziridine, 2-methyl-

P013 542-62-1 Barium cyanide

P024 106-47-8 Benzenamine, 4-chloro-

P077 100-01-6 Benzenamine, 4-nitro-

P028 100-44-7 Benzene, (chloromethyl)-

P042 51-43-4 1,2-Benzenediol, 4-[1-hydroxy-2-(methylamino)ethyl]-, (R)-

P046 122-09-8 Benzeneethanamine, alpha, alpha-dimethyl-

P014 108-98-5 Benzenethiol

P127 1563-66-2 7-Benzofuranol, 2,3-dihydro-2,2- dimethyl-, methylcarbamate

P188 57-64-7 Benzoic acid, 2-hydroxy-, compd. with (3aS-cis)-1,2,3,3a,8,8a-hexahydro- 1,3a,8-trimethylpyrrolo[2,3-b]indol-5- yl methylcarbamate ester (1:1)

P001 [1]81-81-2 2H-1-Benzopyran-2-one, 4-hydroxy-3-(3-oxo-1-phenylbutyl)- and salts when presentat concentrations greater than 0.3%

P028 100-44-7 Benzyl chloride

P015 7440-41-7 Beryllium Powder

P017 598-31-2 Bromoacetone

P018 357-57-3 Brucine

P045 39196-18-4 2-Butanone, 3,3-dimethyl-1 -(methylthio)-, O-[(methylamino) carbonyl] oxime

P021 592-01-8 Calcium cyanide

P189 55285-14-8 Carbamic acid, [(dibutylamino)- thio]methyl-, 2,3-dihydro-2,2- dimethyl- 7-benzofuranyl ester

P191 644-64-4 Carbamic acid, dimethyl-, 1-[(dimethylamino)carbonyl]- 5-methyl-1H- pyrazol- 3-yl ester

P192 119-38-0 Carbamic acid, dimethyl-, 3-methyl-1- (1-methylethyl)-1H- pyrazol-5-yl ester

P190 1129-41-5 Carbamic acid, methyl-, 3-methylphenyl ester

P127 1563-66-2 Carbofuran

P022 75-15-0 Carbon disulfide

P095 75-44-5 Carbonic dichloride

P189 55285-14-8 Carbosulfan

P023 107-20-0 Chloroacetaldehyde

P024 106-47-8 p-Chloroaniline

P026 5344-82-1 1-(o-Chlorophenyl)thiourea

P027 542-76-7 3-Chloropropionitrile

P029 544-92-3 Copper cyanide

P202 64-00-6 m-Cumenyl methylcarbamate

P030 --------- Cyanides (soluble cyanide salts), not otherwise specified

P031 460-19-5 Cyanogen

P033 506-77-4 Cyanogen chloride

P034 131-89-5 2-Cyclohexyl-4,6-dinitrophenol




P016 542-88-1 Dichloromethyl ether

P036 696-28-6 Dichlorophenylarsine

P037 60-57-1 Dieldrin

P038 692-42-2 Diethylarsine

P041 311-45-5 Diethyl-p-nitrophenyl phosphate

P040 297-97-2 O,O-Diethyl O-pyrazinyl phosphorothioate

P043 55-91-4 Diisopropylfluorophosphate (DFP)

P004 309-00-2 1,4,5,8-Dimethanonaphthalene, 1,2,3,4,10,10-hexachloro-1,4,4a,5,8,8a-hexahydro-,(1alpha,4alpha, 4abeta, 5alpha, 8alpha,8abeta)-

P060 465-73-6 1,4,5,8-Dimethanonaphthalene, 1,2,3,4,10,10-hexachloro-1,4,4a,5,8,8a-hexahydro-,(1alpha,4alpha,4abeta,5beta, 8beta,8abeta)-

P037 60-57-1 2,7:3,6-Dimethanonaphth[2,3b]oxirane,3,4,5,6,9,9-hexachloro-1a,2,2a,3,6,6a,7,7a-octahydro-,(1aalpha,2beta,2aalpha,3beta,6beta,6aalpha,7beta,7aalpha)-

P051 72-20-5 2,7,3,6-Dimethanonaphth[2,3b] oxirine,3,4,5,6,9,9-hexachloro-1a,2,2a,3,6,6a,7,7a-octahydro (1aalpha,2beta,2abeta,3alpha,6alpha,6abeta,7beta,7aalpha)-, & metabolites

P044 60-51-5 Dimethoate

P046 122-09-8 alpha, alpha-Dimethylphenethylamine

P191 644-64-4 Dimetilan

P047 [1]534-52-1 4,6-Dinitro-o-cresol, and salts

P048 51-28-5 2,4-Dinitrophenol

P020 88-85-7 Dinoseb

P085 152-16-9 Diphosphoramide, octamethyl-

P111 107-49-3 Diphosphoric acid, tetraethyl ester

P039 298-04-4 Disulfoton

P049 541-53-7 Dithiobiuret

P185 26419-73-8 1,3-Dithiolane-2-carboxaldehyde, 2,4- dimethyl-, O- [(methylamino)-carbonyl]oxime

P050 115-29-7 Endosulfan

P088 145-73-3 Endothall

P051 72-20-8 Endrin, & metabolites

P042 51-43-4 Epinephrine

P031 460-19-5 Ethanedinitrile

P194 23135-22-0 Ethanimidothioic acid, 2- (dimethylamino)-N-[[(methylamino) carbonyl]oxy]-2-oxo-,methyl ester

P066 16752-77-5 Ethanimidothioic acid, N[[(methylamino) carbonyl]oxy]-, methyl ester

P101 107-12-0 Ethyl cyanide

P054 151-56-4 Ethyleneimine

P097 52-85-7 Famphur

P056 7782-41-4 Fluorine

P057 640-19-7 Fluoroacetamide

P058 62-74-8 Fluoroacetic acid, sodium salt

P198 23422-53-9 Formetanate hydrochloride

P197 17702-57-7 Formparanate

P065 628-86-4 Fluminic acid, mercury(2+) salt (R,T)




P059 76-44-8 Heptachlor

P062 757-58-4 Hexaethyl tetraphosphate

P116 79-19-6 Hydrazinecarbothioamide

P068 80-34-4 Hydrazine, methyl-

P063 74-90-8 Hydrocyanic acid (Hydrogen cyanide)

P096 7803-51-2 Hydrogen phosphide

P060 465-73-6 Isodrin

P192 119-38-0 Isolan

P202 64-00-6 3-Isopropylphenyl N-methylcarbamate

P007 2763-96-4 3(2H)-Isoxazolone, 5-(aminomethyl)-

P196 15339-36-3 Manganese, bis(dimethylcarbamodithioato-S,S')- (Manganesedimethyldithiocarbamate)

P092 62-38-4 Mercury, (acetato-O)phenyl

P065 628-86-4 Mercury fulminate (R,T)

P082 62-75-9 Methanamine, N-methyl-N-nitroso-

P064 624-83-9 Methane, isocyanato-

P016 542-88-1 Methane, oxybis[chloro-

P112 509-14-8 Methane, tetranitro- (R)

P118 75-70-7 Methanethiol, trichloro-

P198 23422-53-9 Methanimidamide, N,N-dimethyl-N'-[3- [[(methylamino)-carbonyl]oxy]phenyl]- ,monohydrochloride

P197 17702-57-7 Methanimidamide, N,N-dimethyl-N'-[2- methyl-4-[[(methylamino)carbonyl]oxy]phenyl]-

P050 115-29-7 6,9-Methano-2,4,3-benzodioxathiepin,6,7,8,9,10,10-hexachloro-1,5,5a,6,9,9a-hexahydro-, 3-oxide

P059 76-44-8 4,7-Methano-1H-indene, 1,4,5,6,7,8,8-heptachloro-3a,4,7,7a-tetrahydro

P199 2032-65-7 Methiocarb

P066 16752-77-5 Methomyl

P068 60-34-4 Methyl hydrazine

P064 624-83-9 Methyl isocyanate

P069 75-86-5 2-Methyllactonitrile

P071 298-00-0 Methyl parathion

P190 1129-41-5 Metolcarb

P128 315-8-4 Mexacarbate

P072 86-88-4 alpha-Naphthylthiourea

P073 13463-39-3 Nickel carbonyl

P074 557-19-7 Nickel cyanide

P075 [1]54-11-5 Nicotine and salts

P076 10102-43-9 Nitric oxide

P077 100-01-6 p-Nitroaniline

P078 10102-44-0 Nitrogen dioxide

P076 10102-43-9 Nitrogen oxide NO

P078 10102-44-0 Nitrogen oxide NO(2)




P081 55-63-0 Nitroglycerine (R)

P082 62-75-9 N-Nitrosomethylamine

P084 4549-40-0 N-Nitrosomethylvinylamine

P085 152-16-9 Octamethylpyrophosphoramide

P087 20816-12-0 Osmium oxide OsO(4), (T-4) -

P087 20816-12-0 Osmium tetroxide

P088 145-73-3 7-Oxabicyclo[2.2.1]heptane-2,3-dicarboxylic acid

P194 23135-22-0 Oxamyl

P089 56-38-2 Parathion

P034 131-89-5 Phenol, 2-cyclohexyl-4,6-dinitro-

P048 51-28-5 Phenol, 2,4-dinitro-

P047 (1) 534-52-1 Phenol, 2-methyl-4,6-dinitro- and salts

P020 88-85-7 Phenol, 2-(1-methylpropyl)-4,6-dinitro-

P009 131-74-8 Phenol, 2,4,6-trinitro-, ammonium salt (R)

P128 315-18-4 Phenol, 4-(dimethylamino)-3,5-dimethyl- , methylcarbamate (ester)

P199 2032-65-7 Phenol, (3,5-dimethyl-4-(methylthio)-, methylcarbamate

P202 64-00-6 Phenol, 3-(1-methylethyl)-, methyl carbamate

P201 2631-37-0 Phenol, 3-methyl-5-(1-methylethyl)-, methyl carbamate

P092 62-38-4 Phenylmercury acetate

P093 103-85-5 Phenylthiourea

P094 298-02-2 Phorate

P095 75-44-5 Phosgene

P096 7803-51-2 Phosphine

P041 311-45-5 Phosphoric acid, diethyl 4-nitrophenyl ester

P039 298-04-4 Phosphorodithioic acid, O,O-diethyl S-[2-(ethylthio)ethyl]ester

P094 296-04-2 Phosphorodithioic acid, O,O-diethyl S-[(ethylthio)methyl] ester

P044 60-51-5 Phosphorodithioic acid, O,O-dimethyl S-[2-(methylamino)-2-oxoethyl] ester

P043 55-91-4 Phosphorofluoridic acid, bis-(1-methylethyl) ester

P089 56-38-2 Phosphorothioic acid, O,O-diethyl O-(4-nitrophenyl) ester

P040 297-92-2 Phosphorodithioic acid, O,O-diethyl O-pyrazinyl ester

P097 52-85-7 Phosphorodithioic acid, O-O,4 [(diimethylamino)sulfonyl])phenyl]O,O-dimethylester

P071 296-00-0 Phosphorodithioic acid, O,O-dimethyl O-(4-nitrophenyl)ester

P204 57-47-6 Physostigmine

P188 57-64-7 Physostigmine salicylate

P110 78-00-2 Plumbane, tetraethyl-

P098 151-50-8 Potassium cyanide

P099 506-61-6 Potassium silver cyanide

P201 2631-37-0 Promecarb

P070 116-06-3 Propanal, 2-methyl-2-(methylthio)-,O-[(methylamino)carbonyl] oxime

P203 1646-88-4 Propanal, 2-methyl-2-(methyl-sulfonyl)- , O-[(methylamino)carbonyl] oxime

