Master of Social Work Program Handbook

Fall 2017 | Spring 2018

Table of ContentsUniversity of Missouri’s School of Social Work Mission� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 1MSW Program Mission Statement � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 1Statement of Non-Discrimination� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 1Intellectual Pluralism � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 1Special Needs � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 1MSW Program Goals and Objectives � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 1 Generalist Goals and Objectives � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 1 Policy, Planning, and Administrative Objectives � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 2 Clinical Practice Objectives � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 3Masters of Social Work Curriculum � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 3 Overview � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 3 Concentration � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 4 Prerequisites � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 6 Practicum II � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 6 Electives � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 6 Clinical Selectives� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 6 Online Courses � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 6 Summer Semester � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 7 Course Descriptions � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 8 Field Instruction � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 12 SOC WK 8970 Seminar � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 12 Portfolio Project � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 13 Independent Studies � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 13 GraduateCertificateinGerontologicalSocialWork � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 13 MSW/MPH Dual Degree Program � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 14 Enrollment in 2nd Year Fall Classes � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 15 Course Transfer � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 15 Course Waivers� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 15 Grading � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 15 Grades of “C” � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 16 Grades of “I”� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 16 Grade Appeals� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 16 Academic Probation � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 16 Course Withdrawal � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 17 Leave of Absence � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 17 Withdrawal from the University � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 17 ReadmissiontotheSchoolofSocialWork� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 17 Part-Time Students � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 18Technology Suggestions for Online Students� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 18 BasicComputerSkills � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 18 BasicComputerSpecifications � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 18 Mobile Devices � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 19 Accessing Online Course Content � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 19 Video � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 19 Written Material� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 19 Web/Video Conferencing� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 19 Virus Protection and Malware Protection � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 19

Other MSW Program Requirements � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 19 APAManual/AcademicIntegrityTutorial&Quiz � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 19 Poverty Simulation � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 19 Graduation Requirements � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 19Advisement � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �20 Regular Advisement � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �20 Duties and Responsibilities of the Advisor � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 21 Change of Advisors � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 21 Special advisement � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 21 Student Status Review � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 22 Dismissal from School � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 23 Initiation Procedures � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 23 Advisor Role � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �24 Hearing Procedure � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �24 Follow Up to Student Status Review Committee Meeting � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 25 Dismissal Appeal Process � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 25MU Student Services � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 27 Asian Affairs Center � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 27 Bookstore(TheMizzouStore) � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 27 Cambio Center � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �28 CampusComputing/DivisionofInformationTechnology(DoIT)� � � � � � � � � � � � � � � � � � � � � � �28 Campus Dining � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �28 Career Center � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �28 Cashier’sOffice � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �28 Center for leadership development and Community Involvement� � � � � � � � � � � � � � � � � � � � � �28 Counseling � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �28 Disability Center � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �28 E-Mail � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �28 Financial Aid � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �29 GainesOldhamBlackCultureCenter � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �29 OfficeofGraduateStudies � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �29 GraduateStudentOrganizations � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �29 International Center � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �29 LGBTQResourceCenter � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �29 Library � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �29 Multicultural Center � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �29 OfficeofServiceLearning � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �30 Parenting � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �30 Parking&Transportation � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �30 Police Department � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �30 Relationship&SexualViolencePreventionCenter� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �30 Student Health � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �30 Student Legal Services � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �30 Student Recreation Center � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �30 The Learning Center Graduate Writing Services � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �30 University Housing/Residential Life � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �30 Wellness Resource Center � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 31 Women’s Center � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 31

School of Social Work contacts � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 31 Staff Contacts � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 31 FacultyProfiles � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 31School of Social Work Student Services � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 31 Computer Lab � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 31 ConferencesandWorkshops� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 31 FreeMeetingSpaceforSocialWorkstudents � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 31 Job Openings � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 32 SchoolofSocialWorkStudentGroups � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 32 SchoolofSocialWorkWebSite � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 33 Student Listserv: MSW-L � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 33Financial Aid� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 33 SchoolofSocialWork(SSW)Scholarships� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 33 Student Loans � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 33 SSW Assistantships � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 33 Graduate School Fellowships � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �34 Field Placement In Employment Setting � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �34Code of Conduct� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �34 Studentresponsibilitytoknowacademicregulations � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �34 Academic Dishonesty � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �34 Discrimination Grievance Procedure � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 35 SexualHarassmentPolicy � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 35 NASW Code of Ethics� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 35 MU Statement of Values � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �36Registration Checklist � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 37Sample Plan of Study - Masters of Social Work Program � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �38 AdvancedStanding,Full-Time–Columbia(39credithours)SpringStart � � � � � � � � � � � � � � �38 AdvancedStanding,Part-Time-Columbia(39credithours)SpringStart � � � � � � � � � � � � � � �39 RegularStanding,Full-Time-Columbia(60credithours)FallStart � � � � � � � � � � � � � � � � � � � � 41 RegularStanding,Part-Time–Columbia(60credithours)Fallstart � � � � � � � � � � � � � � � � � � �43 AdvancedStanding,Part-Time–Online(39credithours)Fallstart � � � � � � � � � � � � � � � � � � � �45 RegularStanding,PartTime–Online(60credithours)Fallstart � � � � � � � � � � � � � � � � � � � � � �47MSW Scholarship Application � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �50 SchoolofSocialWorkScholarships� � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 51Release of information Form � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 53Address Change Form � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � �54Learning Plan for Problems, Independent Study & Research � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 55Intent to complete MSW/MPH Dual Degree � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 57Generalist and Concentration Competencies � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � � 58

1

University of Missouri’s School of Social Work MissionThemissionoftheMUSchoolofSocialWorkistopromoteleadershipforsocialandeconomicjusticebypreparingstudentsforprofessionalexcellenceandleadershipinpractice,research,andpolicy.Withinthecontextofalandgrantinstitution,themissionoftheSchoolofSocialWorkreflectstheUniversityofMissouri’stightlyinterlockedmissionsofteaching,research,outreach,andeconomicdevelopment.

MSW Program Mission StatementTheUniversityofMissouri’sMSWProgrampreparescompetent,effectiveandethicalsocialworkprofessionallead-ersforsocialchange.TheMSWProgramemphasizesacommitmenttoenhancinghumanwell-beingbyalleviatingsocialproblems,embracingdiversityandpromotingsocialandeconomicjusticewithsystemsofallsizesthroughadvancedclinicalsocialworkpracticeandpolicyplanningandadministrativesocialworkpractice.

Statement of Non-DiscriminationTheUniversityofMissouriSystemisanEqualOpportunity/AffirmativeActioninstitutionandisnondiscriminatoryrelativetorace,religion,color,nationalorigin,sex,sexualorientation,age,disability,genderidentityandexpres-sion,orstatusasaVietnam-eraveteran.TheMUSchoolofSocialWorkhasadistinguishedhistoryinpromotingtherightsofoppressedminoritiesofallkindsandinaggressivelychampioningtheircauses.Inkeepingwiththiscommitment,theSchoolactivelysolicitsapplicationsfromqualifiedpersonsofallgroups.

Any person having inquiries concerning the University of Missouri-Columbia’s compliance with implementing Title VIoftheCivilRightsActof1964,TitleIXoftheEducationAmendmentsof1972,Section504oftheRehabilitationActof1973,theAmericansWithDisabilitiesActof1990,orothercivilrightslawsshouldcontactHumanResourceServices,UniversityofMissouri-Columbia,1095VirginiaAve.,Room101,Columbia,MO65211,(573)882-4256,ortheAssistantSecretaryforCivilRights,U.S.DepartmentofEducation.

Intellectual PluralismTheUniversitycommunitywelcomesintellectualdiversityandrespectsstudentrights.Studentswhohaveques-tions concerning the quality of instruction in this class may address concerns to either the Departmental Chair or Divisional leader or Director of the OfficeofStudentsRightsandResponsibilities(http://osrr.missouri.edu/).Allstudentswillhavetheopportunitytosubmitananonymousevaluationoftheinstructor(s)attheendofthecourse.

Special Needs If you have special needs as addressed by the Americans with Disabilities Act, and need this publication in an alternativeformat,notifyusatthefollowingaddressortelephonenumber.SchoolofSocialWork,724ClarkHall,Columbia,MO65211.Phone:573-882-6206.Reasonableeffortswillbemadetoaccommodateyourspe-cialneeds.

MSW Program Goals and Objectives

Generalist Goals and Objectives

Goal1:PreparesocialPreparesocialworkstudentsfortheprofessionalpracticeofsocialworkwithdiversesys-temsofvarioussizes,emphasizingtheprovisionofcompetent,ethicalclinicalandprogramplanning&administra-tiveservices,basedonthecorecompetenciesofsocialwork(Competency1-9).

2

Objectives:• Understandandapplytheoreticalframeworksandscientificorientationtoinformassessment

and guide practice interventions with individuals within the environment, across the lifespan, and across all systemiclevels:micro,mezzoandmacro.

• Useprofessionalvalues,ethics,andskillstoprovideafoundationalcontextwithinthegeneralistpracticeframe-workofengagement,assessment,intervention,andevaluationacrossallsystemiclevels.

• Identifywiththesocialworkprofessionincludingknowledgeofthehistoricalcontextandfoundation.• Demonstrateawareness,sensitivity,andrespectfortheinfluenceofhumandiversityinshapinglifeexperienc-

esacrossthelifespan,nationallyaswellasglobally.

Goal2: Preparestudentstotakeanactiverole,professionally,inaddressingsocialproblemsandtochallengesocialandeconomicinjustice.(Competency2&3)

Objectives:• Recognizetheinfluenceofresearchandpolicyonservicedeliveryaswellastheinfluenceof

practiceonresearchandpolicydevelopment.• Useempirically-basedknowledgetodeveloppracticestrategiesandpolicyadvocacyand

development.• Understand the structure and mechanisms of oppression and privilege and demonstrate the

knowledgeandskillsnecessarytoworkeffectivelywithpopulationsatrisk.• Apply, without discrimination, effective strategies of advocacy and social change that empower

populationsatriskandwhichpromotesocialandeconomicjustice.

Goal3: Preparestudentsforlifelongprofessionaldevelopment.(Competency1&4).

Objectives:• Demonstratecommitmenttocontinuedprofessionaldevelopment.

Policy, Planning, and Administrative Objectives

Goal1:Preparesocialworkstudentsfortheprofessionalpracticeofsocialworkwithdiversesystemsofvarioussizes,emphasizingtheprovisionofcompetent,ethicalclinicalandprogramplanning&administrativeservices,basedonthecorecompetenciesofsocialwork(Competency1-9).

Objectives:

• Recognize,comprehend,andapplysocialworkvaluesandethicstoissuesofsocialandeconomicjusticeinadministrativeandpolicypractice.

• Plan,develop,implement,&evaluateorganizationalandcommunityprogramsusing evidence-based re-search.

• Understandtheoryandapplicationofsupervisoryandconsultativeskillsinadministrativeandpolicyprac-tice.

Goal2:Preparestudentstotakeanactiverole,professionally,inaddressingsocialproblemsandtochallengesocialandeconomicinjustice(Compentency2&3).

Objectives:• Analyzeissuesanddevelopsocialpoliciesthatfurthersocialandeconomicjusticegoalswithinhumanser-viceagencies,organizations,communities,andsociety.

• Understand the structure and mechanisms of oppression and privilege as they related to community and

3

organizationaldevelopment.• Demonstratepolicy,planningandadministrativeskillsinservicetovulnerableandoppressedindividualsandgroups.

Goal3:Preparestudentsforlifelongprofessionaldevelopment(Competency1&4).

Objectives:• Demonstrate recognition of the importance of professional growth and development

Clinical Practice Objectives

Goal1:Preparesocialworkstudentsfortheprofessionalpracticeofsocialworkwithdiversesystemsofvarioussizes,emphasizingtheprovisionofcompetent,ethicalclinicalandprogramplanning&administrativeservices,basedonthecorecompetenciesofsocialwork(Competency1-9).

Objectives:

• Recognize,comprehend,andapplysocialworkvaluesandethicstoissuesofsocialandeconomicjusticeinclinicalpractice.

• Demonstrate the ability to effectively and ethically asses client systems for strengths and needs.

• Implement evidence-based clinical treatment strategies with individuals, families, and groups

• Understandtheoryandapplicationofsupervisoryandconsultativeskillsinclinicalpractice.

Goal2:Preparestudentstotakeanactiverole,professionally,inaddressingsocialproblemsandtochallengesocialandeconomicinjustice(Competency2&3).

Objectives:• Evaluate and improve clinical practice in a systematic and ongoing manner that is informed by evi-dence-basedresearchandthatbuildsthesocialworkknowledgebase.

• Understand the structure and mechanisms of oppression and privilege, and resistance to oppression and theimpactonclientexperiences,assessment,treatment,andevaluation.

• Demonstrateclinicalskillstoworkeffectivelywithvulnerableandoppressedindividuals.

Goal3:Preparestudentsforlifelongprofessionaldevelopment(Competency1&4).

Objectives:• Demonstrate recognition of the importance of professional growth and development

MASTERS OF SOCIAL WORK CURRICULUM

Overview

TheMSWprogrampreparesstudentsforprofessionalleadershipinsocialworkinthepromotionofsocialandeco-nomicjusticethroughtheachievementofcompetenceinafieldofpractice.

ThecurriculumisdividedintotheFoundationlevelandtheConcentrationlevel.TheFoundationcontentiscom-prisedof21credithoursandfocusesonthedevelopmentofgeneralistknowledgeandskillsinsocialwork,includ-ingarequiredfieldpracticum.Concentrationcontentiscomprisedof30credithoursandfocusesonthedevelop-

4

mentofspecializedknowledgeandskillsinClinicalPracticeorPolicyPlanningandAdministration(PPA).

Full-timeRegularStandingMSWstudents(non-BSWgraduates)arerequiredtotake60credithoursandbeginstudyoftheirchosenconcentration(ClinicalorPPA)duringthesecondsemesteroftheregularprogram.Full-TimeAdvancedStandingstudents(BSWgraduates)arerequiredtotake39credithours(7952Research+Concentrationcourses)andbegintheirconcentrationworkuponenteringtheMSWProgram.

Allstudentsmustcompletethedegreerequirementswithinfouryears.

Concentration

The MU MSW program offers two concentrations: Advanced Clinical Practice and Policy, Planning and Administra-tion(PP&A).Withintheseconcentrations,studentshavetheopportunitytocreateaplanofstudybasedontheirindividualinterestsandprofessionalgoals.Decisionsregardingtheirchosenconcentrationaremadebystudentsinconsultationwithfacultyadvisors.

A brief description of the two concentrations is as follows:

1. Advanced Clinical Practice: includes strategies of clinical intervention with socially and economically disadvantaged individuals, families and small groups in a variety of health, mental health, family and chil-drenservices,andseniorcitizenagencies.

2. Policy, Planning and Administration in Human Services: includes intervention strategies that effect changeattheorganizational,interagency,communityandsocietallevelstoadvancesocialandeconomicjusticeforconsumersofsocialandhumanservicesandtoempowerpractitionerswithinthoseagencies.

Acompletelistoffoundationandconcentrationcoursesisprovidedonthenextpage.

5

CourseListFoundation Courses7000ProfessionalSocialWorkPractice 1credit7710SocialPolicyandServiceDeliveryinSocialWork 3credits7720FoundationsofHumanBehavior 3credits7730SocialWorkSkills 3credits7740LargeGroupTheory 2credits7760SocialJusticeSeminar 2credits7952ResearchMethodsandDesigninSocialWork 3credits7971GraduateFieldPracticumI 4credits Total = 21 creditsElective Courses-----Elective 3credits-----Elective 3credits----- Elective** 3Credits Total=6-9credits

Concentration Courses: Clinical -----AdvancedClinicalSelective(choose 1 from those offered)* 3credits7770StrategiesofClinicalSocialWorkIntervention 3credits7780FundamentalsofSocialWorkAdministration 3credits7820DSMV&Psychopathology:ASocialWorkPerspective 3credits8953EvaluativeResearch 3credits8970IntegrativeProfessionalPracticeSeminar 3credits8971 Graduate Field Practicum II 12 credits

Total=30credits

ConcentrationCourses:Policy,Planning&Administration7780FundamentalsofSocialWorkAdministration 3credits7820DSMV&Psychopathology:ASocialWorkPerspective 3credits7920AdvancedFoundationsofHumanBehaviorforAdmin. 3credits8350ManagementofaSocialAgency 3credits8953EvaluativeResearch 3credits8970IntegrativeProfessionalPracticeSeminar 3credits8971 Graduate Field Practicum II 12 credits Total=30credits

*Please note: Clinical Selectives offered will vary from year to year.** 3rd elective is only required for Regular Standing students

6

Prerequisites

AllFoundationcoursesareprerequisitesforsecondyearconcentrationcourses.Thefollowingfoundationcourses(7000,7710,7720,7730,7740,7952)mustbecompletedbeforestudentsmayenter7971Field.

Studentsmaynotenrollinacoursewithan“Incomplete”gradeinaprerequisitecourse.Studentscannotenter8971withan“Incomplete”gradeinanypreviouscourses.Noexceptionsaregrantedtothisrequirement.

Practicum II

Aftercompletionofallconcentrationcoursework,studentsmayenrollin8971GraduateFieldPracticumII(12credits),a680clock-hourfieldpracticum,and8970ProfessionalPracticeSeminar(3credits).

DuringpracticumstudentsareplacedinasocialserviceagencyunderthesupervisionofaMSW.ThisexperiencebeginsonthefirstworkingdayinJanuaryorMayandcontinuesuntiltheendofthesemesteronafive-day-per-weekbasis.Whileinpracticum,studentsparticipateinacompanioncourse,8970ProfessionalPracticeSeminar,andcompletetheirPortfolioProject.Thepracticumexperienceprovides“handson”instructioninthestudents’chosenConcentrationwhiletheSeminarandPortfolioProjecthelptointegratethestudent’sknowledgefrompriorMSWclassroomcourseswiththefieldcourse.

Electives

Allstudentstaketwo-threeelectives*intheircourseofstudy.Consultationwithyouradvisorisimportanttodesignaplanofstudythatfitsyoureducationalneeds.SeealsotheIndependentStudy,TopicsandReadingssectionofthismanualforfurtherelectiveoptions.

Clinical Selectives

Aclinicalpracticeselectiveoffersstudentsanopportunitytoacquirein-depthknowledgeandskillsinacoreareaofclinicalsocialworkpractice.ClinicalConcentrationstudentstakeone(1)clinicalselectiveintheircourseofstudyduringtheirfinalsemesterpriortoblockplacement(8971)ClinicalSelectivesMUSTbetakenwithintheSSW.Non-SWcoursesarenotacceptablesubstitutesfortheclinicalselectiverequirement. Therearenoexceptionstothispolicy.Consultationwithyouradvisorisimportanttodesignaplanofstudythatfitsyoureducationalneeds.

Online Courses

SomeMSWcoursesareofferedonlinethroughCanvascoursemanagementsystems(https://courses.missouri.edu/).Onlinecoursesaredifferentfromthetraditionalfacetofacecoursesthatyouhavetakeninthepastinthattheyrequireconsistentandfrequentinteractionbetweenyou,yourpeersandtheinstructor.Sometimesstudentstakingtheirfirstonlinecoursefeelsomedissonance,discomfortandfrustrationwiththechangeinclassformatbutthisoftenchangesasthestudentbecomesmorefamiliarwiththenewcourseformat.Someofthebenefitsstudentsinonlinecourseshaveidentifiedare:

• asynchronouslearningbetterfitstheirschedule,

• there is decreased travel time to classes,

• thecommunication,problem-solving,criticalthinking,andtechnologyskillsdevelopedthroughonlinecourseworkbetterpreparestudentsforcontemporarylearningandworksettings

Thelearningcurveforthefirstcoursecanbealittlesteep.Tomakeiteasier,becertaintologinfrequentlytoyouronlinecoursesiteandbecomefamiliarwithallthetoolsandpagesonthecoursesite.It’simportanttobecomefa-miliarwiththecoursesyllabusandassignments.Youshouldreadallthediscussionpostingsandparticipateactive-

7

lyindiscussion.Mostimportantly,doyourworkontime(don’tgetbehind!)andcommunicatewiththeinstructorwhenassistanceisneeded.Yourinstructorcan’tbeofassistanceifs/hedoesn’tknowyouarestrugglingwiththeassignmentorcourseformat.VisitMizzouOnline’s“TipsforSuccess”pageformoreinformationabouthowtomanageonlinecoursework(http://online.missouri.edu/succeed/index.aspx).

Summer Semester

DuetotheintensityofcourseworkintheshortSummersemester,studentsshouldschedulevacationsforsometimeafterSummerclasseshaveconcluded,eveniftheirclassesareonline.

Beingonvacationisnotanexcuseformissingin-personclasssessionsordecreasedparticipationinonlinecourses.

8

Course Descriptions

SOC WK 7000 Professional Social Work Practice (1)� Thiscourseintroducesthesocialworkprofessionwithinahistoricalandcontemporarycontext,providesanoverviewofkeyconcepts,standardsandregulations,andassistsstudentsinexaminingpersonalandprofessionalvaluesandethicsrelatedtopractice.

SOC WK 7085 Problems in Social Work (1-6)� Intensivestudyofanareaofsocialwelfarerelatedtospecialinterestofstudent.Prerequisites:graduatestanding,consentrequired.

SOC WK 7001 Topics in Social Work (1-3)� Specialandemergingtopicsinsocialworkandsocialwelfare.Subject,content,andcreditvarydependingonavail-ablefacultyandstudentinterest.Prerequisite:graduatestanding.

SOC WK 7220 Advanced Social Work Practice in Integrated Health Care (3)� Thecoursewillintroducestudentstotheessentialpracticeskillsneededtoeffectivelyaddressthechallengesofintegratingservices,careandsupportforpersonswithhealth,mentalhealth,andsubstanceuseproblems.Countsanelective.

SOC WK 7330 Addiction Treatment and Prevention (3)� Providesknowledgefromsocialworkandotherdisciplinesinvolvedinsubstanceabusetreatment.Integratedap-proachtoproblemsofsubstanceabuseanddevelopmentofself-awarenessareemphasized.Prerequisite:graduatestanding;Countsanelective.

SOC WK 7340 Military Culture: Issues for Helping Professionals (3)�Anintroductiontothebranchesofthemilitaryandrelatedculturalissues.Examinesthehistoricalandcontem-porarycomplexitiesofmilitaryserviceandpersonalandprofessionalvaluesandethicsrelatedtopracticewithmilitarypersonnel,families,andveterans.Countsanelective.

SOC WK 7370 Delinquency, Corrections and Social Treatment (3)� Focuses on problems and causative factors in developing and maintaining delinquent and criminal behavior and attitudes:addressingcriticalandcomparativeunderstandingofsocialchangestrategiesemployedinthisfield.Prerequisite:graduatestanding;Countsanelective.

SOC WK 7390 Helping Strategies With Children and Adolescents (3)� Thiscourseisanintroductiontosocialworkpracticewithyouth.Contentdrawsontheories,policies,researchandpracticeskillsrelevanttounderstandingandhelpingchildrenandadolescents.Prerequisite:graduatestanding;Countsanelective.

SOC WK 7395 Death, Grief and Loss (3)� This course is designed to provide an awareness of the impact of grief and loss whether as a result of a death or majorlifealteration.Theperspectivethatgriefexistsinmanycontextsbeyonddeathwillbeafocalpointofthecourse.Theoryassociatedwiththeprocessofdying,griefandgriefresolutionwillbeexamined.Additionally,studentswillexploreinfluencingfactorssuchaslifespandevelopment,religion,cultureandpersonalresponsestoloss.Countsanelective.

SOC WK 7400 Contemporary Issues in Domestic Violence (3)� (sameasWomen’sandGenderStudies7400).Covershistoryofthedomesticviolencemovement,intimatepartnerviolencetheoriesanddata,legislativeandorganizationalpolicyissues,andinterventionmodelsforpracticewithindividualswhohaveexperienceddomesticviolenceincludingco-occurringissuessuchastrauma.Prerequisite:graduatestanding;Countsanelective.

9

SOC WK 7410 Law and Social Work Practice (3)� Thiscourseexplorestheintersectionofhumanservices,law,andpolicy.Itexploreshowlawshapesservicesdirect-edatchildren,families,women,andracialandsexualminorities.Studentslearntoworkwithlegalprofessionals,prepareforproceedings,andavoidmalpractice.Prerequisite:graduatestanding;Countsanelective.

SOC WK 7450 Critical Issues in Child Welfare (3)� Intensiveseminaroncurrentdevelopmentsinchildwelfarepractice.Addressescontroversiesinassessment,inter-vention,andpolicymakingforchildrenandtheirfamilies.Examineinterventionforprevention,protection,place-mentandreunificationforchildreninhigh-risksituations,Prerequisites:graduatestanding;Countsanelective.

SOC WK 7460 Advanced Social Group Work (3)� Anintensiveexposuretothetheoriesandmodelsofsocialgroupworkpracticethroughcognitive,affectiveandexperiential(laboratory)methodsofteaching/learning.Prerequisites:graduatestanding;Countsanelective.

SOC WK 7470 Organizational Issues in Social Work Practices in Child Welfare (3)� Intensiveseminarinmeso-levelpracticeinthefieldofchildwelfare.Examinescommunicationtheory,teambuild-ing,andinter-organizationaldynamicsastheyaffectprofessionalpracticeinchildwelfare.Prerequisites:graduatestanding;Countsanelective.

SOC WK 7480 Helping Strategies with Older Persons (3)� Focusoninterdisciplinarymethodsofassessmentandinterventionstrategiesdesignedtooptimizehealthyfunc-tioningforolderpersonsandtheirfamilies.Prerequisites:graduatestanding; Countsanelective.

SOC WK 7485 Military Social Work (3)�An overview of military culture, resilience, challenges, and behavioral health needs of military personnel and veter-ans.Contentdrawsontheoriesandresearchrelevanttothispopulation.Countsasanelective.

SOC WK 7490 Family Treatment (3)� Comparativestudyoftheoriesandmethodsrequiredforworkwithproblemsoffamilyfunctioning.Bothcon-jointandsubsystemapproachestofamilytreatmentareexamined.Prerequisite:graduatestandinginsocialworkandSOCWK7770;countsasaclinicalselective.

SOC WK 7710 Social Policy and Service Delivery in Social Work (3)� Covershistoricandcontemporaryissuesinsocialwelfarepolicy.Focusesonrelationshipsamongsocialproblems,publicpolicies,privateactions,poverty,racism,sexismandsocialworkpractice/values.Prerequisites:graduatestandinginsocialwork;Foundationlevelcourse.

SOC WK 7720 Foundations of Human Behavior (3)� Substantivesourcesfrombehavioralsciencesusedinsocialworktowardunderstandingthebiosocialprocessesandconstraintsofhumandevelopment.Prerequisite:graduatestandinginsocialwork;Foundationlevelcourse.

SOC WK 7730 Social Work Skills (3)�Introducestheoryandapplicationofstrengths-basedgeneralistpractice.Developsknowledge,values,andtech-niquesofprofessionalsocialworkpracticeatmicro,mezzo,andmacrolevels,emphasizingassessmentandinterac-tionskillswithindividualsandfamilies.Prerequisite:graduatestandinginsocialwork;Foundationlevelcourse.

SOC WK 7740 Large Group Theory (2)� Examinationofsocialenvironmentinwhichsocialworkispracticedwithparticularemphasisondevelopmentofanalyticframeworkforunderstandingformalorganizationsandcommunities.Prerequisite:graduatestandinginSocialWork;Foundationlevelcourse.

SOC WK 7760 Social Justice Seminar (2)� Providesintegrativelearningexperienceinsocialworkpracticeinfoundationlevelsocialworkpracticefocusingonsocialandeconomicjusticeexperiencesinfieldpracticum.Prerequisites:graduatestanding;consentrequired.

10

Co-requisite:7971;Foundationlevelcourse.

SOC WK 7770 Strategies of Clinical Social Work Intervention (3)� Strategies of social treatment with individuals and small groups applicable to practice in public and private social agencysettings.Prerequisites:graduatestandinginsocialwork;Clinicalconcentrationcourse.

SOC WK 7780 Fundamentals of Social Work Administration (3)� Basicmanagerialskillswhichsocialworkersneedforsupervision,planning,staffdevelopmentandadministrativepositionsinsocialagencies;focusonindividualmanagementfunctionsandskillsassociatedwiththem.Prerequi-site: graduate standing in socialwork;ClinicalandPP&Aconcentrationcourse.