P101 107-12-0 Propanenitrile

P027 542-76-7 Propanenitrile,3-chloro-




P069 75-86-5 Propanenitrile, 2-hydroxy-2-methyl-

P081 55-63-0 1,2,3-Propanetriol, trinitrate (R)

P017 598-31-2 2-Propanone, 1-bromo-

P102 107-19-7 Propargyl alcohol

P003 107-02-8 2-Propenal

P005 107-18-6 2-Propen-1-ol

P067 75-55-8 1,2-Propylenimine

P102 107-19-7 2-Propyn-1-ol

P008 504-24-5 4-Pyridinamine

P075 [1]54-11-5 Pyridine, 3-(1-methyl-2-pyrrolidinyl)-, (S)-, and salts

P204 57-47-6 Pyrrolo[2,3-b]indol-5-ol, 1,2,3,3a,8,8a-hexahydro-1,3a,8- trimethyl-,methylcarbamate (ester), (3aS-cis)-

P114 12039-52-0 Selenious acid, dithallium(1+) salt

P103 630-10-4 Selenourea

P104 506-64-9 Silver cyanide

P105 26628-22-8 Sodium azide

P106 143-33-9 Sodium cyanide

P108 [1]57-24-9 Strychnidin-10-one (Strychnine), and salts

P018 357-57-3 Strychnidin-10-one, 2,3-dimethoxy-

P115 7446-18-6 Sulfuric acid, dithallium(1+) salt

P109 3689-24-5 Tetraethyldithiopyrophosphate

P110 78-00-2 Tetraethyl lead

P111 107-49-3 Tetraethyl pyrophosphate

P112 509-14-8 Tetranitromethane (R)

P062 757-58-4 Tetraphosphoric acid, hexaethyl ester

P113 1314-32-5 Thallic oxide

P114 12039-52-0 Thallium(I) selenite

P115 7446-18-6 Thallium(I) sulfate

P109 3689-24-5 Thiodiphosphoric acid, tetraethyl ester

P045 39196-18-4 Thiofanox

P049 541-53-7 Thiomidodicarbonic diamide [(H(2)N)C(S)](2)NH

P014 108-98-5 Thiophenol

P116 79-19-6 Thiosemicarbazide

P026 5344-82-1 Thiourea, (2-chlorophenyl)-

P072 86-88-4 Thiourea, 1-naphthalenyl-

P093 103-85-5 Thiourea, phenyl-

P185 26419-73-8 Tirpate

P123 8001-35-2 Toxaphene

P118 75-70-7 Trichloromethanethiol

P119 7803-55-6 Vanadic acid, ammonium salt

P120 1314-62-1 Vanadium oxide V(2)O(5)

P120 1314-62-1 Vanadium pentoxide

P084 4549-40-0 Vinylamine, N-methyl-N-nitroso




P001 [1]81-81-2 Warfarin, & salts, when present at concentrations greater than 0.3%

P205 137-30-4 Zinc, bis(dimethylcarbamodithioato- S,S')-, (Ziram)

P121 557-21-1 Zinc cyanide

P122 1314-84-7 Zinc phosphide Zn(3)P(2), when present at concentrations greater than 10% (R,T)

P205 137-30-4 Ziram

NOTES:

Key: T = toxicity; R = reactivity; I = ignitability; C = corrosivity. Absence of a letter indicates that the compound is only listed fortoxicity.

The commercial chemical products, manufacturing chemical intermediates, or off-specification commercial chemical products referred toabove are identified as toxic wastes (T), unless otherwise designated, and are subject to the SQG exclusion defined in 40 CFR 261.5(a)and (g).

To see a version of this table with all wastes listed in numerical order by waste code, see 40 CFR 261.33(e).

[1] CAS No. given for parent compound only.

Table 5: Hazardous waste “U” listHazardous CAS No. SubstanceWaste #

30558-43-1 A2213U394

U001 75-07-0 Acetaldehyde (I)

U034 75-87-6 Acetaldehyde,trichloro-

U187 62-44-2 Acetamide,N-(4-ethoxyphenyl)-

U005 53-96-3 Acetamide,N-9H-fluoren-2-yl-

U240 (1)94-75-7 Acetic acid,(2-4-dichlorophenoxy)-salts & esters

U112 141-78-6 Acetic acid,ethylester (I)

U144 301-04-2 Acetic acid,lead(2+)salt

U214 563-68-8 Acetic acid,thallium(1+) salt See 93-76-5 Acetic acid, (2,4,5-trichlorophenoxy)-F027

see F027 93-76-5 Acetic acid, (2,4,5-trichlorophenoxy)-

U002 67-64-1 Acetone (I)

U003 75-05-8 Acetonitrile (I,T)

U004 98-86-2 Acetophenone

U005 53-96-3 2-Acetylaminofluorene

U006 75-36-5 Acetylchloride (C,R,T)

U007 79-06-1 Acrylamide

U008 79-10-7 Acrylic acid (I)

U009 107-13-1 Acrylonitrile

U011 61-82-5 Amitrole

U012 62-53-3 Aniline (I,T)

U136 75-60-5 Arsinic acid,dimethyl

U014 492-80-8 Auramine

U015 115-02-6 Azaserine

U010 50-07-7 Azirino[2',3':3,4]pyrrolo[1,2-a]indole-4,7-dione,6-amino-8-[[(aminocarbonyl)oxy]methyl]-1,1a,2,8,8a,8b-hexahydro-8a-methoxy-5-methyl-,[1aS-(1aalpha,8beta,8aalpha,8balpha)]-

U280 101-27-9 Barban




U278 22781-23-3 Bendiocarb

U364 22961-82-6 Bendiocarb phenol

U271 17804-35-2 Benomyl

U157 50-49-5 Benz[j]aceanthrylene,1,2-dihydro-3-methyl-

U016 225-51-4 Benz(c)acridine

U017 98-87-3 Benzalchloride

U192 23950-58-5 Benzamide,3,5-dichloro-N-(1,1-diethyl-2-propynyl)-

U018 56-55-3 Benz[a]anthracene

U094 57-97-6 Benz[a]anthracene,7,12-dimethyl-

U012 62-53-3 Benzenamine (1,T)

U014 492-80-8 Benzenamine,4,4-carbonimidoylbis (N,N-dimethyl-

U049 3165-93-3 Benzenamine,4-chloro-2-methyl-hydrochloride

U093 60-11-7 Benzenamine,N,N-dimethyl-4-(phenylazo)-

U328 95-53-4 Benzenamine,2-methyl-

U353 106-49-0 Benzenamine,4-methyl-

U158 101-14-4 Benzenamine,4,4'-methylenebis[2-chloro-

U222 636-21-5 Benzenamine,2-methyl-,hydrochloride

U181 99-55-8 Benzenamine,2-methyl-5-nitro

U019 71-43-2 Benzene (I,T)

U038 510-15-6 Benzeneacetic acid,4-chloro-alpha-(4-chlorophenyl)-alpha-hydroxy-ethylester

U030 101-55-3 Benzene,1-bromo-4-phenoxy-

U035 305-03-3 Benzenebutanoic acid,4-[bis(2-chloroethyl)amino]-

U037 108-90-7 Benzene,chloro

U221 25376-45-8 Benzenediamine,ar-methyl-

U028 117-81-7 1,2-Benzenedicarboxylic acid,bis(2-ethylhexyl)ester

U069 84-74-2 1,2-Benzenedicarboxylic acid,dibutylester

U088 84-66-2 1,2-Benzenedicarboxylic acid,diethylester

U102 131-11-3 1,2-Benzenedicarboxylic acid,dimethylester

U107 117-84-0 1,2-Benzenedicarboxylic acid,dioctyl

U070 95-50-1 Benzene,1,2-dichloro-



U060 72-54-8 Benzene,1,1'-(2,2-dichloroethylidene)bis[4-chloro-

U017 98-87-3 Benzene,(dichloromethyl)-

U223 26471-62-5 Benzene,1,3-diisocyanatomethyl-(R,T)

U239 1330-20-7 Benzene,dimethyl-(I)

U201 108-46-3 1,3-Benzenediol

U127 118-74-1 Benzene,hexachloro-

U056 110-82-7 Benzene,hexahydro-(I)

U220 108-88-3 Benzene,methyl-

U105 121-14-2 Benzene,1-methyl-2,4-dinitro-

U106 606-20-2 Benzene,2-methyl-1,3-dinitro-




U055 98-82-8 Benzene,(1-methylethyl)-(I)

U169 98-95-3 Benzene, nitro-

U183 608-93-5 Benzene, pentachloro-

U185 82-68-8 Benzene, pentachloronitro-

U020 98-09-9 Benzene sulfonic acid chloride (C,R)

U020 98-09-9 Benzene sulfonyl chloride (C,R)

U207 95-94-3 Benzene,1,2,4,5-tetrachloro-

U061 50-29-3 Benzene,1,1'-(2,2,2-trichloroethylidene)bis[4-chloro-

U247 72-43-5 Benzene,1,1'-(2,2,2-trichloroethylidene)bis[4-methoxy-

U023 98-07-7 Benzene,(trichloromethyl)-

U234 99-35-4 Benzene,1,3,5-trinitro-

U021 92-87-5 Benzidine

U278 22781-23-3 1,3-Benzodioxol-4-ol, 2,2-dimethyl-, methyl carbamate

U364 22961-82-6 1,3-Benzodioxol-4-ol, 2,2-dimethyl-,

U203 94-59-7 1,3-Benzodioxole,5-(2-propenyl)-

U141 120-58-1 1,3-Benzodioxole,5-(1-propenyl)-

U367 1563-38-8 7-Benzofuranol, 2,3-dihydro-2,2- dimethyl-

U090 94-58-6 1,3-Benzodioxole,5-propyl-

U064 189-55-9 Benzo[rst]pentaphene

U248 (1)81-81-2 2H-1-Benzopyran-2-one,4-hydroxy-3-(3-oxo-1-phenyl-butyl)-, & salts, when presentat concentrations of 0.3% or less

U022 50-32-8 Benzo[a]pyrene

U197 106-51-4 p-Benzoquinone

U023 96-07-7 Benzotrichloride(C,R,T)

U085 1464-53-5 2,2'-Bioxirane

U021 92-87-5 [1,1'-Biphenyl]-4,4'-diamine

U073 91-94-1 [1,1'-Biphenyl]-4,4'-diamine, 3,3'-dichloro-

U091 119-90-4 [1,1'-Biphenyl]-4,4'-diamine, 3,3'-dimethoxy-

U095 119-93-7 [1,1'-Biphenyl]-4,4'-diamine, 3,3'-dimethyl-

U225 75-25-2 Bromoform

U030 101-55-3 4-Bromophenyl phenyl ether

U128 87-68-3 1,3-Butadiene,1,1,2,3,4,4-hexachloro-

U172 924-16-3 1-Butanamine,N-butyl-N-nitroso-

U031 71-36-3 1-Butanol (I)

U159 78-93-3 2-Butanone (I,T)

U160 1338-23-4 2-Butanone peroxide (R,T)

U053 4170-30-3 2-Butenal

U074 764-41-0 2-Butene,1,4-dichloro-(I,T)

U143 303-34-4 2-Butenoic acid,2-methyl-,7-[[2,3-dihydroxy-2-(1-methoxyethyl)-3-methyl-1-oxobutoxy]methyl]-2,3,5,7a-tetrahydro-1H-pyrrolizin-1-ylester,[1S-[1alpha(Z),7(2S*,3R*),7aalpha]]-

U031 71-36-3 n-Butylalcohol (I)




U136 75-60-5 Cacodylic acid

U032 13765-19-0 Calcium chromate

U372 10605-21-7 Carbamic acid, 1H-benzimidazol-2-yl, methyl ester

U271 17804-35-2 Carbamic acid, [1- [(butylamino)carbonyl]-1H- benzimidazol-2-yl]-, methyl ester

U280 101-27-9 Carbamic acid, (3-chlorophenyl)-, 4- chloro-2-butynyl ester

U238 51-79-6 Carbamic acid,ethylester

U178 615-53-2 Carbamic acid,methylnitroso-,ethylester

U373 122-42-9 Carbamic acid, phenyl-, 1-methylethyl ester

U409 23564-05-8 Carbamic acid,[1,2-phenylenebis(iminocarbonothioyl)]bis-, dimethyl ester

U097 79-44-7 Carbamic chloride,dimethyl

U389 2303-17-5 Carbamothioic acid, bis(1-methylethyl)- , S-(2,3,3-trichloro-2-propenyl) ester

U387 52888-80-9 Carbamothioic acid, dipropyl-, S- (phenylmethyl) ester

U114 (1)111-54-6 Carbamodithioic acid,1,2-ethanediylbis-,saltsandesters

U062 2303-16-4 Carbamothioic acid,bis(1-methylethyl)-,S-(2,3-dichloro-2-propenyl)ester

U279 63-25-2 Carbaryl

U372 10605-21-7 Carbendazim

U367 1563-38-8 Carbofuran phenol

U215 6533-73-9 Carbonic acid,dithallium(1+)salt

U033 353-50-4 Carbonic difluoride

U156 79-22-1 Carbonochloridic acid,methylester (I,T)

U033 353-50-4 Carbonoxyfluoride (R,T)

U211 56-23-5 Carbon tetrachloride

U034 75-87-6 Chloral

U035 305-03-3 Chlorambucil

U036 57-74-9 Chlordane, alpha and gamma isomers

U026 494-03-1 Chlornaphazin

U037 108-90-7 Chlorobenzene

U038 510-15-6 Chlorobenzilate

U039 59-50-7 p-Chloro-m-cresol

U042 110-75-8 2-Chloroethyl vinyl ether

U044 67-66-3 Chloroform

U046 107-30-2 Chloromethyl methyl ether

U047 91-58-7 beta-Chloronaphthalene

U048 95-57-8 o-Chlorophenol

U049 3165-93-3 4-Chloro-o-toluidine, hydrochloride

U032 13765-19-0 Chromic acid,H(2)CrO(4)calcium salt

U050 218-01-9 Chrysene

U393 137-29-1 Copper dimethyldithiocarbamate

U051 – Creosote

U052 1319-77-3 Cresol(Cresylicacid)

U053 4170-30-3 Crotonaldehyde

U055 98-82-8 Cumene(I)




U246 506-68-3 Cyanogenbromide (CN)Br

U197 106-51-4 2,5-Cyclohexadiene-1,4-dione

U056 110-82-7 Cyclohexane (I)

U129 58-89-9 Cyclohexane,1,2,3,4,5,6-hexachloro-,(1alpha,2alpha,3beta,4alpha,5alpha, 6beta)-

U057 108-94-1 Cyclohexanone(I)

U130 77-47-4 1,3-Cyclopentadiene,1,2,3,4,5,5-hexa-chloro-

U058 50-18-0 Cyclophosphamide

U240 (1) 94-75-7 2,4-D,salts and esters

U059 20830-81-3 Daunomycin

U060 72-54-8 DDD

U061 50-29-3 DDT

U062 2303-16-4 Diallate

U063 53-70-3 Dibenz[a,h]anthracene

U064 189-55-9 Dibenzo[a,i]pyrene

U066 96-12-8 1,2-Dibromo-3-chloropropane

U069 84-74-2 Dibutylphthalate

U070 95-50-1 o-Dichlorobenzene

U071 541-73-1 m-Dichlorobenzene

U072 106-46-7 p-Dichlorobenzene

U073 91-94-1 3,3'-Dichlorobenzidine

U074 764-41-0 1,4-Dichloro-2-butene (I,T)

U075 75-71-8 Dichlorodifluoromethane

U078 75-35-4 1,1-Dichloroethylene

U079 156-60-5 1,2-Dichloroethylene

U025 111-44-4 Dichloroethyl ether

U027 108-60-1 Dichloroisopropyl ether

U024 111-91-1 Dichloromethoxyethane

U081 120-83-2 2,4-Dichlorophenol

U082 87-65-0 2,6-Dichlorophenol

U084 542-75-6 1,3-Dichloropropene

U085 1464-53-5 1,2:3,4-Diepoxybutane (I,T)

U108 123-91-1 1,4-Diethyleneoxide

U028 117-81-7 Diethylhexylphthalate

U395 5952-26-1 Diethylene glycol, dicarbamate

U086 1615-80-1 N,N'-Diethylhydrazine

U087 3288-58-2 O,O-DiethylS-methyldithiophosphate

U088 84-66-2 Diethylphthalate

U089 56-53-1 Diethylstilbestrol

U090 94-58-6 Dihydrosafrole

U091 119-90-4 3,3'-Dimethoxybenzidine

U092 124-40-3 Dimethylamine (I)

U093 60-11-7 p-Dimethylaminoazo benzene




U094 57-97-6 7,12-Dimethylbenz[a]anthracene

U095 119-93-7 3,3'-Dimethylbenzidine

U096 80-15-9 alpha,alpha-Dimethylbenzylhydroperoxide (R)

U097 79-44-7 Dimethylcarbamoylchloride

U098 57-14-7 1,1-Dimethylhydrazine

U099 540-73-8 1,2-Dimethylhydrazine

U101 105-67-9 2,4-Dimethy lphenol

U102 131-11-3 Dimethyl phthalate

U103 77-78-1 Dimethyl sulfate

U105 121-14-2 2,4-Dinitrotoluene

U106 606-20-2 2,6-Dinitrotoluene

U107 117-84-0 Di-n-octylphthalate

U108 123-91-1 1,4-Dioxane

U109 122-66-7 1,2-Diphenylhydrazine

U110 142-84-7 Dipropylamine (I)

U111 621-64-7 Di-n-propylnitrosamine

U041 106-89-8 Epichlorohydrin

U001 75-07-0 Ethanal (I)

U404 121-44-8 Ethanamine, N,N-diethyl-

U174 55-18-5 Ethanamine,N-ethyl-N-nitroso-

U155 91-80-5 1,2-Ethanediamine,N,N-dimethyl-N'-2-pyridinyl-N'-(2thienylmethyl)-

U067 106-93-4 Ethane,1,2-dibromo-

U076 75-34-3 Ethane,1,1-dichloro-

U077 107-06-2 Ethane,1,2-dichloro-

U131 67-72-1 Ethane,hexachloro

U024 111-91-1 Ethane,1,1'-[methylenebis-(oxy)]bis[2-chloro-

U117 60-29-7 Ethane,1,1'-oxybis-(I)

U025 111-44-4 Ethane,1,1'-oxybis[2-chloro-

U184 76-01-7 Ethane,pentachloro-

U208 630-20-6 Ethane,1,1,1,2-tetrachloro-

U209 79-34-5 Ethane,1,1,2,2-tetrachloro-

U218 62-55-5 Ethanethioamide

U226 71-55-6 Ethane,1,1,1-trichloro-

U227 79-00-5 Ethane,1,1,2-trichloro-

U410 59669-26-0 Ethanimidothioic acid, N,N'- [thiobis[(methylimino)carbonyloxy]]bi s-, dimethylester

U394 30558-43-1 Ethanimidothioic acid, 2- (dimethylamino)-N-hydroxy-2-oxo-, methyl ester

U359 110-80-5 Ethanol,2-ethoxy-

U173 1116-54-7 Ethanol,2,2'-(nitrosoimino)bis-

U395 5952-26-1 Ethanol, 2,2'-oxybis-, dicarbamate

U004 98-86-2 Ethanone,1-phenyl-

U043 75-01-4 Ethene,chloro-




U042 110-75-8 Ethene,(2-chloroethoxy)-

U078 75-35-4 Ethene,1,1-dichloro-

U079 156-60-5 Ethene,1,2-dichloro-, (E)-

U210 127-18-4 Ethene,tetrachloro-

U228 79-01-6 Ethene,trichloro-

U112 141-78-6 Ethylacetate (I)

U113 140-88-5 Ethylacrylate (I)

U238 51-79-6 Ethylcarbamate (urethane)

U117 60-29-7 Ethylether (I)

U114 (1)111-54-6 Ethylenebisdithiocarbamic acid, salts & esters

U067 106-93-4 Ethylene dibromide

U077 107-06-2 Ethylene dichloride

U359 110-80-5 Ethylene glycol monoethyl ether

U115 75-21-8 Ethylene oxide (I,T)

U116 96-45-7 Ethylene thiourea

U076 75-34-3 Ethylidene dichloride

U118 97-63-2 Ethylmethacrylate

U119 62-50-0 Ethylmethane sulfonate

U120 206-44-0 Fluoranthene

U122 50-00-0 Formaldehyde

U123 64-18-6 Formic acid (C,T)

U124 110-00-9 Furan (I)

U125 98-01-1 2-Furancarboxaldehyde (I)

U147 108-31-6 2,5-Furandione

U213 109-99-9 Furan,tetrahydro- (I)

U125 98-01-1 Furfural (I)

U124 110-00-9 Furfuran (I)

U206 18883-66-4 Glucopyranose,2-deoxy-2-(3-methyl-3-nitrosoureido)-D

U206 18883-66-4 D-Glucose,2-deoxy-2-[[(methylnitrosoamino)carbonyl]amino]-

U126 765-34-4 Glycidylaldehyde

U163 70-25-7 Guanidine,N-methyl-N-nitro-N-nitroso-

U127 118-74-1 Hexachlorobenzene

U128 87-68-3 Hexachlorobutadiene

U130 77-47-4 Hexachlorocyclopentadiene

U131 67-72-1 Hexachloroethane

U132 70-30-4 Hexachlorophene

U243 1888-71-7 Hexachloropropene

U133 302-01-2 Hydrazine (R,T)

U086 1615-80-1 Hydrazine,1,2-diethyl-

U098 57-14-7 Hydrazine,1,1-dimethyl-

U099 540-73-8 Hydrazine,1,2-dimethyl-

U109 122-66-7 Hydrazine,1,2-diphenyl-




U134 7664-39-3 Hydrofluoric acid (C,T)

U134 7664-39-3 Hydrogen fluoride (C,T)

U135 7783-06-4 Hydrogen sulfide

U096 80-15-9 Hydroperoxide,1-methyl-1-phenylethyl-(R)

U116 96-45-7 2-Imidazolidinethione

U137 193-39-5 Indeno[1,2,3-cd]pyrene

U190 85-44-9 1,3-Isobenzofurandione

U140 78-83-1 Isobutyl alcohol (I,T)

U141 120-58-1 Isosafrole

U142 143-50-0 Kepone

U143 303-34-4 Lasiocarpine

U144 301-04-2 Lead acetate

U146 1335-32-6 Lead,bis(acetato-O)tetrahydroxytri

U145 7446-27-7 Lead phosphate

U146 1335-32-6 Lead subacetate

U129 58-89-9 Lindane

U163 70-25-7 MNNG

U147 108-31-6 Maleicanhydride

U148 123-33-1 Maleichydrazide

U149 109-77-3 Malononitrile

U150 148-82-3 Melphalan

U151 7439-97-6 Mercury

U152 126-98-7 Methacrylonitrile (I,T)

U092 124-40-3 Methanamine,N-methyl-(I)

U029 74-83-9 Methane,bromo-

U045 74-87-3 Methane,chloro-(I,T)

U046 107-30-2 Methane,chloromethoxy-

U068 74-95-3 Methane,dibromo-

U080 75-09-2 Methane,dichloro-

U075 75-71-8 Methane,dichlorodifluoro-

U138 74-88-4 Methane,iodo-

U119 62-50-0 Methane sulfonic acid, ethyl ester

U211 56-23-5 Methane,tetrachloro-

U153 74-93-1 Methanethiol (I,T)