SOC WK 7820 DSM V & Psychopathology: A Social Work Perspective (3). Examinespsychopathologyofhumanbehaviorwithinsocialworkcontext,prevailingdiagnosticmodels(DiagnosticandStatisticalManualofMentalDisordersV),andhistoricallyoppressivecategorizations. Prerequisites: graduate standinginsocialwork;ClinicalandPP&Aconcentrationcourse.

SOC WK 7920 Advanced Foundations of Human Behavior for Administrators (3)� Examinationofrelevanttheoreticalandbehavioralfoundationsinorderthatstudentscanacquiretheknowledgetofunctionasasocialworkadministrator.Prerequisites:graduatestandinginsocialwork;PP&Aconcentrationcourse.

SOC WK 7952 Research Methods in Social Work (3)� Examinesresearchmethodologyanddesignasappliedtothestudyofsocialworktechniquesandproblems.Em-phasizesdifferentialusesofscientificobservationandtechniquesfordevelopingknowledgeandimprovingprac-tice.Prerequisite:graduatestandinginsocialwork;Foundationlevelcourse.

SOC WK 7971 Graduate Field Practicum I (4)� Supervisedsocialworkpracticeinaschool-approvedagencyprovidingafullrangeofinterventionexperiences.Springsemester,twoorthreedaysperweek.GradedonS/Ubasisonly.Prerequisites:graduatestandinginsocialwork;SOCWK7710,7720,7730;PrerequisitesorCo-requisite:7740,7770or7780,7820,7920;7952;Co-requi-site:7760;Foundationlevelcourse.

SOC WK 8010 Child Abuse and Neglect Assessment and Intervention (3)�In-depthexplorationofidentificationofandinterventionswithabused/neglectedchildrenandtheirfamilies.Examinesrolesforsocialworkwithbothvictimsandperpetrators.Examineshowenvironmentalfactorsaffectsuccessfulintervention.Countsasanelective.

SOC WK 8020 Social Work in Schools (3)�The course focuses on the etiology and development of child and adolescent educational, social, emotional, and be-havioralhealthdisordersencountered,identifiedandtreatedinschoolsettings.Educationaldisabilitiesandrelatedpolicesandtheinterdisciplinarynatureofschoolsettingswillbehighlighted.Countsasanelective.

SOC WK 8030 Client Case Management, Networking, and Advocacy (3)� Examinesthekeyroleofclinicalcasemanagementacrossallsocialworkclientpopulations.Modelsofcaseman-agementforandtechniquesapplicabletothosepopulationswillbedevelopedforeffectivepractice.Prerequisite:graduatestandinginsocialworkandSOCWK7770;Countsanelective.

SOC WK 8050 Resiliency and Solution-Focused Practice (3)� Focusesonbrieftherapyapproachestodealingwithclinicalproblemsinatime-efficient,clinicallyeffectivemeth-od.Variousapproachestosolution-orientedworkbasedinresiliencytheoryarepresented.Stressesclientempow-ermentacrossthelifespan.Prerequisites:graduatestandinginsocialworkandSOCWK7770; Counts as a clinical selective.

11

SOC WK 8060 Trauma Practice and Crisis Intervention (3)� Focusesonclinicaltechniquesforsocialworkwithtraumasurvivors.Addressingeffectsofdisasters,personalvio-lenceandwarareincluded.Resiliencyinsurvivorsispresentedasbasisforinterventions.Prerequisites:graduatestandinginsocialworkandSOCWK7770; Countsasaclinicalselective.

SOC WK 8070 Cognitive Behavioral Practice (3)Focuses on the theory, concepts, and techniques of cognitive behavioral therapies, with a particular emphasis on clinicalinterventionmethodsthatmaybeusedbythesocialworkertoaddressspecificclientneeds.Prerequisites:graduatestandinginsocialwork&SW7770StrategiesofClinicalSocialWorkIntervention;Countsasaclinicalselective.

SOC WK 8210 Disability Rights Advocacy (3) Highlightshistoricalviewsofdisabilitiesinrelationshiptocontemporarypolicies,programsandservices.Thiscross-disabilityfocusexaminestheshiftinfocusfromcure,care,andtreatmenttoparticipation,capabilities,adapt-ingenvironments,andbuildingcommunity.Prerequisites:Graduatestanding;SW7710recommended;Countsanelective.

SOC WK 8220 Integrated Health Policy & Services (3) ThecoursefocusesontheroleofsocialworkersassocialpolicypractitionerswithinanIntegratedBehavioralHealthenvironment.Strategiestoinfluencepoliciesandpromotechangeintheinterestofserviceconsumer,agen-cyandsocietywillbepresented.Countsanelective.

SOC WK 8240 Social Policy for Older Adults (3) Thiscoursewillexaminesocialpoliciesatthelocal,state,andfederallevelthatimpactolderadults.Studentswillexploreandappraiseneeds,values,ageism,andhumanrightsastheypertaintoperspectivesaboutsocialpoliciesforolderadults.Thecoursewillhighlightagingandsocialpolicychallengesrelatedtodiverseandspecialneedsofolderadults.Countsanelective.

SOC WK 8350 Management of a Social Agency (3)� Basic resource management and control techniques common to social agencies with emphasis on personnel man-agement,informationanddatamanagement,andfiscalmanagement.Prerequisites:graduatestandinginsocialwork;PP&Aconcentrationcourse.

SOC_WK 8953 Evaluative Research (3)Develop ability to systematically evaluate effectiveness of intervention strategies designed to produce positive changeinclients’environmentand/orcognitive,affectiveandbehavioralfunctioning.Prerequisite:graduatestand-inginsocialworkand7952.

SOC WK 8955 Independent Study in Social Work (1-6)� Intensiveinvestigationofphenomenagermanetoareaofconcentrationcarriedoutwithguidanceoffaculty.Mayincludedatacollection;leadstoawrittenreportinpublishableformat.Prerequisite:graduatestanding;countsasanelective;consentrequired.

SOC WK 8970 Professional Practice Seminar I (3)� Providesintegrativelearningexperienceinsocialworkpracticeinanareaofbeginningspecializationinautono-moussocialworkpractice.Prerequisites:graduatestanding;consentrequired.Co-requisite:SOCWK8971.

SOC WK 8971 Graduate Field Practicum II (12)� Fieldinstructiontailoredtoconcentrationinterests,developingdepthinclinicalskillsindirectserviceorinplan-ningandadministration.GradedonS/Ubasisonly;Prerequisites:graduatestandinginsocialwork;successful com-pletionofallrequiredgraduatecourseworkexceptSOCWK8970;Co-requisite:SOCWK8970.

12

Field Instruction

Fieldinstructionisacrucialpartofstudents’learningexperienceasitprovidesstudentswiththeopportunitytoputintopractice,inasocialserviceagency,theconceptslearnedintheclassroom.RegularStandingstudentscompletetwocoursesinthissequence:SW7971andSW8971.AdvancedStandingStudentsarerequiredtocompleteonlySW8971.

SW7971requires400clockhoursfor4hourscreditswhichgenerallyinvolvesthreedaysperweekatthefieldsite.

SW8971requires680clockhours(generally40hours/week)for12credithours.

EntryintoSW8971,thefinal(block)fieldplacement,requiresa3.0minimumGPAandsuccessfulcompletionofallpreviousMSWcoursework.

Field assignments are collaborative decisions of the Director of Field Education, faculty advisor, student, and, in somecases,theMSWProgramDirector.

Insomeunusualsituations,studentsmaybeeligibletousetheiremploymentastheblockfieldpracticum.Theemploying agency must consent to new learning/duties for the student during the period of the course as well as meetingtheregularcourseconditions.TheDirectorofFieldEducationisresponsiblefornegotiatinganddirectlymonitoringthesearrangements.

Students are encouraged to consult the Field Education website at http://ssw.missouri.edu/fieldinfo.shtml to browse thedatabaseofpossiblefieldplacementsitesandreviewfieldplacementprocedures.StudentsmustsecuretheField InstructionHandbookfordetailedexplanationofrequirementsthatmustbemetbeforeentryintoanyFieldPlace-ment.Therearepoliciesandprocedurestobefollowedwhileintheplacementswhicharevitalfortheirsuccessfulcompletion.Failuretoadheretotheserequirementscandelayentryintothefieldplacementsorfailuretograduate.

Please note: If you have criminal history, including misdemeanor or felony, your practicum placement will be af-fected.Pleaseknowthisisariskyouassumeandyourchoicesofpracticumplacementsmaybeseverelylimited.Thismeanstheremightnotbeaplacementavailableortheplacement(s)youdesiremaynotbeanoption.TheFieldEdu-cationOfficeattemptsplacementsforallstudentsbutcannotchangeagencypolicyregardingacceptanceofstudentswithacriminalhistory.Thedateandtypeofoffensebothfigureheavilyintoplacementoptions(themorerecenttheoffensethelesslikelihoodofacceptancebyagencies).Thestudentmustbeawarethathe/shewillneedtoaccepttheplacement available regardless of student preference or career plans or the student may have to delay practicum until anacceptingagencyisavailable.

Inaddition,pleasebeawarethat,dependingontheoffense,yourabilitytobecomelicensedmayalsobeaffected.Foradditional information regarding licensure you can contact the Missouri Division of Professional Registration at http://pr.mo.gov/socialworkers.asporcontactthembyphoneat573.751.0885.

Studentswillberequiredtosubscribetoaweb-basedprogram,Taskstream,tocompleteallfieldpracticumpaper-work(aoneyearsubscriptionforadvancedstandingstudentsandatwo-yearsubscriptionforregularstandingstudents).Therewillbeafeeassociatedwiththeprogram.TheprogramwillrequirethatyousignaFERPAwaivergivingpermissiontoshareyourpersonalinformationwithfacultymembers,fieldinstructorsandfacultyliaisonswithaneducationalneedtoknow.

SOC WK 8970 Seminar

Seminarmaybeofferedin-person&/oronlinedependingoninstructorandstudentpreferencesofcourseformat.Studentswhoareplacedinpracticumsites75milesorgreaterfromtheColumbiacampusarerequiredtotakeSeminaronline.In-personseminarsessionsmaymeetonweeknights(oneeveningperweek),Friday(4alldaysessionsduringthesemester)orFriday/Saturdaysession(2weekendsessionsduringthesemester).Becauseyouareearningcreditforbothcourses,seminarhourscanNOTbecountedasfieldplacementhours.Studentsmustmake-upfieldhoursmissedwhenattendingseminarclasssessions.

In-personseminarmeetingdatesarechosenbytheseminarinstructorandarenon-negotiable.Thesedatesare

13

providedtostudentsasearlyaspossible.Theyarepublishedinacourseofferingsheetprovidedtostudentsviatheirstudentemailaccountpriortotheopenenrollmentperiod.

PLEASE NOTE: Students who enroll in seminar classes that meet on Friday or Friday/Saturday must attend all classroomsessionstopasstheclass.Therearenoexceptionstothispolicy.Ifyoumissaseminarsession,youcouldberequiredtodropfieldandseminar.Thiswilldelaygraduationforuptooneyear.

Portfolio Project

Studentstakeaseminarclass(SW8970)concurrentwiththeirfinalpracticumcourse(SW8971).Aportfo-lio demonstrating the student’s growth in the program is a requirement of SW 8970 and is considered the capstoneprojectfortheMSWprogram.Assuch,theportfolioisasubstituteforamaster’sthesisorcom-prehensiveexam.Informationfortheportfolioshouldbecollectedthroughoutstudents’academicprogram.Studentsareadvisedtokeeptheirsyllabi,assignments,tests,andanyotherimportantdocumentsrelatedtoeachindividualcourseforpossibleuseintheportfolio.Thestudent’sseminarinstructorwillprovidespecificguidelinesforthefinalorganizationoftheportfoliopriortosubmission.

Independent Studies

Studentsmaywishtotakeoneoftheirelectivecoursesasanindependentstudy.Suchcoursesfocusonthestudyorinvestigationofadefinedproblemortopic,orreadingsinasubstantiveknowledgeareawhichmaylegitimatelybethebasisofindependentstudy,isrelatedtoyourchosenconcentration,andisnotavailableasaregularcourse.StudentsmaynottakeindependentstudiesasasubstituteforrequiredFoundationorConcentrationcourses.

Thefirststepindesigninganindependentstudyistodiscussyourplanswithyoufacultyadvisor.Withthehelpofyouradvisor,locateafacultymemberwhoiswillingandabletosuperviseyourwork.Thiscouldbeyourfacultyadvisororanotherfacultymemberwithsubstantiveknowledgeonyourchosentopic.Ifafacultymemberagreestosuperviseyourindependentstudy,thenextstepistocreateastudyplanwiththesupervisingfacultymemberusingtheapproveddepartmentalproposalform(MSW4)andobtainyourfacultyadvisor’sapprovaloftheplan.Theproposalformmustbe signed by the course instructor, the faculty advisor, and the MSW Program Director before you will be permitted to registerfortheindependentstudycourse.

Independentstudycoursesmaybetakenforvariablecredit.TheGraduateSchoolhasalimitastohowmanycredithoursmaybetakenintutorial/independentstudyandthiswillguidetheadvisor’sdecision.Onetosixhourscreditiscustomary.