U225 75-25-2 Methane,tribromo-

U044 67-66-3 Methane,trichloro-

U121 75-69-4 Methane,trichlorofluoro-

U036 57-74-9 4,7-Methano-1H-indene,1,2,4,5,6,7,8,8-octachloro-2,3,3a,4,7,7a hexahydro-

U154 67-56-1 Methanol (I)

U155 91-80-5 Methapyrilene

U142 143-50-0 1,3,4-Metheno-2H-cyclobuta[cd]pentalen-2-one,1,1a,3,3a,4,5,5a,5b,6-decachloroctahydro-




U247 72-43-5 Methoxychlor

U154 67-56-1 Methyl alcohol (I)

U029 74-83-9 Methyl bromide

U186 504-60-9 1-Methyl butadiene (I)

U045 74-87-3 Methyl chloride (I,T)

U156 79-22-1 Methylchlorocarbonate (I,T)

U226 71-55-6 Methylchloroform

U157 56-49-5 3-Methyl cholanthrene

U158 101-14-4 4,4-Methylene bis(2-chloroaniline)

U068 74-95-3 Methylene bromide

U080 75-09-2 Methylene chloride

U159 78-93-3 Methyl ethyl ketone (MEK) (I,T)

U160 1338-23-4 Methyl ethyl ketone peroxide (R,T)

U138 74-88-4 Methyliodide

U161 108-10-1 Methyl isobutyl ketone (I)

U162 80-62-6 Methyl methacrylate (I,T)

U161 108-10-1 4-Methyl-2-pentanone (I)

U164 56-04-2 Methyl thiouracil

U010 50-07-7 MitomycinC

U059 20830-81-3 5,12-Naphthacenedione,8-acetyl-10-[(3-amino-2,3,6-trideoxy)-alpha-L-lyxohexopyranosyl)oxyl]-7,8,9,10-tetrahydro-6,8,11-trihydroxy-1-methoxy-,(8S-cis)-

U167 134-32-7 1-Naphthalenamine

U168 91-59-8 2-Naphthalenamine

U026 494-03-1 Naphthalenamine,N,N'-bis(2-chloroethyl)-

U165 91-20-3 Naphthalene

U047 91-58-7 Naphthalene,2-chloro-

U166 130-15-4 1,4-Naphthalenedione

U236 72-57-1 2,7-Naphthalenedisulfonicacid,3,3'-[(3,3'-dimethyl[1,1'-biphenyl]-4,4'-diyl)bis(azo)bis[5-amino-4-hydroxy]-, tetrasodium salt

U279 63-25-2 1-Naphthalenol, methylcarbamate

U166 130-15-4 1,4,Naphthoquinone

U167 134-32-7 alpha-Naphthylamine

U168 91-59-8 beta-Naphthylamine

U217 10102-45-1 Nitric acid,thallium(1+)salt

U169 98-95-3 Nitrobenzene (I,T)

U170 100-02-7 p-Nitrophenol

U171 79-46-9 2-Nitropropane (I,T)

U172 924-16-3 N-Nitrosodi-n-butylamine

U173 1116-54-7 N-Nitrosodiethanolamine

U174 55-18-5 N-Nitrosodiethylamine

U176 759-73-9 N-Nitroso-N-ethylurea

U177 684-93-5 N-Nitroso-N-methylurea




U178 615-53-2 N-Nitroso-N-methylurethane

U179 100-75-4 N-Nitrosopiperidine

U180 930-55-2 N-Nitrosopyrrolidine

U181 99-55-8 5-Nitro-o-toluidine

U193 1120-71-4 1,2-Oxathiolane,2,2-dioxide

U058 50-18-0 2H-1,3,2-Oxazaphosphorin-2-amine,N,N-bis(2-chloroethyl)tetrahydro-,2-oxide

U115 75-21-8 Oxirane (I,T)

U126 765-34-4 Oxirane carboxyaldehyde

U041 106-89-8 Oxirane,(chloromethyl)-

U182 123-63-7 Paraldehyde

U183 608-93-5 Pentachlorobenzene

U184 76-01-7 Pentachloroethane

U185 82-68-8 Pentachloronitrobenzene(PCNB) See 87-86-5 Pentachlorophenol F027

See F027 87-86-5 Pentachlorophenol

U161 108-10-1 Pentanol,4-methyl-

U186 504-60-9 1,3-Pentadiene (I)

U187 62-44-2 Phenacetin

U188 108-95-2 Phenol

U048 95-57-8 Phenol,2-chloro-

U039 59-50-7 Phenol,4-chloro-3-methyl-

U081 120-83-2 Phenol,2,4-dichloro-

U082 87-65-0 Phenol,2,6-dichloro-

U089 56-53-1 Phenol,4,4'-(1,2-diethyl-1,2-ethenediyl) bis-,(E)-

U101 105-67-9 Phenol,2,4-dimethyl-

U052 1319-77-3 Phenol, methyl-

U132 70-30-4 Phenol,2,2'-methylenebis[3,4,6-trichloro-

U411 114-26-1 Phenol, 2-(1-methylethoxy)-, methylcarbamate

U170 100-02-7 Phenol,4-nitro- See 87-86-5 Phenol,pentachloro F027. See 58-90-2 Phenol,2,3,4,6-tetrachloro F027. See 88-06-2 Phenol,2,4,6-trichloro F027

See F027 87-86-5 Phenol, pentachloro-

See F027 58-90-2 Phenol, 2,3,4,6-tetrachloro-

See F027 95-95-4 Phenol, 2,4,5-trichloro-

See F027 88-06-2 Phenol, 2,4,6-trichloro-

U150 148-82-3 L-Phenylalanine,4-[bis(2-chloroethyl)amino]-

U145 7446-27-7 Phosphoric acid, lead (2+) salt(2:3)

U087 3288-58-2 Phosphorodithioic acid,0,0-diethylS-methylester

U189 1314-80-3 Phosphorus sulfide (R)

U190 85-44-9 Phthalic anhydride

U191 109-06-8 2-Picoline

U179 100-75-4 Piperidine,1-nitroso-

U192 23950-58-5 Pronamide

U194 107-10-8 1-Propanamine (I,T)




U111 621-64-7 1-Propanamine,N-nitroso-N-propyl-

U110 142-84-7 1-Propanamine,N-propyl-(I)

U066 96-12-8 Propane,1,2-dibromo-3-chloro-

U083 78-87-5 Propane,1,2-dichloro-

U149 109-77-3 Propane dinitrile

U171 79-46-9 Propane,2-nitro-(I,T)

U027 39638-32-9 Propane,2,2'oxybis[2-chloro-

U193 1120-71-4 1,3-Propanesultone See 93-72-1 Propanoicacid,2-(2,4,5-F027 trichlorophenoxy)-

See F027 93-72-1 Propanoic acid, 2-(2,4,5- trichlorophenoxy)-

U235 126-72-7 1-Propanol,2,3-dibromo-,phosphate(3:1)

U140 78-83-1 1-Propanol,2-methyl-(I,T)

U002 67-64-1 2-Propanone (I)

U007 79-06-1 2-Propenamide

U084 542-75-6 1-Propene,1,3-dichloro-

U243 1888-71-7 1-Propene,1,1,2,3,3,3-hexachloro-

U009 107-13-1 2-Propene nitrile

U152 126-98-7 2-Propene nitrile,2-methyl-(I,T)

U008 79-10-7 2-Propenoic acid (I)

U113 140-88-5 2-Propenoic acid,ethylester (I)

U118 97-63-2 2-Propenoic acid,2-methyl-,ethylester

U162 80-66-2 2-Propenoic acid,2-methyl-,methylester (I,T)

U373 122-42-9 Propham

U411 114-26-1 Propoxur

U387 52888-80-9 Prosulfocarb

U194 107-10-8 n-Propylamine (I,T)

U083 78-87-5 Propylene dichloride

U148 123-33-1 3,6-Pyridazinedione,1,2-dihydro-

U196 110-86-1 Pyridine

U191 109-06-8 Pyridine,2-methyl-

U237 66-75-1 2,4-(1H,3H)-Pyrimidinedione,5-[bis(2-chloroethyl)amino]-

U164 56-04-2 4(1H)-Pyrimidinone, 2,3-dihydro-6-methyl-2-thioxo-

U180 930-55-2 Pyrrolidine,1-nitroso-

U200 50-55-5 Reserpine

U201 108-46-3 Resorcinol

U203 94-59-7 Safrole

U204 7783-00-8 Selenious acid

U204 7783-00-8 Selenium dioxide

U205 7488-56-4 Selenium sulfide

U015 115-02-6 L-Serine,diazoacetate (ester) See 93-72-1 Silvex(2,4,5-TP) F027

See F027 93-72-1 Silvex (2,4,5-TP)

U206 18883-66-4 Streptozotocin

U103 77-78-1 Sulfuric acid, dimethyl ester




U189 1314-80-3 Sulfurphosphide (R) See 93-76-52,4,5-T F027

See F027 93-76-5 2,4,5-T

U207 95-94-3 1,2,4,5-Tetrachlorobenzene

U208 630-20-6 1,1,1,2-Tetrachloroethane

U209 79-34-5 1,1,2,2-Tetrachloroethane

U210 127-18-4 Tetrachloroethylene (See 58-90-22,3,4,6-Tetrachlorophenol F027)

See F027 58-90-2 2,3,4,6-Tetrachlorophenol

U213 109-99-9 Tetrahydrofuran (I)

U214 563-68-8 Thallium (I) acetate

U215 6533-73-9 Thallium (I) carbonate

U216 7791-12-0 Thallium (I) chloride

U216 7791-12-0 Thallium chloride TlCl

U217 10102-45-1 Thallium (I) nitrate

U218 62-55-5 Thioacetamide

U410 59669-26-0 Thiodicarb

U153 74-93-1 Thiomethanol (I,T)

U244 137-26-8 Thioperoxydicarbonicdiamide [(H(2)N)C(S)](2)S(2)tetramethyl-

U409 23564-05-8 Thiophanate-methyl

U219 62-56-6 Thiourea

U244 137-26-8 Thiram

U220 108-88-3 Toluene

U221 25376-45-8 Toluene diamine

U223 26471-62-5 Toluene diisocyanate (R,T)

U328 95-53-4 o-Toluidine

U353 106-49-0 p-Toluidine

U222 636-21-5 o-Toluidine hydrochloride

U389 2303-17-5 Triallate

U011 61-82-5 1H-1,2,4-Triazol-3-amine

U226 71-55-6 1,1,1-Trichloroethane

U227 79-00-5 1,1,2-Trichloroethane

U228 79-01-6 Trichloroethylene

U121 75-69-4 Trichloromonofluoromethane See 95-95-42,4,5-Trichlorophenol F027 See 88-06-22,4,6-Trichlorophenol F027

See F027 95-95-4 2,4,5-Trichlorophenol

See F027 88-06-2 2,4,6-Trichlorophenol U404 121-44-8 Triethylamine

U404 121-44-8 Triethylamine

U234 99-35-4 1,3,5-Trinitrobenzene (R,T)

U182 123-63-7 1,3,5-Trioxane,2,4,6-trimethyl-

U235 126-72-7 Tris(2,3-dibromopropyl) phosphate

U236 72-57-1 Trypan blue

U237 66-75-1 Uracil mustard

U176 759-73-9 Urea,N-ethyl-N-nitroso-




U177 684-93-5 Urea,N-methyl-N-nitroso

U043 75-01-4 Vinyl chloride

U248 (1)81-81-2 Warfarin, when present at concentrations of 0.3% or less

U239 1330-20-7 Xylene (1)

U200 50-55-5 Yohimban-16-carboxylicacid,11,17-dimethoxy-18-[(3,4,5-tri-methoxybenzoyl)oxy]-,methy lester,(3 beta,16 beta,17 alpha,18 beta,20 alpha)-

U249 1314-84-7 Zinc phosphide,Zn(3)P(2), when present at concentrations of 10% or less.