Graduate Certificate in Gerontological Social WorkTheGraduateCertificateinGerontologicalSocialWorkattheUniversityofMissouriisdesignedtoexpandthepoolofprofessionalswhoarequalifiedtoworkinsettingswitholderadultsandtheirfamilies.Thecertificatefocusesonpracticestrategiesofsocialworkinterventionfrommicro,mezzo,andmacroperspectives.ThiscertificatewillbeavailabletostudentsenrolledintheMUSchoolofSocialWorkmaster’sprogramaspartoftheirgraduatetrainingaswellasastand-alonecertificatetograduatelevelclinicalMSWpractitionersandgraduatelevelpolicyandadministrationMSWpractitionerswhowishtoaugmenttheirknowledgeandskillsinthisarea.ApprovaloftheMSWProgramDirectorandCommittee,andDirectoroftheGraduatecertificateinGerontologicalSocialWorkisrequiredforadmissiontothecertificateprogram.ParticipantsintheGerontologicalSocialWorkCertificateprogrambuildawarenessandexpertiseforworkinset-tingsthatserveolderadultsandtheirfamilies.Participantsaretrainedinmicro,mezzo,macroandclinicalstrate-giesknowntobeeffectiveinworkwitholderadultsandtheirfamilies.Aninterdisciplinary,multi-levelemphasiswill be provided in the program since a large component of elder care is the coordination and management of servicesprovidedbyvariousdisciplines.Courseworkwillutilizeabio-psycho-social-culturalperspectiveempha-sizingtheecologicalperspective,Lawton’stheoryofenvironmentalpress,resiliency,andthefunctionalagemodeloffamilywork.Inaddition,studentswillbuildawarenessofagingpoliciesandservices,andpoliciesthatimpactpersonswithdisabilitiesandwomen.AsaresultofearningtheGerontologicalSocialWorkGraduateCertificate,practicingMSW’sorPost-MSWdegreepractitionerscanexpectenhancedemployabilityduetothedevelopmentofnewskillsthatrespondtogrowing

14

societalneed.CurrentMSWstudentsbenefitfromthegraduatecertificatebycompletingaconcentratedcourseof study on a population group and obtaining specialty training with population/services needing graduate level socialworkers.TheGerontologicalSWGradCertificateconsistsof12credithours,includingtworequiredcourses,oneelectiveandoneinterdisciplinarycourseingerontologyoraging.Therequiredcoursesinclude:1)“HelpingStrategieswithOlderAdults“(countsasanelective);and2)“PoliciesandServicesforOlderAdults“(countsasapolicyelective).For the third course, clinical MSWs choose between “Family Treatment”, “Resiliency and Solution Focused Practice”, and“ClientCaseManagement,Networking,andAdvocacy”,(allcountasaclinicalselective).Policy,PlanningandAdministrativeMSWswilltake“DisabilityRightsAdvocacy”(countsasanelective).Forthefourthclass,studentswill choose from a variety of acceptable interdisciplinary courses in gerontology to be approved by the Director of theGraduateCertificateinGerontologicalSocialWork.DuringthefinalsemesteroftheMSWProgram,thefull-timeblockpracticumexperience40hours/week(680totalhours)isarrangedatasettingwherestudentswillgainskillspracticingwitholderadults.TheDirectorofFieldinconjunctionwiththeDirectoroftheGraduateCertificateinGerontologicalSocialWorkworkswithstudentstochooseapracticumsettingthatfitsSSWrequirementsandstudentinterests.PracticingMSWsonlycomplete12hoursofcourseworkandarenotrequiredtocompleteanadditionalpracticumexperience.ForadditionalinformationabouttheGraduateCertificateinGerontologicalSocialWork,pleasecontacttheGeron-tologicalSocialWorkGraduateCertificateDirector,Dr.ColleenGalambosatGalambosC@missouri.edu.

MSW/MPH Dual Degree ProgramFull-time, regular standing students can earn a MasterofSocialWork (MSW)anda Master of Public Health (MPH)with an emphasis in HealthPromotionandPolicy.Graduatesofthedualdegreewillbewell-positionedtofindemployment as a health policy advocate, health agency administrator or in an integrated behavioral health setting asacaremanagers,healthcoach,patientadvocate,counselor,orteamleader.Studentspursuingdualdegreesmustbeindependentlyadmittedtoeachprogram.Only Regular Standing (RS),full-timeMSWstudents(bothclinicalorPP&Aconcentration)willbeadmittedtotheprogram.

The dual degree reduces total student credit hours by 27 credits and reduces the length of study by one academic year.Ifcompletedseparately,studentswouldberequiredtocomplete105credithours(60credithoursforRSMSW;45credithoursforMPH)Studentscompletingbothdegreeswillberequiredtocomplete78credithours,with51ofthosebeingdisciplinespecific(18MPHand33MSW)and27creditssharedbetweenthetwopro-grams.Studentswillcompletethebothdegreeprogramsin7semesters,includingonesummersession.Pleaseseeour sampleplansofstudy.

Students will apply separately to each program and be admitted to both programs before they are accepted as a dualdegreestudent.Studentsmayapplyatanypointbeforebeginninggraduateschoolorduringthefirstyearofeitherprogram.MPHstudents applying for the MSW program must submit their MSW application no later than October 1st oftheirfirstyearofstudybutearlyapplicationsubmissionisencouraged.MSWstudentsapplyingforthe MPH program must submit their MPH application byDecember1stoftheirfirstyear.Onceacceptedintobothprograms, the student must complete the IntenttoCompleteMSW/MPHDualDegreeform.

The advisor for the MSW/MPH Dual Degree program participants will be a faculty member with a joint appoint-mentinboththeMSWandMPHPrograms.Ifafacultymemberwithajointappointmentisnotavailableforadvis-ing,thestudentwillbeappointedaseparateadvisorforbothdegreeprograms.Incaseswherestudentdifficultiesareexperiencedthatrequireadvisoryservicesotherthanthatavailablefromtheadvisor,theSchoolofSocialWork’sformalstudentadvisoryprocesswillbefollowed.

Up to eight hours of transfer credit may be applied as follows: to one of the two degree programs, or divided betweenthetwodegreeprogramspertheadvisor(s)andprogramdirectors’decision.Theeighthoursoftransfercreditwillnotbeappliedseparatelytoeachdegreeprogram.

Credit requirements, shared hours, and curriculum focus conform to the requirements of the MU Graduate School, thenationalaccreditingbodyforgraduateeducationinpublichealth(CEPH),andthenationalaccreditingbodyforgraduateeducationinsocialwork(CSWE).Thecapstoneandinternshipwillsatisfytherequirementsofbothprogramsandwillfocusontheintersectionofsubjectmatterbetweensocialworkandpublichealth.

15

Enrollment in 2nd Year Fall ClassesCoursesarefilledonafirstcome,firstenrolledbasis.NOoverrides/permissionswillbegivenforClinicalSelectivecoursesandfewoverrides/permissions,ifany,willbegivenforotherelectives.

Course Transfer

Life Experience/Previous Work Experience Policy:In accordance with CSWE accreditation standards, the MU SSW does not grant social work credit for life or work expe-rience at the MSW level.

GraduatecourseworkfromanotherinstitutionmaybeallowedastransfercredittowardtheMSWdegreeifthecourseworkmeetsspecifiedcriteria:

a. Thetransferredcoursewillbelessthaneight(8)yearsatthetimetheMSWdegreeisgranted.

b. IfthecourseistosubstituteforaFoundationcourse,itmusthaveequivalentcontent.Thisisdeterminedbyyouradvisorand/ortheMSWProgramDirector.

c. Ifthecourseistobeusedasanelective,itmustberelatedtothestudent’schosenconcentration.

d. Nocoursetransfersarepermittedforrequiredsecondyearconcentrationcourses.

e. Amaximumoftwelve(12)hoursoftransfercreditwillbeconsideredforthesixty(60)hourprogram,andamaximumofsix(6)hoursoftransfercreditwillbeconsideredforthethirty-nine(39)houradvancedstandingprogram.

f.Tosubmitmaterialsforreview,pleasefirstreadthedefinitionsandcoursedescriptionselectives(page7ofthishandbook).Decidewhich,ifany,ofyourpriorgraduatecoursesyoubelievemayqualifyfortransfer.Locateorobtainacopyofthesyllabusforthecourseyoutookfromyourformerinstitution(s)andforwardthem to the Student Support Specialist at nullc@missouri.edu.TheMSWProgramDirector,oryouradvisor,willreviewthesyllabusanddecideifitisacceptablefortransfercredit.

Weencourageyoutosubmityourrequestsfortransferasearlyaspossible.YoumaysubmitsyllabifortransfercreditreviewanytimebutpleaseknowthatthereviewsareconductedatthediscretionoftheDirectorandyouradvisor.Ifyousubmityourmaterialspriortoorientation,adecisionmaybereadybythetimeyoubegintheMSWprogram.

Course Waivers

StudentswhoqualifyforadvancedstandingreceiveawaiveroftheFoundationcontentwiththeexceptionofSoc_Wk7952:ResearchMethodsinSocialWork.

Grading

Graduatestudents’gradesinallcoursescountingtowardanadvanceddegreemaybereportedas:A+/-,B+/-,andC+/-.Facultymembersarenotrequiredtouseaplus/minusgradingscale;thatdecisionshouldbebasedonthefacultymember’sevaluationofstudentperformanceand/orpolicesoftheiracademicprogram.Gradepointaveragesarecalculatedas:A+(4.0),A(4.0),A-(3.7),B+(3.3),B(3.0),B-(2.7),C+(2.3),C(2.0),andC-(1.7).TheGraduateSchoolconsidersgradesofC+,CandC-aspassinggrades;however,gradesintheCrangemaynotbeacceptableforspecificprogrammaticrequirementsandmayresultinthestudentbeingunabletomaintaina3.0cumulativeaverage.

NoDgrademaybeawardedtoagraduatestudent,andagradeofFmeanstheworkhasnotsatisfiedthemin-imumrequirementsofthecourse.Wdenoteswithdrawnpassinganddoesnotaffectastudent’sgradepointaverage.

16

Grades of “C”Astudentwhoreceivesa“C”gradeinanyfoundationorconcentrationlevelMSWcoursemustrepeatthatcourse.Ifthe course where a grade of “C” is earned is part of a course sequence, the course that is part of a course sequence mustrepeated,andatleasta“B”gradeearned,priortotakinganyfurthercourseworkin that sequence in the MSW program.Thiscouldresultindelayingastudent’sgraduationbyatleastoneyear.

Grades of “I”

Agradeof“I”(Incomplete)isgivenonlyinunusualcircumstancesandatthediscretionoftheinstructor.Thestu-dent must develop, together with the instructor, a plan for completion of the course within a designated time peri-od.Notethatagradeof“I”mustbereplacedbythedatespecifiedbytheinstructor,butnolaterthantheendofonecalendaryear.Studentsshouldbeawarethatgradesof“I”maypreventtheirabilitytotakesubsequentrequiredcoursesand,thereby,delaygraduation.AstudentwiththreeormoreoutstandingincompletesmaynotregisterforadditionalMSWcourses.Failuretofinishcourseworkintheclasswherethegradeof“I”wasassignedwithinthegiventimeframewillresultinthegradeof“I”beingconvertedtoagradeof“F”.ThiscanleadtoacademicprobationordismissalfromtheschoolofSocialWork(seepages27-30formoreinformationaboutprobationanddismissal).

Grade Appeals

Studentsmayappealafinalcoursegradeiftheybelievetheyhavebeengradedinanarbitraryandcapriciousway.Agrademaybeconsideredarbitraryandcapriciousundertheserulesonlyifoneofthefollowingisshown:a. The grade is assigned on some basis other than the performance in the course;

b. Thegradewasassignedbyreferencetomoreexactingordemandingstandardsthanwereappliedtootherstudentsinthecourse,exceptthatforundergraduatesin300and400levelcourses,adifferent,butsimilar-ly uniform, grading standard may be applied than for graduate students in the course;

c. The grade was assigned by reference to a performance standard which substantially deviated from the per-formance standard previously announced by the instructor;

d. Thegradewasassignedaftertheinstructorrefusedtocorrectmathematicalormechanicalgradingerrors.

SeetheFacultyHandbookforinformationabouttheproceduresforappeal(J4):

http://facultycouncil.missouri.edu/handbook/article-7.html

Academic Probation

TheSchool’sAcademicProbationregulationsaredesignedforagraduateprofessionalprogramandmayexceedUniversityrulesandregulationsontermandcumulativeGPA.AlloftheUniversityrulesandregulationsregardingacademicprobationapplytostudentsoftheSchoolofSocialWork(see“GraduateCatalog”oftheUniversity).Inaddition,theSchoolofSocialWorkmayconsidertheuseofprobationarystatusfor:

1)Studentsmaybeplacedonacademicprobationwhenprofessionaldevelopmentisjudgedtobeinadequate.

2)Studentsfailingaprofessionalsocialworkcourse(gradeof“F”)willbeplacedonprobation.

3)Studentsfailingtomakeadequateprogressinselecting,initiatingand/orcompletingaprofessionalfieldplacementwillbeplacedonprobation.AstudentonacademicprobationisnoteligibleforaGSSPfeewaiver.Whilethestudentmaystillholdanassistant-ship,s/hewillnotbeeligibleforaGSSPfeewaiveruntils/heisoffacademicprobation.

DurationAttheendofeachsemester,graduatestudentswithacumulativeGPAbelow3.0areplacedonprobation.If

17

attheendofthefollowingsemesterthecumulativeGPAis3.0orbetter,theprobationarystatusisremoved.AstudentonprobationfailingtoraisethecumulativeGPAto3.0may,ontherecommendationoftheMSWProgramCommittee,beallowedasecondprobationarysemester.AstudentissubjecttodismissaluponfailuretoraisethecumulativeGPAto3.0bytheendofthesecondprobationarysemester,oratanytimeasemester/termorcumulativeGPAfallsbelow2.0.Note:Summersessionisnotcountedasasemester.

Tograduate,astudentmusthaveanoverallGPAof3.0inallgraduatecoursestakenatMUandnotjustthosecourseslistedonaprogramofstudy.Studentscannotgraduatefromtheprogramwhileonprobation-arystatus.

Required student performance

Students’advisorsandtheMSWProgramDirectorwilldelineatespecificexpectationsforstudents’performancewhileonprobation.Attheconclusionoftheprobationaryperiodtheywillreviewthestudents’performanceandmakeoneofthefollowingdecisions:

a. Removefromprobation

b. Continueprobation

c. Dismissfromschool.

Academicprobationsetsinmotionopportunitiestomaximizetheopportunityforstudentstolearn.Students’advisorsandtheMSWProgramDirectormayrecommendactivitiestoimprovestudents’performance.ExamplesmightincludereferraltotheLearningLaboratory;anadditionalfieldplacementand/orextendedfieldplacement;regularmeetingswithacademicadvisor;delayoffieldplacement,orotheractivities.

Course Withdrawal

StudentsmaywithdrawfromcoursesaccordingtothestandardproceduresintheGraduateCatalog.Studentswho wish to withdraw from a course must obtain an Add/Drop form from the Graduate Student Support Specialist.ItrequiresthesignaturesoftheiradvisorsandtheMSWProgramDirector.Studentswillreceiveagrade of “W” if they were passing the course at the time of withdrawal, and a grade of “F” if they were failing the courseatthetimeofthewithdrawal.Withdrawingfromarequiredcoursemaydelaygraduation.

Leave of Absence

Students must follow their plan of study and be continually registered for all fall and spring semesters until completionofthedegree.StudentswhocannotmaintaincontinualenrollmentmayrequestaLeaveofAbsencefromtheMSWprogram.A“LeaveofAbsence”isdefinedasatemporaryinterruption,oneyearorless,ofMSWcoursework.Studentswhoanticipatebeing“onleave”mustmeetwiththeiradvisorortheStudentServicesCoordinatortodevelopaplanfordegreecompletion.TheadvisorwillincludethedegreeplaninthestudentfileandnotifytheGraduateStudentSupportSpecialistoftheplannedleave.StudentsshouldbeawarethatadisruptioninMSWcourseworkwilllikelydelaygraduationforatleastoneyear.Leavesofoveroneyearre-quirereadmissiontotheUniversity.SeeReadmissiontotheUniversitysectionbelow.

Withdrawal from the University

The University Graduate Catalog describes the policy and procedure that must be followed if a student wishes towithdrawfromtheUniversity.

Readmission to the School of Social Work

StudentswhohavebeenabsentfromtheMSWprogramforatleastoneyear,andwhoseekreadmissionintotheprogrammustfileaGraduateStudiesRe-activationform.Formsareavailablehere:http://gradstudies.missouri.edu/forms-downloads/repository/reactivation.pdf. Students will then be required to meet with the MSW Program Directortodevelopaplanfordegreecompletionwithindesignatedtimelimits.Updatedinformationsuchas(SSWapplication,references,transcripts,personalstatement)mayberequestedasaconditionofre-admission.

18

Any student who is absent and has not registered for one year is required by the University of Missouri-Colum-biaGraduateSchooltore-submitanapplicationandanadditional$65.00applicationfee.

Part-Time Students

StudentsmaychoosetoattendtheMUMSWprogramonapart-timebasis.Allonlinestudents(Regular&Ad-vancedStanding)havepart-timestatus.

Part-Timestudentsenrollin2classespersemester,mostsemesters(Fall,SpringandSummer)overaperiodoftwoyears(AdvancedStanding)orthreeyears(RegularStanding).Studentstakeclassesasacohortandarerequiredtofollowaplanofstudydevelopedforthatcohort.

ThePart-TimeMSWProgram-ColumbiaCampuscoursesareheldduringevening(Monday-Thursday)in-personclassesandsomeweekends,aswellasonline.PartTimeMSW-ColumbiaCampusstudentsbegininFallSemester(August-Regularstandingonly).Instructionaltechnologyforoncampusstudentsmayinclude:in-personinstruc-tionandonlinecourses.Studentsshouldhaveaccesstoindependentcomputerresourcesinordertocompleteasignificantamountofrequiredonlinecoursework.

ThePart-TimeMSWProgram-OnlinecoursesarealwaysheldonlinewiththeexceptionofpracticumIandIIwhicharedeliveredinperson.PartTimeMSW-OnlinestudentsbegininFallSemester(August).

Pleaseseetheplanofstudyinthebackofthishandbookformoredetails.

Technology Suggestions for Online StudentsOnline courses are delivered over the Internet and accessed in a learning management system, Canvas, http://courses.missouri.edu.

Basic Computer SkillsStudentsdonotneedtobeadvancedcomputeruserstobesuccessfulintheprogram.However,therearegeneralandbasiccomputerskillsneededtobesuccessfulincoursestoincludetheabilityto: · Download and install software, plug-ins or media players.· Access the Internet frequently and reliably.·        Create, save and retrieve files on computer.· Use basic features of word processing tools, including Word, Excel and PowerPoint or equivalent programs**.· AccessUniversityassignedemaildailyandreliably.

**If students use an equivalent program to Microsoft Office, it is important to verify that the Instructor can open stu-dent files. Students should check with Instructors for file submission types for assignments.

Basic Computer SpecificationsTohavethebestexperienceinanonlinecourse,studentswillneedtomeetbasiccomputerspecificationstofullyaccess their course content and meet course requirements:

WindowsorMac(DesktopPCorlaptop) Reliable High-speed Internet access/Wi-Fi Speakers(builtin*orexternal) Headset, headphones, or ear buds Microphone(builtin*orexternal) Webcam(builtinorexternal) Java6orHigher 2Internetbrowsers(IE,Firefox,Safari,GoogleChrome) Note: Two browsers will be needed because some internet browsers only support certain web applications and tools.

19

16-bitorgreatervideocard(24-bitpreferred)

*Students should check the quality of built in speakers and microphones. External devices may provide higher quality for hearing and speaking with faculty/other students via webcam.

Mobile DevicesThere are apps available for Canvas that students may download to access course content via smartphones, tablets, iPhones,andiPads.Theremaybefeesassociatedfortheappdownloadthatstudentswillneedtopay.TheseappsarenotdevelopedormaintainedbytheUniversityofMissouri.Theseappshavedifferentfeatures,andallcoursecontentmaynotbefullyaccessed.Itisimportanttoreadtheappspecifications.

Accessing Online Course ContentAllonlinecourseswillbedeliveredthroughthecoursemanagementsystem,Canvas.Canvascanbeaccessedathttps://courses.missouri.edu.

VideoStudentsmayviewvideocontentintheircourses.Agoodvideocardisrecommendedtoviewvideoswithoutde-lay/interruptions.

Written MaterialToaccesscoursematerials,studentswillneedMicrosoftOfficeoraequivalentprogramthatcanopenMicrosoftOfficeprograms(e.g.Word,PowerPoint)andPDFs(AdobeAcrobatReader).Itisrecommendedthatstudentsusenewerversionsofprogramstofullyaccessmaterial.TheUniversityofMissouriprovidesoptionsforstudentsforsomeoftheseprogramsthatcanbedownloadedforfreeoratreducedcost.

Web/Video ConferencingSomecoursesrequirestudentstoparticipateviaweb/videoconferencingtools.

Virus Protection and Malware ProtectionStudentswillsharefileswithInstructorsandotherstudents.Itisimportantthatstudentshavevirusprotectionandmalwareprotectionontheirdevices.Therearefreeoptionsavailableforvirusandmalwareprotection.

Other MSW Program Requirements

APA Manual/ Academic Integrity Tutorial & QuizAllMSWstudentsarerequiredtoanonlineacademicintegritytutorialandquiz,andpurchasethelatestedition of the Publication Manual of the American Psychological Association for use during the MSW Pro-gram.

Poverty SimulationAllon-campusMSWstudentsarerequiredtoattendaPovertySimulationExerciseofferedbytheSchoolofSocialWorkinfallsemesteroftheirfirstyearintheMSWProgram.OnlystudentswhoparticipatedintheSSWpovertysimulationasBSWstudentsareexcused.OnlineMSWstudentsarerequiredtoattendaPover-tySimulationneartheirhome,ifavailable.

Graduation RequirementsMasterofSocialWork(MSW)DegreeRequirements/AcceptableProgressTowardtheDegree

TheUniversityconferstheMSWdegreeuponthefulfillmentofthefollowingrequirements:

20

1. Fortheregularprogram,completionof60hoursofgraduatecreditisrequired.Fortheadvancedstandingprogram,completionof39credithoursisrequired.

2. MaintenanceofacumulativeGPAof3.0orbetterforallMSWclasses.

3. Demonstration of “reasonable progress toward the degree” is given by maintaining participation in the MSWprogramofatleast6credithoursineachregularAcademicSemester(Fall&Spring).Apart-timestudentwishingtotakefewerthan6credithoursinaregularsemesterwillneedpermissionoftheMSWProgramDirector.

4. The MU Graduate School requires that the faculty in academic units review the progress of every graduate studenteachyear.Studentsaboutwhomconcernshavebeenraisedwillbenotifiedaboutthenatureoftheseconcernsandhowtheseconcernswillbeaddressed.Studentswhoaredeemedtobeprogressingsuccessfullywillnotbenotified.Anystudentmaydiscusstheirprogressindividuallywiththeiradvisoratanytime.

5. Inconjunctionwiththeadvisor,adevelopmentofaPlanofStudythatallowsforthecompletionofallworkrequiredfortheMSWdegreewithinfouryearsoftheinitiationofcoursework.

6. Completionofallcourseworkwithnodelayofgradesbeforeenteringthesecondyearofstudy.

7. Hours required for the MSW degree must be completed in courses with University Catalog numbers of 7000 orabove.

8. Agradeof“satisfactory”(ona“satisfactory/unsatisfactory”basis)inthefirst-yearfieldcourseisrequiredforRegularprogramstudentstobeeligibletoenterthesecond-yearfieldcourse.Tobeeligibleforgradua-tionagradeofsatisfactoryintheblockfieldpracticumisrequired.

9. CompletionofatleasttwosemestersinresidencyatMU.Residencyisdefinedasenrollmentofaminimumofninecredithours.Theblockfieldinstructionsemestercountstowardtheresidencyrequirement.

MU Graduate School Graduation Requirements

1. Studentsmustmaintaina3.0GPAthroughouttheirgraduateworktoremainingoodstandingintheGraduateSchoolandtograduate.

2. A Program of Study for the Master’s Degree(M-1form)mustbefiledwiththeGraduateSchoolbeforegraduation.TheformmaybesecuredfromtheMSWsupportstaffpersonortheGraduateSchool.Itrequiresthelistingofallcoursestakenandtransferredtowardthedegreeandthesignatureofthestudent,advisorandMSWProgramDirector.Itisthestudent’sresponsibilitytocompletethisform.

3. The student must meet all other requirements of the University as outlined in the “M”book.

Advisement

Studentadvisementisanimportantpartofthestudent’seducationalexperience.Theadvisorysystemhasthefollowing purposes:

1. Toprovideeachstudentwithafacultymemberwhoknowsthestudent’seducationalinterestsandgoals,his/her particular educational program and who serves as a resource in assisting the student in his/her total educationalexperience;and

2. ToprovidetheSchoolwithaclearchannelthroughwhichtocarryoutcertainadministrativefunctionsinreferencetothespecificstudent.

TherearethreelevelsfortheadvisementsystemattheSchoolofSocialWork:RegularAdvisement,SpecialAdvisement,andStudentStatusReview.

Regular Advisement

StudentsareassignedtheiradvisorsbytheMSWProgramCommitteebeforethestudents’firstregistration.Effortismadetopairstudentsandadvisorsbasedoncareerinterestswhentheyareknown.

21

Students with Advisors who are on 9 month contracts should plan to meet with their advisor before the end of the academicyeartoplanforSpringregistration.StudentmayseekadvicefromtheMSWProgramDirectorwhenissuesofconcernariseduringSummersemester.

Duties and Responsibilities of the Advisor

Theadvisorhasprimaryresponsibilityforhelpingthestudentmakemaximumuseofher/hislearningopportunitiesand,ingeneral,actstoadvancethestudent’sbestinterests.

Specifically,theadvisor:

- consultswiththestudentregardingher/hisshort-termandlong-rangeeducationalgoals.Assiststhestudentinmakingchoicesfromthecourseoptions(e.g.electives,policyelective,diversityelective,clinicalselective)availabletomeethis/hergoals.

- helpsthestudentassessher/hiseducationalneedsandobjectivesregardingthetwofieldplacementswhile considering potential resources;

- isresponsibleforpreparingtheeducationalassessmentofthestudenttoserveastheofficialSchoolreferenceifoneisrequested.NoreferenceorreportisissuedtoanyoneoutsidetheSchoolwithoutthestudent’swrittenpermission.Itisincumbentonthestudenttoseethatsuchwrittenpermissionisreceived by the School;

- initiateaSpecialAdvisementforthestudentifneeded;theadvisorwillchairthemeetingandworkwith the student to implement the recommendations which ensue;

- is available to the student to discuss personal issues as they impinge on the student’s educational experienceandmaymakereferralstovariousUniversityandcommunityresourcesifrequestedtodosobythestudent.

- Thestudentmeetswiththeadvisorwhennecessary.Inordertobuildamentorrelationship,itisrecommended that the student contact the advisor to schedule an appointment at least once every semester.

Change of Advisors

The relationship with an advisor is important to successful completion of the degree; consequently students willbeassignedanadvisoruponentrytotheprogramandtheyshouldtaketheearliestopportunitytomeetwiththeiradvisor.Studentsmaychangeadvisorsuponagreementwiththefacultymemberwhotheywishtohaveasanadvisoranduponfilingform“ApplicationforGraduatechangeofProgram,Degree,EmphasisorAdvisor” which can be found here: http://gradstudies.missouri.edu/forms-downloads/repository/change-degree.pdf.Itisaprofessionalcourtesytoinformthecurrentadvisorofthedesiretomakeachangeinadvising.WhenstudentsselectaConcentrationtheymaywishtochangeadvisorstoafacultymemberwhoteachesinthatarea,ifthishasnotcoincidedwiththeinitialassignment.Studentsingraduatecertificateprogramswillbeassignedtothefacultymemberinchargeofthatprogram.

Special advisement

Purpose

SpecialAdvisementproceduresaredesignatedtoprovideextendedadvisoryresourcesintheinterestofenhancingthestudent’slearningopportunitiesand/orchangingastudent’sprogram.

Special Advisement is advisory to the student and his/her faculty advisor and will not relate to administrative decisionsaboutstudentstatus.

Special Advisement is one of several possible resources of choice available to advisor and student to supplementorreinforcetheregularservicesoftheadvisor.Specialadvisementshouldbeconsideredbytheadvisorandthestudentalongwithotheravailableadvisorysupplements.

22

AnattempttoresolvetheacademicdifficultiesthroughSpecialAdvisementmustoccurbeforeaStudentStatusReviewonacademicgradeperformancecanbecalled.

Inemergencyorexceptionalcircumstances,reportedinwritingbytheadvisororthestudent,theDirectoroftheSchoolmaywaivetherequirementofSpecialAdvisementpriortoStudentStatusReview.

Initiation

Special Advisement is normally initiated by the faculty advisor; it may also be initiated by the student or a facultymember,uponwrittenrequesttotheadvisor,statingthesituationwhichisbelievedtomakespecialadvisementdesirable.

Special advisement procedures may be initiated whenever there are special academic interests and/or difficultiesbelievedtorequireadvisoryservicesotherthanthatavailablefromtheadvisor.

Composition of Special Advisement Committees

A Special Advisement committee will include:

a. Thestudent’sadvisor,whoservesaschair,isresponsibleforawrittenreportofthediscussionandsuggestions made, and shares the recommendations with the student;

b. Facultymember(s)concernedwiththespecialinterestsand/ordifficulties;and

c. Attheoptionofthestudent,anadditionalfacultymemberofthestudent’schoice.

Procedures for Special Advisement

a. Thefacultyadvisorwillarrangeameetingofthecommitteeassoonaspossibleaftertheneedarisesortherequest is made;

b. Thestudentwillbeprovidedanopportunitytomeetwiththecommitteeandparticipateindiscussionwhen appropriate;

c. Theadvisorwillhaveresponsibilityforassessingthesuggestionsandcollaboratingwiththestudentandothersonfollow-upactions.

d. Dependingontheissueofconcern,studentsmaybeplacedonacademicprobationimmediatelyfollowingaspecialadvisementuntilthegoalsoutlinedinthestudent’sactionplanhavebeenmet.