NOTES:

To see a version of this table with all wastes listed in numerical order by waste code, see 40 CFR 261.33(f).

(1) CAS Number given for parent compound only.


HAZARDOUS WASTE.

Items to consider getting in advance:

Items to have facility personnel prepare or gather in advance:

.

.PART 2: PRE-AUDIT PREPARATION

• The generator’s classification category (large, small, or conditionally exempt).

• The facility’s contingency plan (showing layout and emergency response procedures).

• The Biennial Report of Hazardous Waste Activity or other listing of hazardous wastes.

• Information concerning the status of waste oil generated at the site.

• For all sites:– Manifests and land disposal forms.– Exception/discrepancy reports.– Inspection records.– Job descriptions, employee list, and training records.– Waste classification records.– The EPA ID number form.– The Biennial Report of Hazardous Waste Activity.– Spill records and reports.– Records of arrangements with police, fire department, and emergency response teams.– Tests of fire water.– The facility evacuation plan.– Tank testing records.– Documentation required for any wastes subject to a conditional exclusion from the hazardous

waste regulations.

• For eligible academic entities managing wastes under the alternative standards of 40 CFR 262Subpart K:– The Laboratory Management Plan.– Records of laboratory clean-outs.– Training records for laboratory workers.

• For hazardous waste laboratories:– Waste receiving and storage records.– Waste treatment records.


Hazardous Waste Pre-audit Preparation

• For TSD facilities:– Part A and Part B permit applications or standardized permit application.– The Part B permit or standardized permit.– The waste analysis plan.– The preparedness and prevention plan.– Treatment and disposal records.– Monitoring records.– Operating records.– Closure/post-closure plans.

• For reclamation and intermediate facilities managing excluded hazardous secondary materials thatwere generated off-site:– EPA notifications.– Records of all shipments of hazardous secondary material that were received at the facility.– Written cost estimate for closing the facility.– Proof of financial assurance.

• For used oil generators, burners, and marketers:– A waste oil analysis (to prove that waste oil is not hazardous waste).– Tolling contracts (if applicable).– Shipping and/or receiving records.– For off-specification marketers and burners, a one-time certification notice.

• For used oil processors:– Shipping and/or receiving records.– The waste analysis plan.– Operating records.– Copies of Biennial Reports of Hazardous Waste Activity submitted to EPA.

• For large quantity handlers of universal waste:– Shipping and/or receiving records.


Acronyms and Abbreviations Used in This Module

Hazardous Waste Pre-audit Preparation

AHW acute or acutely hazardous waste min minute(s)API American Petroleum Institute MJ/scm megajoule per cubic meter atAST aboveground storage tank standard conditionsASTM American Society for Testing and mm millimeter(s)

materials m/s meters per secondBIFs boilers and industrial furnaces MW megawattBtu/scf British thermal units per cubic feet at NACE National Association of Corrosion

standard conditions EngineersC Celsius NARM Naturally Occurring and/orCAA Clean Air Act Accelerator-Produced RadioactiveCAMU corrective action management unit MaterialCAS Chemical Abstracts Service NFPA National Fire Protection AssociationCERCLA Comprehensive Environmental NRC National Response Center

Response, Compensation, and NRC U.S. Nuclear Regulatory CommissionLiability Act OECD Organization for Economic

CESQG conditionally exempt small quantity Cooperation and Developmentgenerator PCB polychlorinated biphenyl

CFR Code of Federal Regulations PE professional engineercm centimeter(s) pH presence of hydrogenCWA Clean Water Act POHC principal organic hazardousDAF dissolved air flotation constituentsDDESB Department of Defense Explosives POTW publicly owned treatment works

Safety Board ppm part(s) per millionDOD U.S. Department of Defense ppmv part(s) per million by volumeDOE U.S. Department of Energy ppmw part(s) per million by weightDOT U.S. Department of Transportation QA/QC quality assurance/quality controlEOD explosive ordnance disposal qt quart(s)EP Extraction Procedure RCRA Resource Conservation and RecoveryEPA U.S. Environmental Protection Act

Agency sec second(s)F Fahrenheit SI surface impoundmentft foot/feet SIC Standard Industrial Classificationgal gallon(s) SPCC Plan Spill Prevention, Control, andGMP good management practice Countermeasure PlanHAZWOPER Hazardous Waste Operations and SQG small quantity generator

Emergency Response SQHUW Small Quantity Handler of UniversalHM Hazardous Materials Wastehr hour(s) TCLP Toxic Characteristic LeachingHSWA Hazardous and Solid Waste Procedure

Amendments of 1984 TEU technical escort unionHW hazardous waste TNT trinitrotolueneIAF induced air flotation TOC total organic carbonID identification tpy ton(s) per yearIED improvised explosive device TSCA Toxic Substances Control ActISS Interim Status Standards TSD treatment, storage, and disposalkg kilogram(s) (facility)kPa kilopascal(s) UDMH 1,1-dimethyl-hydrazineL liter(s) USC United States Codelb pound(s) USCG United States Coast GuardLDR Land Disposal Restriction USPS United States Postal ServiceLLRW Low-Level Radioactive Waste UST underground storage tankLLRWDF Low-Level Radioactive Waste UXO unexploded ordnance

Disposal Facility Vmax maximum allowable velocityLQG large quantity generator VO volatile organicLQHUW large quantity handler of universal VOC volatile organic compound

waste yr year(s)m meter(s)mg milligram(s)Mg megagram(s)


HAZARDOUS WASTE.

1. Overall

2. Conditionally Exempt Small Quantity Generators: General

.

.PART 3: RULEBOOK.

.Part A-1: Conditionally Exempt Small Quantity Generator Requirements

A facility is classified as a conditionally exempt small quantity generator (CESQG) if itgenerates in a calendar month:

• 100 kg or less of hazardous waste;• 1 kg or less of acute hazardous waste; or• 100 kg or less of any residue or contaminated soil, waste, or other debris resulting from

clean-up of a spill of an acute hazardous waste into or on any land or water.

NOTE: Accumulation limits also apply; see paragraph 2.1.

.

1.1 Determine actions taken or changes made since the previous review of hazardous wastemanagement.

Guide Note• Obtain a copy of the previous hazardous waste review or audit; determine if all noncompliance issues

previously identified have been resolved.• If the facility has been subject to compliance orders or other legal actions relating to its hazardous waste

management practices, determine the present status of the facility’s compliance with these orders.

1.2 Copies of all relevant federal, state, and local regulations and guidance documents onhazardous waste management should be maintained at the facility. (GMP)

Guide Note• Determine from interviews or observation if copies of the following hazardous waste management regulations

are maintained and kept current at the facility:

– 40 CFR 260 – 40 CFR 279;– DOT regulations at 49 CFR 172, 49 CFR 173, 49 CFR 178, and 49 CFR 179; and– state hazardous waste management regulations.

• Determine if facility environmental staff are familiar with and knowledgeable of regulatory requirements.• Determine how the facility stays up to date with changing hazardous waste regulatory requirements.

.

2.1 CESQGs are not subject to regulation under 40 CFR 262 – 40 CFR 268, or 40 CFR 270, or tonotification requirements of RCRA Section 3010, provided they meet certain requirements.(40 CFR 261.5(e) – (g), and (j))

Guide Note• Verify that the facility does not generate more than 100 kg of hazardous waste in a calendar month, and never

accumulates 1,000 kg or greater of hazardous wastes at the facility at any one time (see the next bullet pointbelow for limits applicable to acute hazardous wastes) (40 CFR 261.5(a)).

EAF 10/12 ©STP HW/Part 3A-1 - 1

Hazardous Waste Part A-1 Rulebook

• Verify that the facility does not generate in a calendar month, or accumulate on site at any time, acutehazardous wastes as listed in 40 CFR 261.31, 40 CFR 261.32, or 40 CFR 261.33(e), in quantities greater thanthe following (40 CFR 261.5(e) – (f)):

– a total of 1 kg of acute hazardous wastes; or– a total of 100 kg of any residue or contaminated soil, waste, or other debris resulting from clean-up of a

spill of an acute hazardous waste, into or on any land or water.

NOTE: Generators exceeding these quantities are fully regulated as LQGs (see Part A-3 of this rulebook).

• Ensure that, for the CESQG to be exempt from full regulation, the generator complies with all of the following(40 CFR 261.5(f) – (g)):

– the generator has made a waste determination (40 CFR 262.11; see paragraph 2.2 below) through testanalysis or knowledge that the waste is a hazardous waste; and

– the generator either treats or disposes of the hazardous wastes in an onsite facility or transfers the wastesoff site to one of the following:

1) a permitted hazardous waste TSD facility for treatment or disposal;2) a facility that is permitted, licensed, ore registered by a State to manage municipal solid waste or

non-municipal non-hazardous waste;3) a facility that beneficially uses or reuses, or legitimately recycles or reclaims its waste; or4) for universal waste managed under 40 CFR 273, a universal waste handler or destination facility.

NOTE 1: CESQG hazardous waste may be mixed with non-hazardous waste and remain subject tothese reduced requirements even though the resultant mixture exceeds the quantity limitations, unlessthe mixture meets any of the characteristics of hazardous waste.

NOTE 2: If a CESQG’s wastes are mixed with used oil, the mixture is subject to the requirements of40 CFR 279 (see Rulebook D, Used Oil Management).

NOTE 3: CESQGs are not required under federal regulations to have an EPA ID number of theirown if they meet the requirements of 40 CFR 261.5(e) – (g), and (j). Some states may require thesefacilities to obtain a state-specific hazardous waste ID number.

NOTE 4: Although not required by federal regulations, some states require CESQGs to complete amanifest for each shipment. If accumulation at a CESQG exceeds 1,000 kg of hazardous wastes, theaccumulation time clock begins and the CESQG becomes an SQG subject to manifestingrequirements.

2.2 Facilities that generate solid wastes as defined in 40 CFR 261.2, must determine if those wastesare hazardous wastes. (40 CFR 262.11)

Guide Note• Verify that the facility has a hazardous waste management program (GMP).• Determine if there is a master list of the types and quantities of hazardous wastes generated, treated, and

disposed of at the facility. Verify that the list is complete and updated regularly (GMP).• Determine from discussions with staff how wastes generated at the facility are identified and classified.• Determine if the facility follows federal or state criteria for identifying the specific listed or characteristics of

hazardous wastes, whichever is more stringent (e.g., waste oil is sometimes considered a hazardous waste bystate regulations but is exempt under most sections of RCRA).

• For each waste stream, review the classification of the waste to determine if it has been done correctly andrecord any inconsistencies.

2.3 If certain requirements are met, generators may temporarily hold samples collected forpurposes of testing to determine their characteristics or composition without having to meet therequirements of 40 CFR 262 – 40 CFR 268 or the notification requirements of RCRA Section3010. (40 CFR 261.4(d))

Guide Note• Determine if the facility is storing and handling the samples as follows:

– the samples are being held by the sample collector before transport to a laboratory for testing;– the samples are being held in a laboratory before testing;– the samples are being held in the laboratory after testing but before it is returned to the sample

collector; or

HW/Part 3A-1 - 2 EAF 10/12 ©STP


– the samples are being held temporarily in a laboratory after testing for a specific purpose where furthertesting of the samples may be necessary (see section 4 of this part of the rulebook for additionalrequirements for the manifesting and transportation of samples).

• Determine if shipments of waste samples are in compliance with DOT regulations, United States PostalService (USPS) shipping requirements, and any other applicable shipping requirements. If the sample collectordetermines that DOT, USPS, or other shipping requirements do not apply to the shipment of the sample,ensure that the following information accompanies the sample (40 CFR 261.4(d)(2)(i) and (d)(2)(ii)):

– sample collector’s name, mailing address, and telephone number;– laboratory’s name, mailing address, and telephone number;– quantity of the sample;– date of shipment; and– a description of the sample.