Student Status Review

Preamble

TheSchoolofSocialWorkchargesafacultycommitteewiththeresponsibilityforthestatusreviewofanystudent’s academic performance and progress in the classroom and in the practicum setting which violate expectationsofperformanceappropriateforasocialworkstudent.

Socialworkstudentsareexpectedtoestablishandmaintainprofessionalrelationshipsatalllevels,bothwithinandoutsidetheclassroom(withfaculty,staff,andstudents;withindividualclients,groups,thecommunity,andothers).Thisentails,amongotherthings,adheringtostandardsofacademichonesty;respectingselfandothers;andbeingabletocommunicateinwaysthatarenon-exploitativeofothers.Moreover,socialworkstudentsareexpectedtosubscribetoandabidebythevaluesandstandardsofthesocialworkprofessionasexemplifiedintheNationalAssociationofSocialWorkers(NASW)CodeofEthics.

Thestudentmayappealthefacultycommittee’sdecisiontotheDirectoroftheSchool.Uponreceiptofthe Committee’s decision and the minutes of the hearing, and/or an appeal from the student, the Director willactuponthematterandimplementthedecision.TheDirectorwillcommunicatethisdecisiontothestudentandthefacultycommittee.

23

General Guidelines

The Student Status Review process may be initiated by:

a. the student,

b. the student’s faculty advisor, and/or

c. any faculty member concerned about the student’s status

A faculty member who initiates the review and who serves on the committee shall be temporarily replaced by his/heralternatetothecommitteeandshallnotvoteonthematterbeforethecommittee.

AnyoneinitiatingtheStudentStatusReviewprocessmustmaketherequesttotheChairofthecommittee.Student performance and behavior will be reviewed by the committee in the following circumstances:

a. Studentfailstocorrectdeficitsinhis/heracademicperformanceasstipulatedinpriorSpecialAdvising agreements and/or

b. Facultyexpressconcernoverattitudinal,behavioral,orethicalconsiderationswhichquestionsthestudent’sfitnessfortheprofessionofsocialwork.

The committee will include in its deliberations all available information relating to student performance, including academic performance, attitudinal or ethical considerations, and personal circumstances which affectacademicperformance.Thecommitteemayrecommendoneofthreeactionsonthebasisoffactualevidence:

a. DismissalfromtheSchoolofSocialWork

b. Academic probation

c. Proceed without probation

Dismissal from School

The Student Status Review committee may recommend dismissal from the School for a student

a. whoseacademicclassroomorpracticumperformanceisjudgedtobeunacceptable.ThiscanleadtoacademicprobationordismissalfromtheSchoolofSocialWork

1. Earning a grade of “F” in any course

2. Failuretofinishcourseworkintheclasswherethegradeof“I”wasassignedwithinthegiven timeframe will result in the grade of “I” being converted to a grade of “F”

b. whofailstosatisfyconditionsofprobation.AstudentissubjecttodismissaluponfailuretoraisethecumulativeGPAto3.0bytheendofthesecondprobationarysemester,oratanytimeasemester/termorcumulativeGPAfallsbelow2.0.

c. when his/her academic performance in the classroom or in the practicum setting is inconsistent with the spirit and the letter of the NASW Code of Ethics in situations in which ethical judgment istobeexercisedandprofessionalinterventionorprofessionalconductisplanned.

Initiation Procedures

1. A written request for Student Status Review with supporting material must be made to the Chair of the facultycommittee.Suchrequestmustspecifystudentperformanceand/orconductthatnecessitatereviewofthestudent’sstatus.

2. The Chair of the committee will forward the request and supporting material to members of the committee.Thecommitteewillreviewtherequestanddetermineiftheissuesmeetrequisiteconditionsforstudentstatusreviewwithinten(10)workingdaysfollowingreceiptoftherequest.If

24

the matter falls within the purview of the committee, the committee will set a date for the Student StatusReview.Thenotificationtothestudentwillbeinwritingandwillspecifytheallegeddeficienciesinperformanceand/orconduct;andthedate,timeandlocationofthereview.Thenotificationwillbedeliveredtothestudentbystudentemail,specifyingdeliveryreceiptandreadreceiptrequested.Thenotificationwillalsobesenttothestudent’sadvisor,andtheDirectoroftheSchool.TheStudentStatusReviewmeetingwillbesettoconveneatleastten(10)workingdaysfollowingwrittennotificationtothestudent.Theten(10)workingdaysnotificationprovisionmaybewaivedattherequestofthestudentor,withthestudent’swrittenapproval,atthecommittee’srequest.

3. The person initiating the request for a Student Status Review may request that such review be canceled or discontinued by submitting a written request to the Chair of the Committee giving reasons for the request.Uponreceiptoftherequestforcancellation,theChairoftheCommitteeshallpollmemberstodeterminewhethercancellationisappropriate.Suchrequestwillbemadeasearlyaspractical.

4. ThepersoninitiatingthereviewmustbepresentduringtheStudentStatusReviewprocess.

5. Astudentwillhavetherighttopresentdatawhichchallengestheallegationsnecessitatingthisreview.

6. Astudentmayaskupto3individuals(faculty,staff,orpeerstudents)toaddresstheCommitteeonhis/herbehalf.TheseindividualswillbeinvitedtoattendthemeetingtomaketheircommentsbutwillnotattendthefullStudentStatusReviewsession.

7. Astudentwillbeabletoquestionanyoneparticipatingintheproceedings.

8. The procedure for committee meeting includes the following:

Advisor Role

The role of the advisor in the Student Status Review Committee process is to be an advocate for the student and to monitor compliance with the Student Status Review procedure as delineated in the applicable MSW StudentHandbook.TheadvisorwillattendallmeetingsthatthestudentisrequiredtoattendrelatedtotheStudentStatusReviewprocess.IfthestudentStatusReviewiscalledbythestudent’sadvisor,asubstituteadvisorwillbeappointedtoplaytheroleoftheadvisorintheStudentStatusReviewCommitteeprocess.ThesubstituteadvisormustbeaSchoolofSocialWorkfacultymember.

Hearing Procedure

(a) Call to order

(b)Roll call of participants

(c) VerificationofpresenceofCommitteemembers

(d)Verificationofhearingnotificationtothestudent

(e) Verificationofpresenceofpersonrequestingthereviewofthestudent

(f) Verificationofpresenceofstudent’sacademicadvisor

(g) Verificationofpresenceofstudent’sinvitees(ifstudenthasinvitedotherstoaddressCommitteeonhis/herbehalf)

(h) Verificationofduenoticetostudentofhis/heracademicdifficulties

(i) Disposition of procedural questions, if any

(j) Hearing Statement of the circumstances necessitating this review

(k) Statementbythestudent(ifdesired)

(l) Presentation of School’s evidence

(m)Questionsrelatedtoschoolevidencebystudentoradditionalstatementbythestudent(ifdesired)

(n)Presentation of student evidence

25

(o) QuestionsrelatedtostudentevidencebyStudentStatusReviewCommittee(ifdesired)

(p) Chair’swrittennotificationtostudentofthedateandlocationacopyoftheminutesmaybeobtained

(q) Executivesessiontoreviewfactsanddeterminedecision

(r) TheChairshallmaketheproceduresforthemeetingavailabletoallparticipants.

(s) MinutesoftheStudentStatusReviewproceedingswillbetakenbytheappointedsecretary.Thestudent will be advised in writing, during the student status review process, of the date and locationacopyofminutesmaybeobtained.Itisthestudent’sresponsibilitytoobtainacopyoftheminutes.

(t) Correctionstotheminuteswillbemadewithinsixworkingdaysfromthedateofthehearing.Thestudentwillbegivenacopyoftheminutestosignordelineatedisagreement.

(u) TheChairwillnotifythestudentinwritingoftheCommittee’sdecisionwithinten(10)workingdaysfollowingthehearing.Notificationwillbedeliveredtothestudentbyregisteredmail,specifyingreceiptrequested.

(v) TheChairwillsubmitsignedminutesandtheCommittee’sdecisiontotheDirectorwithinten(10)workingdaysfollowingthehearing.

(w)StudentsmayappealtheCommittee’sdecisiontotheDirectorwithinten(10)workingdaysafterreceivingnotificationofthedecision.Theappealwillbeinwriting.

(x) The Director will act upon the Committee’s decision and/or the student’s appeal and implement his/herdispositionofthematterwithinten(10)workingdaysofthereceiptofthedecisionand/orthestudent’sappeal.

(y) ThestudentmayappealanadversedecisioninthemannerprescribedbytheUniversity.

Follow Up to Student Status Review Committee Meeting

Should a follow up meeting be required to address any requirements related to the student’s probation status, the student, student’s advisor or substitute advisor, and the members of the Student Status Review Committeewillattendthemeeting.Atthefollowupmeeting,thestudentwillprovideanupdateontheactivitiesrequiredbytheStudentStatusReviewCommittee.Allprobationaryrequirementsmustbemetbeforeanyfieldpracticumplanningcanoccurinasubsequentsemester.Ifthestudenthasnotmettherequirementsrelatedtoprobationarystatus,s/hewillbedismissedfromtheprogram.Ifanynewallegationsand/orevidencearereceivedbythecommittee,asecondStudentStatusReviewwillbeheld.

Dismissal Appeal Process

Initiation Procedures

1. The student must notify the MSW Program Director of their intent to appeal a dismissal within two weeksofreceivingnoticeoftheirdismissal.Theletterofappealshouldbetypedandsubmittedtothe MSW Program Director by personal delivery, regular or overnight mail, or as a Word document attachedtoane-mail.Appealswillnotbeacceptedbytelephone.Thisrequestmustprovideevidenceforwhythedismissalshouldbeoverturned.Withinten(10)workingdaysfollowingreceiptofthestudent’s intent to appeal, the MSW Program Director will communicate to the student how the pro-gram-levelappealsprocesswillbeconducted.

2. The MSW Program Director will forward the request and any supporting materials to the student’s ad-visor.Theadvisor,orinher/hisabsencetheMSWProgramDirector,willorganizeanAppealsReviewCommitteetohearthestudent’sappeal.

26

3. The Appeals Review Committee will consist of faculty members who were instructors to the student during the period of concern, the student’s faculty advisor, MSW Program Director, Field Director, if relevant to issues of concern, and one faculty member who will be invited by the student, if s/he so chooses.Thisinviteemayattendthemeetingorsubmitwrittencommentsonthestudent’sbehalf.Adjunctinstructorswhoarenotabletoattendthehearingduetoschedulingconflictsmaysubmitawrittenstatementforreview.

4. TheAppealsReviewCommitteewillsetadateandtimeforanappealhearingwithinten(10)workingdaysofreceiptofthenotificationofappeal.

5. Notificationoftheappealsprocess(see#1)andmeetingdate(see#4)willbedeliveredtothestudentbyemailwithadeliveryreceiptandwillincludethedate,timeandlocationofthereview.Thestu-dent’sresponsetosaidemailisconsideredknowledgeoftheappealhearingdate,timeandplace.Ifthestudentdoesnotrespondtotheemailwith48hoursofdelivery,thehearinginformationwillbesenttothestudent’shomeaddress(asnotedinMyZou)byregisteredmail,specifyingreceiptrequested.ThenotificationwillalsobesenttotheDirectoroftheSchool.

6. TheAppealsReviewCommitteewillmeetassoonasispractical.

7. Thestudentisexpectedtoattendtheappealhearinginperson.Non-attendanceattheappealhearingbythestudentwillresultinthedismissalbeingupheld.

8. At the appeals hearing, the student will have the right to present data which challenges the allegations broughtforwardinthedismissal.

9. The student’s advisor, or in her/his absence the MSW Program Director, will act as Chair at the Appeals ReviewCommitteemeeting.

10. Astudentwillbeabletoaddresstheconcernsofanyonewhoparticipatesintheproceedings.

11. Only university email accounts will be used to electronically distribute information regarding the Ap-pealsReviewCommittee.

12. The procedure for committee meeting includes the following:

Hearing Procedure

(a) Call to order;

(b)Roll call of participants;

(c) TheChairshallmaketheproceduresforthemeetingavailabletoallparticipants;

(d)Disposition of procedural questions, if any;

(e) VerificationofpresenceofCommitteemembers;

(f) Verificationofhearingnotificationtothestudent;

(g) Verificationofpresenceofstudent’sacademicadvisor,ortheMSWProgramDirectorinhis/herabsence;

(h) Verificationofpresenceofstudent’sinvitee(ifstudenthasinvitedafacultymembertoaddressCommitteeonhis/herbehalf)orreceiptoftheirwrittensubmission.

(i) Hearing statement of the circumstances of dismissal

(j) Statementbythestudent(ifdesired)

(k)Presentation of School’s evidence

(l) Additionalstatementbythestudent(ifdesired)

27

(m)Presentation of student evidence

(n) Statementsofinviteespeakingonstudent’sbehalf

(o) TheCommitteewillmeettoreviewfactsanddeterminedecision.Thismeetingwilloccurdirectlyfollowingthemeetingwiththestudent,ifnoadditionalinformationisneededforthedecision.Ifadditional time is needed, the Committeewillmeetassoonaspossibletorenderadecision.ThedecisionoftheAppealsCommitteerequiresamajorityvoteandisfinalandnotsubjecttofur-therreview.

(p)MinutesoftheDismissalAppealReviewproceedingswillbetakenbytheappointedsecretary.Withinfiveworkingdaysfromthedateofthehearing,correctionstotheminuteswillbemadebythe advisor, or the MSW Program Director in her/his absence, and the student will be provided withacopyoftheminutesbyemail.Thestudentwillhave48hoursfollowingthedistributionofminutestonoteanydisagreements/hehaswiththecontentsoftheminutes.

(q) TheChairwillnotifythestudentinwritingoftheCommittee’sdecisionwithinten(10)workingdaysfollowingthehearing.Notificationwillbedeliveredtothestudentbyemailwithadeliveryreceipt.Student’sresponsetosaidemailisconsideredknowledgeofthecommitteedecision.Ifstudentdoesnotrespondtotheemailwith48hoursofdelivery,thedecisionwillbesenttothestudent’shomeaddress(asnotedinMyZou)byregisteredmail,specifyingreceiptrequested.