• Verify that samples are packaged so that the material does not leak, spill, or vaporize from the packaging(40 CFR 261.4(d)(3)).

2.4 If certain requirements and limits are met, generators may temporarily hold samples collectedfor the purpose of conducting treatability studies without having to meet the requirements of40 CFR 261 – 40 CFR 263, RCRA hazardous waste generator notification requirements, orquantity determinations for CESQGs. (40 CFR 261.4(e))

Guide Note• Determine if the facility collects and handles treatability samples as follows:

– the treatability sample is being collected and prepared for transportation by the generator or samplecollector;

– the sample is being accumulated or stored by the generator or sample collector prior to transportation to alaboratory or testing facility; or

– the sample is being transported to the laboratory or testing facility for the purpose of conductingtreatability studies.

• Review quantities of materials used in testing. Verify that the following quantities are not exceeded (40 CFR261.4(e)(2)(i)):

– 10,000 kg of media contaminated with nonacute hazardous wastes;– 1,000 kg of nonacute hazardous wastes;– 1 kg of AHW; or– 2,500 kg of media contaminated with AHW for each process being evaluated for each generated waste

stream.

• Verify that laboratories that receive the wastes for treatability testing comply with the provisions of section 3of this part of the rulebook (40 CFR 261.4(f)).

• Determine if shipments of treatability samples comply with DOT and USPS shipping requirements, or areaccompanied by the following required information (40 CFR 261.4(e)(2)(iii)):

– sample collector’s name, mailing address, and telephone number;– laboratory’s name, mailing address, and telephone number;– quantity of the sample;– date of shipment; and– a description of the sample, including its EPA hazardous waste number.

• Determine if samples are packaged so that the material does not leak, spill, or vaporize from the packaging(40 CFR 261.4(e)(2)(iii)).

• Verify that the mass of each shipment does not exceed 10,000 kg (40 CFR 261.4(e)(2)(ii)).

NOTE 1: This quantity may be all media contaminated with non-acute hazardous waste, or may include2,500 kg of media contaminated with acute hazardous waste, 1,000 kg of hazardous waste, and 1 kg of acutehazardous waste.

NOTE 2: EPA may grant requests on a case-by-case basis for quantity limits in excess of those listed above.

• Determine if the generator retains records for 3 yr, including shipping documents, contracts, waste quantitiesshipped, laboratory or testing facility that received the waste, shipment dates, and information on thedisposition of samples (40 CFR 261.4(e)(2)(iv)).



2.5 Containers that previously held hazardous wastes may be reused for other purposes ordiscarded as a solid waste, provided the regulatory definition of “empty” is met. (40 CFR261.7)

Guide Note• Inspect “empty” containers that are not marked or labeled as hazardous wastes to ensure they meet the

regulatory definitions of “empty” as follows:

– All wastes have been removed by pouring, pumping, aspirating, or by another practice commonlyemployed to empty that type of container (40 CFR 261.7(b)(1)(i)).

– For containers with a capacity of 119 gal or less, no more than 3% by weight of the total capacity or nomore than 1 inch of residue remain in the container or inner liner (40 CFR 261.7(b)(1)(ii), and(b)(1)(iii)(A)).

– For containers with a capacity greater than 119 gal, no more than 0.3% by weight of the total capacity ofthe container or no more than 1 inch of residue remain in the container or inner liner (40 CFR261.7(b)(1)(ii), and (b)(1)(iii)(B)).

– For compressed gas cylinders, the pressure in the container approaches atmospheric (40 CFR 261.7(b)(2)).– Containers or inner liners holding AHW have been triple-rinsed using a solvent capable of removing the

material, or have been cleaned by another method that achieves equivalent removal (40 CFR 261.7(b)(3)).

NOTE: Some states may have more stringent requirements regarding “empty” containers.

• Verify that containers that do not meet the definition of “empty” are managed as hazardous wastes (40 CFR261.7(a)(2)).

2.6 Certain materials destined for recycling are exempt from the definition of solid waste, and aretherefore exempt from the hazardous waste regulations. They may be accumulated prior torecycling provided that the generator can demonstrate that such materials are not beingaccumulated speculatively. (40 CFR 261.1(c)(8) and 40 CFR 261.2(c)(4))

Guide Note• Determine whether materials that are recycled meet any of the regulatory exclusions from the definition of

solid waste, as provided in 40 CFR 261.2 (40 CFR 261.2).

NOTE 1: Regulatory exclusions for materials that are recycled include secondary materials that are directlyused as an ingredient in a production process, secondary materials used as an effective substitute for acommercial product, or material that is returned to the original production process as a raw material orfeedstock, provided that these materials are not first reclaimed.

NOTE 2: This paragraph does not apply to commercial chemical products listed in 40 CFR 261.33 (see Tables4 and 5 in the Introduction). Such materials are not considered solid wastes when accumulated speculatively(40 CFR 261.2(c)(4)).

• Verify that the facility can demonstrate that the material being accumulated is potentially recyclable and has afeasible means of being recycled (40 CFR 261.1(c)(8)).

NOTE: Although the regulations do not specify how this demonstration must be made, the generator should beable to identify actual recyclers, recycling technology, and the relative costs associated with recycling.

• Review records and determine whether the facility can show that during the calendar year (commencingJanuary 1) the amount of material that is recycled, or transferred to a different site for recycling, equals at least75% by weight or volume of the amount of that material accumulated at the beginning of the period (40 CFR261.1(c)(8)).

NOTE 1: In calculating the percentage of turnover, the 75% requirement is to be applied to each material ofthe same type that is recycled in the same way.

NOTE 2: Although the regulations do not require specific records or reports, the generator should have recordsof the inventory of material at the start of the calendar year, the amount of material added during the year, andthe amount remaining at the end of the year.



2.7 The facility should ensure that transportation of hazardous wastes between buildings on the siteis accomplished in accordance with GMPs to help prevent spills, releases, and accidents.(GMP)

Guide Note• Determine if procedures exist to manage movement of hazardous wastes throughout the facility.• Determine if drivers are trained in spill control procedures.• Determine if provisions have been made for securing wastes in vehicles during transport.• Determine if the facility contingency plan covers accidents during this transport.

2.8 Used, broken cathode ray tubes (CRTs) destined for recycling are not solid wastes, and aretherefore exempt from the hazardous waste regulations, provided that certain conditions aremet. (40 CFR 261.4(a)(22) and 40 CFR 261.39)

Guide Note• Verify that used, broken CRTs are managed in accordance with the following requirements prior to processing:

– stored in either of the following (40 CFR 261.39(a)(1)):1) a building with a roof, floor, and walls, or2) a container (i.e., a package or a vehicle) that is constructed, filled, and closed to minimize releases of

CRT glass to the environment.

– containers are labeled or marked clearly with the following phrases (40 CFR 261.39(a)(2)):1) “Used cathode ray tube(s)—contains leaded glass” or “Leaded glass from televisions or computers”;

and2) “Do not mix with other glass materials.”

– transported in a container meeting the requirements of the previous two points (40 CFR 261.39(a)(3)).

• Verify that used, broken CRTs are not speculatively accumulated (see paragraph 2.6 above) (40 CFR261.39(a)(4)).

• Determine whether any used, broken CRTs are used in a manner constituting disposal. If so, the applicablerequirements of 40 CFR 266 Subpart C must be met (40 CFR 261.39(a)(4)).

• If the facility exports used, broken CRTs, verify that the following requirements are met (40 CFR261.39(a)(5)):

– EPA is notified of an intended export before the CRTs are scheduled to leave the U.S.

NOTE: A complete notification should be submitted 60 days before the initial shipment. This notificationmay cover export activities occurring over 12 months or less.

– The Acknowledgment of Consent to Export CRTs obtained from the receiving country has been receivedfrom EPA.

NOTE: If the receiving country objects to receipt of the CRTs or withdraws a prior consent, EPA willnotify the exporter in writing.

– If the conditions specified on the original notification change, a written renotification is provided to EPA(not required for changes to the exporter’s phone number or decreases in quantity).

– A copy of the Acknowledgment of Consent to Export CRTs accompanies the shipment and the shipmentconforms to all terms of the Acknowledgment.

– If a shipment cannot be delivered for any reason, EPA is renotified to allow shipment to a new recyclerand another Acknowledgment of Consent to Export CRTs is obtained.

– Copies of notifications and Acknowledgments of Consent to Export CRTs are retained for 3 years.


3. Generators: Hazardous Waste Laboratories


2.9 Processing of used, broken CRTs (including the management of glass removed from CRTs) isexempt from the hazardous waste regulations provided that certain conditions are met. (40 CFR261.39(b))

Guide Note• Verify that processing of used, broken CRTs complies with the following requirements (40 CFR 261.39(b)):

– used, broken CRTs are not speculatively accumulated (see paragraph 2.6 above);– all activities that involve intentionally breaking intact CRTs, further breaking or separating broken CRTs;

and sorting or otherwise managing glass removed from CRT monitors, is performed within a building witha roof, floor, and walls; and

– activities using temperatures high enough to volatilize lead from CRTs are not performed.

• Verify that any glass removed from CRTs that is destined for recycling at a CRT glass manufacturer or a leadsmelter after processing is not speculatively accumulated (see paragraph 2.6 above) (40 CFR 261.39(c)).

• Determine whether any glass from used CRTs is used in a manner constituting disposal. If so, the requirementsof 40 CFR 266 Subpart C must be complied with (40 CFR 261.39(d)).

2.10 Used, intact cathode ray tubes (CRTs) that are recycled are not solid wastes, and are thereforeexempt from the hazardous waste regulations, provided that certain conditions are met.(40 CFR 261.4(a)(22) and 40 CFR 261.40)

Guide Note• Verify that used, intact CRTs that are either sent for recycling within the U.S. or exported for recycling are not

speculatively accumulated by CRT collectors or glass processors (40 CFR 261.4(a)(22)).• If used, intact CRTs are exported for recycling, verify that the notice and consent conditions of 40 CFR

261.39(a)(5) (see paragraph 2.8 above) are complied with (40 CFR 261.40(a)).• If used, intact CRTs are exported for reuse, verify the following requirements are met (40 CFR 261.41):

– A one-time notification is sent to EPA that includes a statement that the notifier plans to export used,intact CRTs for reuse, the notifier’s name, address, and EPA ID number (if applicable) and the name andphone number of a contact person.

– Copies of normal business records, such as contracts, demonstrating that each shipment of exported CRTswill be reused, is retained for at least 3 years from the date of export.

2.11 Certain wastes may be exempt from the hazardous waste regulations provided that certainconditions are met. (40 CFR 261)

Guide Note• Determine whether any wastes generated by the facility are included within any exemption from the hazardous

waste regulations (40 CFR 261.1 - 261.4 and 40 CFR 261.38).• Review applicable exemptions and determine whether the facility is meeting any conditions required of that

exemption (40 CFR 261.1 - 261.4, 40 CFR 261.38).

NOTE: Such conditions may include, but are not limited to, requirements for notification,accumulation/storage, sampling and analysis, waste analysis plans, contaminant limits, and recordkeeping.

.

3.1 Laboratories and testing facilities may temporarily hold or ship hazardous waste samples fortreatability studies without meeting hazardous waste generator or transporter requirements, ifthey operate in accordance with regulations. (40 CFR 261.4(f))

Guide Note• Determine if written notification was provided to EPA or the state administering agency at least 45 days before

conducting treatability studies (40 CFR 261.4(f)(1)).• Verify that the laboratory or testing facility has an EPA ID number (40 CFR 261.4(f)(2)).• Review records to verify that no more than 10,000 kg of media contaminated with nonacute hazardous wastes,

2,500 kg of media contaminated with AHW, or 250 kg of other hazardous wastes is subject to initiation oftreatment in all treatability studies in any single day (40 CFR 261.4(f)(3)).