(r) TheChairwillsubmitminutesandtheCommittee’sdecisiontotheDirectorwithinten(10)work-ingdaysfollowingthehearing.TheChairwillsubmittheCommittee’sdecisiontotheGraduateSchoolwithinten(10)workingdaysfollowingthehearing.

(s) An appeal will be granted if the student demonstrates to the satisfaction of the Dismissal Ap-pealsCommitteethatitismorelikelythannotthathisorherunsatisfactoryacademicperfor-manceistheresultofextraordinaryandnon-reoccurringcircumstancesandisnotrepresenta-tiveofthestudent’sacademicability.Ifanappealisgranted,thestudentwillbereinstatedintheProgramandplacedonacademicprobation.A successful appeal will result in a letter reinstating thestudentintotheMSWProgramanddescribingtheconditionsthatneedtobemet.Ifthesecon-ditionsarenotmet,thestudentwillbedismissedfromtheprogram.

(t) If, however, the appeal is denied, the effective date of the student’s dismissal is the date identifiedintheoriginalletterinformingthestudentthatheorshewasdismissedfromtheMSWProgram.ThestudentwillremaindismissedandcanonlyappealtotheGraduateFacultySenate if he/she believes that, in the course of dismissing the student, the program did not followproperprocedureaccordingtotheGraduateSchool’spublishedrulesandregulations.The Graduate School’s published rules and regulations, as designed by the Graduate Faculty Senate, are available at: http://gradschool.missouri.edu/academics/progress/requests-for-extensions-appeals.php

MU Student Services

Asian Affairs Center

The Asian Affairs Center provides a range of informal and formal discussions, cultural performances, and otherAsia-relatedactivitiesfortheuniversityandgeneralcommunity.Office:N49MemorialUnionPhone:882-6902Website:http://asia.missouri.edu/.

Bookstore (The Mizzou Store)

TheUniversityBookstoreislocatedintheMUStudentCenter.Thisbookstorecarriesallrequiredtextsforsocialworkcoursesplussupplies,gifts,andgraduationregalia.OffCampusStudentsmayordertheirbooksoverthephonebycontactingOrderFulfillmentat1-800-862-5866,oronlineviathebookstore’swebsite(http://www.themizzoustore.com/default.aspx?)andtheywillsendyouyourbooksthroughthemail.

28

Cambio CenterTheCambioCenterfocusesonresearchonLatinosandoutreachtochangingcommunitiesinMissouri.Of-fice:301GentryHall;Phone:882-2978Website:http://www.cambio.missouri.edu/

Campus Computing/Division of Information Technology (DoIT)DoIToperatesanumberofcampuscomputerlabsthatareavailabletoanyMUstudent.TheDivisionofInfor-mationTechnologyoffice;615Locust;Phone:882-5000;Website:http://doit.missouri.edu.

Campus Dining

Avarietyoffoodservicesareavailableacrosscampus.GraduatestudentsmayalsopurchasemealplansthroughtheUniversity.Website:http://dining.missouri.edu.

Career Center

ThecampusCareerPlanningandPlacementCenterisavailabletoallstudents.ItislocatedintheStudentSuccessCenteracrossfromEllisLibraryonLowryMall.TheCareerPlanningandPlacementCenterhelpsstudentschoosemajorfieldsofstudyandcareerpatternsfollowinggraduation.Phone:882-6801;Website:http://career.missouri.edu/.

Cashier’s OfficePaymentonstudentaccounts,financialaidrefundsanddirectdepositservicesareavailableintheCashier’sOfficein15JesseHall.Phone:884-4CASH;Website:http://cashiers.missouri.edu.

Center for leadership development and Community InvolvementTheCenterforLeadershipDevelopmentandCommunityInvolvementislocatedat2500MUStudentCenter.Phone882-8585;Website:http://leadership.missouri.edu/

Counseling

TheCounselingCenterin119ParkerHalloffersstudentshelpincareerdecisionsandresolvingproblemsofapersonalnature.Phone882-6601;Website:http://counseling.missouri.edu/.

Disability Center

Equaleducationalopportunitiesareavailabletoallacademicallyqualifiedstudents.Mostbuildingsoncampusareaccessibleforstudentswithphysicaldisabilities.Anumberofcampusservicesareprovidedtostudentswithdisabilities.Forinformationconcerningservicesforaparticularneed,contacttheDisabilityServicesOffice,S5MemorialUnion.Phone:882-4696;Website:http://disabilityservices.missouri.edu/.

E-MailAllstudentsattheUniversityofMissouriareassignedastudente-mailaccount.E-mailisusedextensivelybytheSchoolofSocialWorkasaprimarycommunicationtool,thereforeallnewstudentsarerequiredtousetheMUE-mailsystem.NewstudentscanlearntheirE-mailaddressandlogontotheMUE-mailsys-tem though http://webmail.mizzou.edu.TheDivisionofInformationTechnology(DoIT)Helpdeskcanbereachedat882-5000.

Once accepted into the MSW program, faculty and staff will not email students at any address other than yourMizzoustudentemail.ThisisinaccordancewiththeFacultyCouncil Policy(http://facultycouncil.missouri.edu/handbook/article-11.html)whichstates:

“Atthebeginningofeachterm,studentsmustprovidetheOfficeoftheRegistrarwiththeircurrentlocalandpermanenthomeaddresses.Theymustkeepthatofficeinformedofanychange(s)ineitheraddress.TheUniversitywillalsoissueofficialelectronicmailaccountstoallincomingstudents. ForanyofficialmailingsthelatestpostaladdressorUniversityelectronicmailaddresswillbeused,therebyfulfillingtheUniversi-ty’sobligationofnotification.(updated6-27-01)”

29

Financial AidTheUniversityofMissouriFinancialAidofficeislocatedin11JesseHall.GraduateStudentswhowishtoqualifyforUniversity-administeredfinancialaid(loans)shouldfiletheFreeApplicationforFederalStudentAid(FASFA)eachyear.Financialaidadvisorsareassignedtoeachstudentbasedonthefirstletteroftheirlastname.Phone:882-7506;Website:http://sfa.missouri.edu/.

Gaines Oldham Black Culture CenterTheGainesOldhamBlackCultureCenterstrivestobeahavenforstudentsyearningforadeeperapprecia-tionofBlackCultureandoffersprogramming,support,andresourcesforstudents,staff,andfaculty.Office:813VirginiaAvenue;Phone:882-2664Website:http://bcc.missouri.edu/.

Office of Graduate StudiesTheUniversityofMissouri-ColumbiaOfficeofGraduateStudiesislocatedin210JesseHall.Phone:882-6311;Website:http://gradstudies.missouri.edu/

Graduate Student OrganizationsAllgraduatestudentsareeligibletoparticipateinthemanystudentorganizationsoperatedbytheMUGraduateSchoolincluding:GraduateStudentAssociations(GSA),theGraduateProfessionalCouncil(GPC),theAssociationofBlackGraduateandProfessionalStudents(ABGPS),theNationalAssociationofGradu-ate-ProfessionalStudentsandtheAssociationforSupportofGraduateStudents.MoreinformationabouteachoftheseorganizationscanbefoundontheGraduateSchoolwebsiteat:http://gradschool.missouri.edu/resources/grad-postdoc-networks.php

Identification CardNewMUStudentIDcardscanbeobtainedinTheIDCenter,locatedattheMizzouStoreintheStudentCenter.Toobtainyourfirstcard,simplypresentdocumentationofyourstudentstatus(i.e.acceptanceletterorclassschedule)withyourstudentnumberandaphotoid(validdriver’slicense,passport,etc.)totheIDCenterStaff.IDcardsareprintedon-sitewhileyouwait.QuestionsconcerningtheuseorreplacementoftheIDcardshouldbedirectedto882-1871.Off-campus and Online students can request a student ID here: http://online.missouri.edu/studentresources/resources/id-card.aspx

International CenterTheInternationalCenter’sStudentandScholarSupportServices(ISSS)provideavarietyofsupportser-vicestoallgraduate,internationalstudentsatMU.TheStudyAbroadofficecoordinatesawide-rangeofinternationalstudyopportunitiesthatmaybeappropriateforgraduatestudents.Office:N52MemorialUnion; Website: http://international.missouri.edu/come-to-mu/.

LGBTQ Resource CenterTheLGBTQResourceCenterprovidesprogramming,leadershipopportunities,andresourcesforstudents,staff, faculty, and community members in an effort to ensure a safe, welcoming and inclusive MU communi-ty.Office:N215BradyCommons;Phone:884-7750Website:http://lgbt.missouri.edu/

LibrarySocialWorkholdingsarelocatedinthemainlibraryofMU,EllisLibrary,whichislocatedonLowryMallacrossfromtheMcDonald’s,justwestoftheMemorialUnionbuilding.Libraryhoursvarywiththedayoftheweekandvacationschedules.Acopyofthelibraryscheduleisavailableatthecheck-outdeskonthefirstfloor.Eachstudentshouldobtainoneoftheseandkeepitpostedinhis/hernotebookforeasyrefer-ence.Phone:882-4701;Website:http://mulibraries.missouri.edu/

Multicultural CenterTheMulticulturalCenterislocatedatG107MUStudentCenter.Phone:882-7152;Website:http://multi-culturalcenter.missouri.edu/

30

Office of Service LearningTheOfficeofServiceLearningislocatedat208LowryHall.Phone:882-0227;Website:http://servelearn.missouri.edu/

ParentingParentLink,sponsoredbyUniversityExtensionprovidesresearch-basedinformationtoparentingques-tionsthroughtheirtoll-free“warmline”.Phone:1-800-552-8522;Website:http://outreach.missouri.edu/parentlink/.

Parking & TransportationParkingandTransportationServicesislocatedinthesecondleveloftheTurnerAvenueParkingGarage.Studentsmayapplyforparkingpermitsatthislocation.Phone:882-4568;Website:http://parking.mis-souri.edu

Police Department

ThecampuspoliceofficeislocatedVirginiaAvenueParkingGarage,901VirginiaAvenue.Phone:882-7201;Website: www.mupolice.com.MUPoliceofferRAD,aselfdefenseclassdesignedforwomen;Website:http://www.mupolice.com/rad/

Relationship & Sexual Violence Prevention Center

TheRelationshipandSexualViolencePrevention(RSVP)Center(formerlytheRapeEducationOffice)isacomprehensiverelationshipandsexualviolenceeducationandresourceservice,whichisanauxiliaryofMSA/GPCincollaborationwiththeMUWomen’sCenter.Thisresourcecenterisdrivenbytheworkoffourdedicatedstudentorganizations:theRSVPPeerEducators,theGreekAdvocates,STARS(StrongerTogetherAgainstRelationshipandSexualViolence),andMARS(MenAgainstRelationship&SexualViolence). Office:G216MUStudentCenter;Phone:882-6636Website:http://rsvp.missouri.edu/

Student Health

TheStudentHealthCenter,locatedonSouthSixthStreet,providessomehealthservicesandreferralsforallstudents.InformationaboutpurchasingStudentHealthInsuranceisalsoavailable.Phone882-7481;Website:http://studenthealth.missouri.edu/

Student Legal ServicesAvarietyoffreelegalservicesareavailabletoMUstudentsfromtheStudentLegalServicesofficein2500MUStudentCenter.Phone:882-8386;Website:http://sls.missouri.edu/

Student Recreation Center Indoor and outdoor facilities are available as well as competitive, non-competitive, structured and unstruc-turedsportsactivities.PresentavalidstudentIDcardforaccess.Phone:882-2067;Website:http://www.mizzourec.com/

The Learning Center Graduate Writing ServicesTheMULearningCenter&StudentSuccessCenterprovidesavarietyoftutoringservicesinperson&on-line.Call882-2493forappointmentsorinformation.Website:http://success.missouri.edu/tlc.html

University Housing/Residential Life TheResidentialLifeDepartmentofferscampushousingforgraduateandprofessionalstudents.Phone:882-4568;Website:http://reslife.missouri.edu/.

31

Wellness Resource CenterTheWellnessResourceCenterislocatedatG202MUStudentCenter.Phone:882-4634;Website:http://wellness.missouri.edu/contact.html

Women’s CenterTheWomen’sCenterprovidesprogramming(interactivediscussions,workshops,weeklygroups,outreachprograms),leadershipopportunities,andresourcesforstudents,staff,faculty,andcommunitymembers.Office:G108MUStudentCenter;Phone:882-6621Website: http://womenscenter.missouri.edu/

School of Social Work contacts

Staff Contacts

For the most up to date staff contact information, please visit http://ssw.missouri.edu/staff.html.

Faculty ProfilesForthemostuptodateinformationaboutfaculty,pleasevisitthefacultyprofilepageathttp://ssw.missou-ri.edu/profiles.html.

School of Social Work Student Services

Computer Lab

TheMUSchoolofSocialWorkoffersacomputerlabforsocialworkstudents.Thelabislocated733ClarkHall.Labhoursare8:00a.m.to5:00p.m.MondaythroughFriday.PleasecalltheDoITHelpDeskwithanycomputingissues:882-5000;Website:http://doit.missouri.edu/sites/

Conferences and WorkshopsConferencesandworkshopsofinteresttosocialworkstudentsarepostedonabulletinboardoutsideof737ClarkHall.

Free Meeting Space for Social Work studentsBelowisalistoffreemeetingspacesonandoff-campusforsmallgroup,studentmeetings.

On Campus:• Theareaoutsideof531ClarkHall.• ClarkHallRooms:737(20-25people),717(10-12people);531(20people);509(15-20people)M-F

8-6:Call884-8795orgotoClark724toreserve;• EllisLibrary:Mainfloorstudyrooms(6-8people);3rdFloorClassrooms(10-20people)Availablebased

onlibrary’shours:Call882-4581orgotoReferencedesk;• GwynnHall:ConferenceRoom;Lounge.M-F8-5;extendedhoursavailable.CallD.Ellison,884-9081

(GwynnHallunderconstructionforFall2012);• HealthSciencesLibrary:3rdFloorClassrooms(10-20people);M-F8-5:Call882-4153;• HealthSciencesLibrary:Smallmediaviewingrooms(~4people?);M-F8-5:Noreservationsneeded;

prioritizedformediaviewing.• LifeSciencesBuildingRooms:001;102;104.M-F7:30-6:00,Sat.10-12.884-1782orgotoroom105.• MemorialUnionNorth:Studyroombyreservationdesk(9people).M-F7am-8pm,Sat.andSun.9am-

8pm:Noreservationsneeded.• NewmanCenter(CatholicStudentCenter):2ndfloorclassrooms.M-F,someweekends,8am–11pm.No

reservations.Roomsareavailableifnotinuse—busytimesareWednesdaynightsandSundaymorn-ings.