• Verify that the quantity of wastes held at the facility for evaluation does not exceed 10,000 kg. Within that10,000 kg, specific waste types cannot exceed the following amounts (40 CFR 261.4(f)(4)):

– for media contaminated with nonacute hazardous wastes—10,000 kg;– for media contaminated with AHW—2,500 kg;– for nonacute hazardous wastes—1,000 kg other than contaminated media; and– for AHW—1 kg.

• Determine whether samples of untreated waste are held for less than 90 days following completion of thetreatability study or less than 1 yr following shipment of the wastes to the laboratory (2 yr for bioremediationstudies), whichever occurs first (40 CFR 261.4(f)(5)).

• Determine if samples of treated materials are archived for future evaluation in quantities of 500 kg or less, forperiods of 5 yr or less from the date of initial receipt.

NOTE: Archived materials are counted against the total storage limit for the facility (40 CFR 261.4(f)(5)).

• Verify that the treatability study does not involve open burning or placement of hazardous wastes on the land(40 CFR 261.4(f)(6)).

• Verify that any residue or unused sample that is deemed to be hazardous waste is handled and disposed of assuch, unless the residues and unused samples are returned to the sample originator under the 40 CFR 261.4(c)exemption (40 CFR 261.4(f)(10)).

• Ensure that the facility notifies EPA or the state agency (if located in an authorized state), by letter, when thefacility is no longer planning to conduct any treatability studies at the site.

3.2 Laboratories and testing facilities that temporarily hold or ship hazardous waste samples fortreatability studies without meeting hazardous waste generator or transporter requirements mustcomply with recordkeeping and reporting requirements. (40 CFR 261.4(f))

Guide Note• Determine if the facility maintains records for 3 yr following completion of each study that show compliance

with treatment rate limits, storage time, and quantity limits (40 CFR 261.4(f)(7)). Verify that the followinginformation is maintained for each treatability study conducted:

– name, address and EPA ID number of the generator or sampler collector;– date of receipt of the shipment and the quantity of waste accepted;– the quantity of waste in storage each day;– date that the treatability study was initiated and the amount of waste introduced to treatment each day;– date that the study was concluded; and– date that any unused sample or residues from the study were returned to the generator or sample collector,

or if sent to a TSD facility, the name and EPA ID number of the facility.

• Determine if the facility maintains a copy of the treatability study contract and shipping papers associated withthe transport of the treatability study samples for 3 yr from the completion date of each study (40 CFR261.4(f)(8)).

• Verify that the facility submits an annual report to EPA or the state administering agency by March 15 of eachyear (40 CFR 261.4(f)(9)).

• Verify that the annual report includes the following information for the previous calendar year (40 CFR261.4(f)(9)):

– name, address, and EPA ID number of the facility conducting the treatability studies;– types (by process) of treatability studies conducted;– name and address of persons for whom studies have been conducted (including their EPA ID numbers);– total quantity of waste in storage each day;– quantity and types of waste subject to treatability studies;– when each treatability study was conducted; and– final disposition of residues and an unused sample from each treatability study.


4. Alternative Waste Determination and Accumulation Requirements for Eligible


Academic Entities.

This section covers the alternative requirements for hazardous waste determination andaccumulation of hazardous waste in 40 CFR 262 Subpart K that are available to laboratoriesowned by eligible academic entities. An “eligible academic entity” is a college or university,or a non-profit research institute that is owned by or has a formal written affiliationagreement with a college or university, or a teaching hospital that is owned by or has a formalwritten affiliation agreement with a college or university. These alternative requirements areoptional and only apply to eligible academic entities that choose to comply with thesestandards. A CESQG has the option of complying with these standards as an alternative tocomplying with the conditional exemption of 40 CFR 261.5(b).

4.1 An eligible academic entity must notify EPA in writing that it is electing to comply with thealternative requirements of 40 CFR 262 Subpart K prior to operating under these alternativerequirements. (40 CFR 262.203)

Guide Note• Verify that the facility notified EPA in writing (using EPA Form 8700-12) that it is electing to be subject to

the alternative requirements of 40 CFR 262 Subpart K for all the laboratories they own which are under thesame EPA Identification Number (40 CFR 262.203(a)).

NOTE 1: A CESQG that does not have an EPA Identification Number must notify EPA that it is electing to besubject to the alternative requirements for all the laboratories owned by the eligible academic entity that areon-site.

NOTE 2: A separate notification must be submitted for each EPA Identification Number (or site, forCESQGs).

• Verify that a copy of the notification is kept on file at the eligible academic entity for as long as itslaboratories are subject to the alternative standards (40 CFR 262.203(c)).

• If the facility is a teaching hospital that is not owned by a college or university, verify that a copy of its formalwritten affiliation agreement with a college or university is kept on file at the teaching hospital for as long asits laboratories are subject to the alternative standards (40 CFR 262.203(d)).

• If the facility is a non-profit research institute that is not owned by a college or university, verify that a copyof its formal written affiliation agreement with a college or university is kept on file at the non-profit researchinstitute for as long as its laboratories are subject to the alternative standards (40 CFR 262.203(e)).

4.2 An eligible academic entity must notify EPA if it elects to withdraw from the alternativerequirements of 40 CFR 262 Subpart K. (40 CFR 262.204)

Guide Note• If an eligible academic entity has elected to no longer meet the alternative requirements, verify that EPA was

notified in writing (using EPA Form 8700-12) (40 CFR 262.204(a)).

NOTE 1: An eligible academic entity must submit a separate notification for each EPA Identification Number(or site, for CESQGs).

NOTE 2: After withdrawing from the alternative standards a CESQG must comply with the requirements of40 CFR 261.5 (see paragraph 2.1).

• Verify that a copy of the withdrawal notice is kept on file at the eligible academic entity for 3 yr from the dateof the notification (40 CFR 262.204(c)).



4.3 An eligible academic entity must manage containers of unwanted material in accordance withspecific standards while that material is in the laboratory. (40 CFR 262.206)

Guide Note• Verify that the following information is affixed or attached to containers of unwanted material (40 CFR

262.206(a)(1)):

– the words “unwanted material” or another equally effective term that is used consistently by the eligibleacademic entity; and

– sufficient information to alert emergency responders to the contents of the container.

NOTE 1: “Unwanted material” is any chemical, mixtures of chemicals, products of experiments or othermaterial from a laboratory that is no longer needed, wanted or usable in the laboratory and that is destinedfor hazardous waste determination by a trained professional.

NOTE 2: Examples of information that would be sufficient to alert emergency responders to the contentsof the container include the name of the chemical(s), or the type or class of chemical, such as organicsolvents or halogenated organic solvents.

• Verify that the following information is either affixed or attached to the container, or at a minimum isassociated with the container (40 CFR 262.206(a)(2)):

– the date that the unwanted material first began accumulating in the container; and– information sufficient to allow a trained professional to properly identify whether an unwanted material is

a solid and hazardous waste and to assign the proper hazardous waste code(s).

NOTE: Examples of information that would allow a trained professional to properly identify whether anunwanted material is a solid or hazardous waste include the following:

1) the name and/or description of the chemical contents or composition of the unwanted material, or, ifknown, the product of the chemical reaction;

2) whether the unwanted material has been used or is unused; and3) a description of the manner in which the chemical was produced or processed, if applicable.

• Verify that containers of unwanted material are managed in accordance with the following requirements(40 CFR 262.206(b)):

– containers are maintained in good condition;– damaged containers are replaced, overpacked, or repaired;– containers are compatible with their contents to avoid reactions between the contents and the container;– containers are made of, or lined with, material that is compatible with the unwanted material so that the

container’s integrity is not impaired; and– containers are kept closed at all times, except as follows:

1) when adding, removing or bulking unwanted material;2) when using a working container (see the next bullet point); or3) when venting of a container is necessary for the proper operation of laboratory equipment (such as

with in-line collection of unwanted materials from high performance liquid chromatographs) or toprevent dangerous situations (such as build-up of extreme pressure).

• Where a working container is used, verify that the container is either closed or its contents are emptied into aseparate container that is then closed at the end of the procedure or work shift or when the container is full,whichever comes first (40 CFR 262.206(b)).

4.4 An eligible academic entity must provide training to all individuals working in a laboratory.(40 CFR 262.207)

Guide Note• Verify that training for laboratory workers and students is commensurate with their duties and so that they

understand and can implement the requirements in 40 CFR Subpart K (40 CFR 262.207(a)).

NOTE: Training for laboratory workers and students may be provided in a variety of ways, including thefollowing (40 CFR 262.207(a)):

– instruction by the professor or laboratory manager before or during an experiment;– formal classroom training;– electronic/written training;– on-the-job training; or– written or oral exams.



• Verify that a trained professional does the following (40 CFR 262.207(d)):

– accompanies the transfer of all unwanted material and hazardous waste that is removed from thelaboratory; and

– makes the hazardous waste determination for unwanted material.

NOTE: A “trained professional” is a person who is knowledgeable and familiar with all procedures forproper waste-handling and emergency response that are relevant to their responsibilities during bothnormal operations and emergencies. A trained professional may be an employee of the eligible academicentity or may be a contractor or vendor who meets the requisite training requirements.

4.5 An eligible academic entity must remove all containers of unwanted material from eachlaboratory on a regular schedule and when certain volumes are exceeded. (40 CFR 262.208)

Guide Note• Verify that containers of unwanted material are removed from each laboratory in accordance with either of the

following (40 CFR 262.208(a)):

– all containers of unwanted material are removed on a regular interval that does not exceed 6 months; or– individual containers of unwanted material are removed within 6 months of the container’s accumulation

start date.

• If a laboratory accumulates a total of more than 55 gal of unwanted material (including reactive acutelyhazardous unwanted material) before the regularly scheduled removal, verify that the following requirementsare met for all containers of unwanted material in that laboratory (40 CFR 262.208(d)(1)):

– container labels are marked with the date that 55 gal was exceeded; and– containers are removed from the laboratory within 10 calendar days of the date that 55 gal was exceeded,

or at the next regularly scheduled removal, whichever comes first.

EXCEPTION: If more than 55 gal (or 1 quart of reactive acutely hazardous unwanted material) ofunwanted materials is generated during a laboratory clean-out that is performed in accordance with40 CFR 262.213 (see paragraph 4.8), the 10 day requirement does not apply. For a laboratory clean-out,all unwanted materials must be removed from the laboratory within 30 calendar days from the start of thelaboratory clean-out.

• If a laboratory accumulates more than 1 quart of reactive acutely hazardous unwanted material before theregularly scheduled removal, verify that the following requirements are met for all containers of reactiveacutely hazardous unwanted material (40 CFR 262.208(d)(2)):

– container labels are marked with the date that 1 quart was exceeded; and– containers are removed from the laboratory within 10 calendar days of the date that 1 quart was exceeded,

or at the next regularly scheduled removal, whichever comes first.

4.6 An eligible academic entity must ensure that a trained professional makes a hazardous wastedetermination on unwanted materials. (40 CFR 262.209)

Guide Note• Verify that a trained professional makes a hazardous waste determination before the unwanted material is

removed from the laboratory (40 CFR 262.209(b)).

4.7 An eligible academic entity that makes the hazardous waste determination for unwantedmaterial in the laboratory must comply with certain requirements. (40 CFR 262.210)

Guide Note• Verify that a trained professional makes the hazardous waste determination before the unwanted material is

removed from the laboratory (40 CFR 262.210(a)).• If an unwanted material is determined to be a hazardous waste, verify that the following requirements are met

(40 CFR 262.210(b)):

– the words “hazardous waste” are written on the container label before the hazardous waste is removedfrom the laboratory;

– the appropriate hazardous waste code(s) are written on the label before the hazardous waste is transportedoff-site; and

– the hazardous waste is counted toward the eligible academic entity’s generator status in the calendarmonth that the hazardous waste determination was made.



• Verify that when hazardous waste is removed from a laboratory it is taken directly to any off-site facilities thatCESQGs may send their wastes to in accordance with 40 CFR 261.5 (see paragraph 2.1).

4.8 An eligible academic entity may conduct a laboratory clean-out once during each 12 monthperiod during which it may hold unwanted materials in the laboratory for up to 30 days fromthe start of the clean-up if the laboratory exceeds 55 gallons of unwanted material (or 1 quartof reactive acutely hazardous unwanted material). (40 CFR 262.213)

Guide Note• Verify that a laboratory clean-out is conducted no more often than once in a 12 month period for each

laboratory (40 CFR 262.213(a)).

NOTE 1: If any additional laboratory clean-outs conducted during the same 12-month period, the eligibleacademic entity must comply with all applicable requirements of 40 CFR 262 Subpart K, but is not eligible tocomply with the less stringent requirements of this paragraph.

NOTE 2: For the purposes of on-site accumulation, laboratories are not required to count hazardous wastesthat are unused commercial chemical products (i.e., P- and U- listed hazardous wastes and unusedcharacteristic hazardous wastes) generated during the designated laboratory clean-out period towards theirgenerator status.

• If the volume of unwanted material in the laboratory exceeds 55 gal (or 1 quart of reactive acutely hazardousunwanted material), verify that all unwanted materials are removed from the laboratory within 30 calendardays from the start of the laboratory clean-out (40 CFR 262.213(a)(1)).

• Verify that the laboratory clean-out is documented, and that records are maintained for 3 yr and include thefollowing information (40 CFR 262.213(a)(4)):

– the laboratory being cleaned out;– the date the laboratory clean-out begins and ends; and– the volume of hazardous waste generated during the laboratory clean-out.

4.9 An eligible academic entity must have a written Laboratory Management Plan that describeshow it will manage unwanted materials. (40 CFR 262.214)

Guide Note• Verify that the facility has developed a written Laboratory Management Plan (40 CFR 262.214(a)).

NOTE: An eligible academic entity may write one Laboratory Management Plan for all the laboratories theyown that have opted to follow the alternative management standards, even if the laboratories are located atsites with different EPA Identification Numbers.

• Verify that Part I of the Laboratory Management Plan includes all of the following (40 CFR 262.214(a)):

– a description of the procedures for container labeling, as follows:

1) whether the eligible academic entity will use the term “unwanted material” on the containers in thelaboratory, and if not, identification of an equally effective term that will be used; and

2) the manner in which label information that is “associated with the container” will be imparted.

– identification of which of the following options the facility will follow for the regular removal ofunwanted material from its laboratories:

1) all containers of unwanted material are removed from each laboratory on a regular interval, not toexceed 6 months; or

2) containers of unwanted material from each laboratory within 6 months of each container’saccumulation start date.

• Verify that Part II of the Laboratory Management Plan includes a description of the facility’s best practices forall of the following (40 CFR 262.214(b)):

– container labeling and management;– providing training of laboratory workers and students commensurate with their duties;– providing training to ensure safe on-site transfers of unwanted material and hazardous waste by trained

professionals;– removing unwanted material from the laboratory, including:

1) for regularly scheduled removals, development of a regular schedule for identifying and removingunwanted materials from its laboratories; and



2) for removals when maximum volumes are exceeded, a description of practices for removingunwanted materials from the laboratory within 10 calendar days and for communicating thatunwanted materials have exceeded their maximum volumes.

– making hazardous waste determinations, including specifying the duties of the individuals involved in theprocess;

– procedures for performing and documenting laboratory clean-outs;– emergency prevention, including:

1) procedures for emergency prevention, notification, and response, appropriate to the hazards in thelaboratory;

2) a list of chemicals that the eligible academic entity has, or is likely to have, that become moredangerous when they exceed their expiration date and/or as they degrade;

3) procedures to safely dispose of chemicals that become more dangerous when they exceed theirexpiration date and/or as they degrade; and

4) procedures for the timely characterization of unknown chemicals.

• Verify that the Laboratory Management Plan is made available to laboratory workers, students, or any others atthe eligible academic entity who request it (40 CFR 262.214(c)).

• Verify that the facility reviews and revises its Laboratory Management Plan as needed (40 CFR 262.214(d)).

4.10 Unwanted material that is not a hazardous waste must be properly managed. (40 CFR 262.215)

Guide Note• Verify that any unwanted material that is not a hazardous waste is managed in compliance with any other

applicable regulations and/or conditions, such as state or local regulations (40 CFR 262.215).

4.11 Non-laboratory hazardous waste generated at an eligible academic entity may not be managedunder the alternative standards. (40 CFR 262.216)

Guide Note• Verify that no non-laboratory hazardous wastes are managed under the alternative standards, and that all such

non-laboratory wastes are managed in accordance with the applicable hazardous waste generator standards(40 CFR 262.216).


HAZARDOUS WASTE.

Overall

Conditionally Exempt Small Quantity Generators: General

.

.PART 4: SCORESHEET.

.Part A-1: Conditionally Exempt Small Quantity Generator Requirements

SITE: DATE:Does not1.

. N/A Complies

.

.

.

. comply

1.1 Determine actions taken or changes made since the previous review of hazardous q q qwaste management.

1.2 Copies of all relevant federal, state, and local regulations and guidance documents on q q qhazardous waste management should be maintained at the facility. (GMP)


2.1 CESQGs are not subject to regulation under 40 CFR 262 – 40 CFR 268, or 40 CFR q q q270, or to notification requirements of RCRA Section 3010, provided they meetcertain requirements. (40 CFR 261.5(e) – (g), and (j))

2.2 Facilities that generate solid wastes as defined in 40 CFR 261.2, must determine if q q qthose wastes are hazardous wastes. (40 CFR 262.11)

2.3 If certain requirements are met, generators may temporarily hold samples collected q q qfor purposes of testing to determine their characteristics or composition withouthaving to meet the requirements of 40 CFR 262 – 40 CFR 268 or the notificationrequirements of RCRA Section 3010. (40 CFR 261.4(d))

2.4 If certain requirements and limits are met, generators may temporarily hold samples q q qcollected for the purpose of conducting treatability studies without having to meetthe requirements of 40 CFR 261 – 40 CFR 263, RCRA hazardous waste generatornotification requirements, or quantity determinations for CESQGs. (40 CFR 261.4(e))

2.5 Containers that previously held hazardous wastes may be reused for other purposes q q qor discarded as a solid waste, provided the regulatory definition of “empty” is met.(40 CFR 261.7)

2.6 Certain materials destined for recycling are exempt from the definition of solid q q qwaste, and are therefore exempt from the hazardous waste regulations. They may beaccumulated prior to recycling provided that the generator can demonstrate that suchmaterials are not being accumulated speculatively. (40 CFR 261.1(c)(8) and 40 CFR261.2(c)(4))

2.7 The facility should ensure that transportation of hazardous wastes between buildings q q qon the site is accomplished in accordance with GMPs to help prevent spills, releases,and accidents. (GMP)

2.8 Used, broken cathode ray tubes (CRTs) destined for recycling are not solid wastes, q q qand are therefore exempt from the hazardous waste regulations, provided that certainconditions are met. (40 CFR 261.4(a)(22) and 40 CFR 261.39)

2.9 Processing of used, broken CRTs (including the management of glass removed from q q qCRTs) is exempt from the hazardous waste regulations provided that certainconditions are met. (40 CFR 261.39(b))


Generators: Hazardous Waste Laboratories

Alternative Waste Determination and Accumulation

Hazardous Waste Part A-1 Scoresheet

2.10 Used, intact cathode ray tubes (CRTs) that are recycled are not solid wastes, and are q q qtherefore exempt from the hazardous waste regulations, provided that certainconditions are met. (40 CFR 261.4(a)(22) and 40 CFR 261.40)

2.11 Certain wastes may be exempt from the hazardous waste regulations provided that q q qcertain conditions are met. (40 CFR 261)


3.1 Laboratories and testing facilities may temporarily hold or ship hazardous waste q q qsamples for treatability studies without meeting hazardous waste generator ortransporter requirements, if they operate in accordance with regulations. (40 CFR261.4(f))

3.2 Laboratories and testing facilities that temporarily hold or ship hazardous waste q q qsamples for treatability studies without meeting hazardous waste generator ortransporter requirements must comply with recordkeeping and reportingrequirements. (40 CFR 261.4(f))

4. Does notN/A Complies complyRequirements for Eligible Academic Entities.....

4.1 An eligible academic entity must notify EPA in writing that it is electing to comply q q qwith the alternative requirements of 40 CFR 262 Subpart K prior to operating underthese alternative requirements. (40 CFR 262.203)

4.2 An eligible academic entity must notify EPA if it elects to withdraw from the q q qalternative requirements of 40 CFR 262 Subpart K. (40 CFR 262.204)

4.3 An eligible academic entity must manage containers of unwanted material in q q qaccordance with specific standards while that material is in the laboratory. (40 CFR262.206)

4.4 An eligible academic entity must provide training to all individuals working in a q q qlaboratory. (40 CFR 262.207)

4.5 An eligible academic entity must remove all containers of unwanted material from q q qeach laboratory on a regular schedule and when certain volumes are exceeded. (40CFR 262.208)

4.6 An eligible academic entity must ensure that a trained professional makes a q q qhazardous waste determination on unwanted materials. (40 CFR 262.209)

4.7 An eligible academic entity that makes the hazardous waste determination for q q qunwanted material in the laboratory must comply with certain requirements. (40 CFR262.210)

4.8 An eligible academic entity may conduct a laboratory clean-out once during each 12 q q qmonth period during which it may hold unwanted materials in the laboratory for upto 30 days from the start of the clean-up if the laboratory exceeds 55 gallons ofunwanted material (or 1 quart of reactive acutely hazardous unwanted material). (40CFR 262.213)

4.9 An eligible academic entity must have a written Laboratory Management Plan that q q qdescribes how it will manage unwanted materials. (40 CFR 262.214)

4.10 Unwanted material that is not a hazardous waste must be properly managed. (40 q q qCFR 262.215)

4.11 Non-laboratory hazardous waste generated at an eligible academic entity may not be q q qmanaged under the alternative standards. (40 CFR 262.216)


© STP

Contact Information

• Toll Free: 1-800-251-0381 • Phone: 1-604-983-3434 • Email: [email protected] • Visit: www.stpub.com

mailto:[email protected]



© STP

Related Publications

• Environmental State Differences Summaries and Checklists • Environmental Auditing:

Integrated Federal & California Compliance Guide • OSHA Auditing: Federal

Compliance Guide • OSHA State Differences

Summaries and Checklists • ISO 14001 Environmental

Management Systems

http://www.stpub.com/environmental-state-differences-summaries-and-checklists-online

http://www.stpub.com/environmental-auditing-integrated-california-and-federal-compliance-guide-online

http://www.stpub.com/osha-auditing-federal-compliance-guide-facilities-the-complete-safety-and-health-audit-checklist-online

http://www.stpub.com/osha-state-differences-summaries-and-checklists-online

http://www.stpub.com/iso-14001-environmental-management-systems-a-complete-implementation-guide-online

© STP

About STP

Premier publishers of practical interpretive technical guides for compliance and risk reduction, serving North American and global business leaders, audit managers and other professionals. STP publications offer comprehensive, up-to-date guidance on key issues and help ensure compliance with standards and regulatory requirements.



environmental auditing: federal compliance guide sample

Technology

facility discharges

q q discharges

discharges incidental

discharges of dredged

andor discharges of

following vessel discharges

stp environmental auditing

e discharges of pollutants