• StudentSuccessCenter:Roomsizesvary.M-F8-5.Sometimesopenlaterthan5:00.Call882-6803toreserve.

32

• StudentCenterStudyRooms(1st and 2ndFloors):Roomsvaryinsize.Mon-Sun7:00am–midnight.http://unions.missouri.edu/mrbs/week.php?year=2012&month=6&day=28&area=1&room=3

• Other Campus buildings: Online reservations http://mubsweb.missouri.edu/html/room/reserve.cfm.Applicationapprovalmustbegrantedbyeachbuilding’scoordinator.

Off Campus• BooneCountyHistoricalSocietyMuseum:443-8936;3801PonderosaSt.Tues-Fri12-4,

Sat-Sun1-5:Libraryisopenforstudying;walk-inswelcome.• BooneElectricCooperative449-4181;1413RangelineSt.Flexiblehours.Callforareservation.• ColumbiaPublicLibrary443-3161;100W.Broadway.StudyRooms(4people;3roomsforlargerstudy

groupsalso);9-9M-F,9-5Sat,1-5Sun.Filloutapplicationatlibraryforlargerroomreservations;Walk-inuseokayforsmallerrooms.

• TigerColumns875-8888;23S.EighthSt.Largeseminarrooms;calltoinquire;donotdropin.

Job OpeningsJobopportunitiesforprofessionalsocialworkersareposted:

• OntheSchoolofSocialWorkElectronicBulletinBoardat:http://ssw.missouri.edu/career.shtml.• As messages to the MSW-L Listserv • OntheJobsbulletinboardlocatedoutsideof706ClarkHall

School of Social Work Student Groups

Council of Student Social Workers (CSSW)isanorganizationopentoallstudentsintheSchoolofSo-cialWork.ActivitiesaredeterminedbytheCouncileachacademicyearandmayincludecommunityserviceprograms, social gatherings, fundraising to support scholarships and attendance at professional meetings, aswellasvariousspecialactivities.MeetingsandactivitiesforthesemesterwillbepostedonthestudentMSW-Llistserv.Formoreinformation,contacttheStudentServicesCoordinatorortheCSSWbulletinboardoutsideof703Clark.

MU Association of Christian Social Work Students (MUACSWS)MUACSWS supports the integration of Christian faith and professional social workeducationandpracticeinthelivesofitsmembers,influencingtheprofessionandthechurch,promot-ingloveandjusticeinsocialserviceandsocialreform.MeetingsareheldWednesdaymorningsat9:30a.m.

Phi Alpha Honor Societyisanationalsocialworkhonorary.Membershipisbyinvitationonlyandisamongthehighesthonorsasocialworkstudentcanreceive.InvitationstojointheChiDeltaChapterofPhiAlphaareextendedatthebeginningofeachsemestertothosestudentswhoattainexcellenceinsocialworkeducationandintheircumulativeacademichistory.

Eligibilityrequirementsinclude:a)statusasa*full-timestudentintheMU-MSWprogram;b)aBorhigh-erinallsocialworkcourses;c)acumulativeGPAof3.75inallsocialworkcourses.StudentswhojoinPhiAlphaenjoylifetimemembershipintheHonorSociety.ChiDeltaPhiAlphamemberswhomaintainactivemembership(byservicehoursandparticipationinChapterevents)areeligibletoreceiveandwearthedis-tinguishedPhiAlphamedallionatgraduation.Formoreinformation,contacttheStudentServicesCoordi-natororthePhiAlphabulletinboardoutsideof703Clark.

*Part-timestudentswhohavecompletedthefirstyearofcoursesandwhomeettheGPArequirementcanbeinvitedformembership.AdvancedStandingstudentwhoarePhiAlphamembersfromotherchaptersshouldnotifytheStudentServicesCoordinatortoreceiveinformationabouttheChiDeltachapteractivities.

33

School of Social Work Web SiteStudents can access the School’s web site online at ssw.missouri.edu. Information about the School and instructors,aSchoolcalendarofevents,andcurrentannouncementsareposted.IntheFieldsection,studentscansearchforpossiblefieldpracticumsites.JobopeningsandcommunicationwithotherstudentsandalumnicanbeaccessedontheElectronicBulletinBoard.

Student Listserv: MSW-LTheSchoolofSocialWorkhostslistservesforallMU-MSWstudents.ThislistservesarefrequentlyusedbytheSchooltoalertstudentstoimportantdatesandinformationrelevanttotheireducation.TheyarealsousedtofacilitatecommunicationbetweenandamongstudentsintheSchoolofSocialWork.

MU MSW students are automatically subscribed to their regional list-serve from their MU student e-mail ac-countuponregistrationintheSchoolofSocialWork.ThissubscriptionwillautomaticallyendupongraduationfromMU.

List-serve Address:Columbia Campus MSW students: msw-l@po.missouri.edu

AsamemberoftheSSWlist-serve,studentsmaysendmessagestoallothersubscribers.Topostamessagetotheentirelist,typetheaddressaboveintheTOboxofthenewe-mailmessage.Whenyouhit“Send”,yourmessagewillbesenttoallMSW-Lsubscribers.

Currentlist-servememberscanmakechangestotheirsubscription,subscribetoadditionallists,ordeletesubscriptions from the MU LISTSERV website at: https://po.missouri.edu/cgi-bin/wa.Simplylog-inwithyoursubscriptione-mailaddressandclickonSubscriber’sCorner.

Financial Aid

School of Social Work (SSW) Scholarships

The School grants, to full time students, several scholarships awarded primarily on the basis of academic meritandfinancialneedasdeterminedbytheFreeApplicationforFederalStudentAid(FAFSA).StudentsinterestedinScholarshipsshouldre-applyeachsemester(Sept15forSpringsemesterscholarships&Jan15forSummerand/orFallsemesterscholarships).StudentsmustcompleteaFAFSAtobeconsideredforscholarshipsthatrequirefinancialneed.

Scholarshipawardsareofvaryingamounts.Somescholarshipsarespecificallyforstudentswithspecificcareeraspirations,e.g.workinginruralcommunities,mentalhealthpracticeorresearch/practicewiththegay&lesbianpopulation.Seehttp://ssw.missouri.edu/finaid.shtml#scholar for the entire list of available scholarships.

The Scholarship Application form is located in the Forms section of this manual and can be downloaded from the SSW website: http://ssw.missouri.edu/docs/msw_scholarship_app.pdf

Student Loans

GraduatestudentsmaybeeligibleforfinancialaidintheformofloansthroughprogramsadministeredbytheUniversity.StudentsshouldapplyattheStudentFinancialAidoffice,11JesseHallandfiletheFreeApplicationFederalStudentAid(FAFSA)formeachyeartheyareinschool.Website:http://financialaid.missouri.edu/types-of-aid/loans/index.php

SSW Assistantships Dependingonexternalfunding,alimitednumberofresearch,teaching,orgraduateassistantshipsmay be availablethroughtheSchoolofSocialWorkformaster’slevelsstudents.ResearchAssistantsworkclose-

34

lywithanassignedfacultypersononcurrentresearchprojects.Thisisanexcellentwaytoparticipateinadvancedresearchaffectingthefieldofsocialwork.Assistantshipsprovideamonthlystipendandattimestuition waiver but, alwaysrequireaworkcommitment.

WhenanassistantshipisavailableintheSSW,studentsarenotifiedthroughtheMSWstudentlistserv.Toapplyforconsideration,fillouttheapplicationthatisprovidedintheemail.

Westronglyencouragestudentswithfinancialneedtoresearchandapplyforassistantshipsinotherareasoftheuniversity.PleaserefertotheGraduateSchoolwebsiteforbasicinformationaboutassistantshipshttp://gradschool.missouri.edu/financials/assistantships-fellowships/index.php and to the following website for open positions: http://hiremizzoutigers.com/.MSW students who have acquired assistantships outsidetheSchoolhaveoftenfoundthemtobeveryrewardingexperience.Sometimestheworkisdirectlyrelatedtotheirsocialworkstudies.PleaseinformtheMSWStudentSupportSpecialistifyouarechosenforsuchanassistantship.Wearecollectinginformationabouttheseopportunitiessothatwecanhelpfuturestudentslocatefinancialsupport.

Graduate School Fellowships

TheMUGraduateSchooloffersseveralfellowshipopportunities;includingfellowshipsspecificallyformi-noritystudents.Formoreinformationonfellowships,contacttheGraduateSchool,210JesseHall;Website:http://gradschool.missouri.edu/financials/assistantships-fellowships/index.php

Field Placement-Related Financial Assistance

Veryrarely,apaidblockfieldpracticumisanothersourceoffinancialassistancetostudents.Studentsshould notify the Director of Field Education during the regular planning period for the course if they antic-ipatetheneedforagency-paidstipendsinthefield.

Field Placement In Employment Setting

StudentswhowishtoexplorethepossibilityofusingtheirplaceofpaidemploymentasafieldpracticumassignmentmustsubmittheirwrittenrequesttotheDirectorofFieldEducation.IndividualrequestswillbecarefullyreviewedwithinthestandardsandexpectationsoutlinedbytheSchool.PleaseseetheFieldManualforadditionalinformation.

Code of Conduct

Student responsibility to know academic regulations Itiseachgraduatestudent’sresponsibilitytoknowandobserveallregulationsandproceduresrelatingtotheprogramthestudentispursuing.Innocasewillaregulationbewaivedoranexceptionbegrantedbecause students plead ignorance of, or contend that they were not informed of, the regulations and pro-cedures.Responsibilityforfollowingallpoliciesandmeetingallrequirementsanddeadlinesforgraduateprogramsrestswiththestudent.

Academic Dishonesty TheSchoolofSocialWorkstrictlyadherestotheUniversity’spolicyonAcademicDishonesty.Studentsshould become very familiar with this policy and if they have any questions about it should address them totheiradvisor.FailuretocomplywiththepolicycanleadtosuspensionandpossiblyexpulsionfromtheUniversity.Thepolicyisasfollows:Academichonesty,suchascheatingandplagiarism,isabasisfordisci-plinaryaction.Inallcasesofacademicdishonesty,thefacultymembermakesanacademicjudgmentabout

35

thestudent’sgradeonthatworkandinthatcourseandreportsallincidentstotheprovostfordisciplinaryaction.

Discrimination Grievance Procedure (390.010Bd.Min.12-17-82,Bd.Min.1-25-90,AmendedBd.Min.10-16-03,AmendedBd.Min.11-29-07,AmendedBd.Min.6-19-14.AmendedBd.Min.2-5-15).

390.010DiscriminationGrievanceProcedureforStudents

Sexual Harassment Policy

(600.020CollectedRulesandRegulationsoftheUniversity,ExecutiveOrder40,4-8-14;Revised6-19-14;Revised9-22-14byExecutiveOrder41).

600.020SexDiscrimination,SexualHarassmentandSexualMisconductinEducation/EmploymentPolicy

NASW Code of Ethics

TheSchoolsupportsfullytheCodeofEthicsoftheNationalAssociationofSocialWorkersanditisex-pectedthatallfull-andpart-timestudentsandfacultyabidebyitsprovisions.PleaseseethefollowingwebsitetoreviewtheCodeofEthics.http://www.naswdc.org/pubs/code/code.asp

36

MU Statement of ValuesThe University of Missouri, as the state’s major land-grant university, honors the public trust placed in it and accepts the associated ac-countabilitytothepeopleofMissouriforitsstewardshipofthattrust.Ourdutyistoacquire,create,transmit,andpreserveknowledge,andtopromoteunderstanding.

We the students, faculty, and staff of MU hold the following values to bethefoundationofouridentityasacommunity.Wepledgeour-selves to act, in the totality of our life together, in accord with these values.

RespectRespect for one’s self and for others is the foundation of honor and thebasisofintegrity.Ahallmarkofourcommunityisrespect—fortheprocessbywhichweseektruthsandforthosewhoengageinthatprocess.Suchrespectisessentialfornurturingthefreeandopendiscourse,exploration,andcreativeexpressionthatcharacterizeauniversity.Respectresultsindedicationtoindividualaswellascol-lectiveexpressionsoftruthandhonesty.Respectisdemonstratedbya commitment to act ethically, to welcome difference, and to engage in openexchangeaboutbothideasanddecisions.

ResponsibilityAsenseofresponsibilityrequirescarefulreflectiononone’smoralobligations.Beingresponsibleimposesthedutyonusandouruniver-sitytomakedecisionsbyacknowledgingthecontextandconsideringconsequences,bothintendedandunintended,ofanycourseofaction.Being responsible requires us to be thoughtful stewards of resourc-es—accountabletoourselves,eachother,andthepublicsweserve.

DiscoveryLearningrequirestrustintheprocessofdiscovery.Discoveryoftenfracturesexistingworldviewsandrequiresacceptanceofuncertaintyandambiguity.Therefore,theuniversitymustsupportallitsmembersinthislife-longprocessthatisbothchallengingandrewarding.Asweseekgreaterunderstandingandwisdom,wealsorecognizethatknowledgeitselfhasboundaries—whatweknowisnotallthatis.

ExcellenceWeaspiretoanexcellencewhichisapproachedthroughdiligentef-fort,bothindividualandcollective.Pursuingexcellencemeansbeingsatisfiedwithnolessthanthehighestgoalswecanenvision.Pursuingexcellenceinvolvesbeinginformedbyregional,national,andglobalstandards,aswellasourpersonalexpectations.Werecognizeandacceptthesacrifices,risks,andresponsibilitiesinvolvedinpursuingexcellence,andsowecelebrateeachother’ssuccesses.Wecommitourselvestothisprocessinanethicalandmoralmanner.

These statements are mere words until we integrate them as values in ourindividuallivesandreflecttheminourinstitutionalpoliciesandpractices.Wepledgeourselvestomakethemeffectiveintheveryfab-ric of our lives, our community, and all our relationships with others, thereby enhancing the development of individuals and the well-being ofsociety.

The School’s Unique Mission

Vision: Leadership for social and economic justice

ThemissionoftheMUSchoolofSocialWorkistopromoteleadershipfor social and economic justice by preparing students for professional excellenceandleadershipinpractice,research,andpolicy.Withinthecontextofalandgrantinstitution,themissionoftheSchoolofSocialWorkreflectstheUniversityofMissouri’stightlyinterlockedmissionsofteaching,research,outreach,andeconomicdevelopment.

Inaworldofsufficientresources,socialandeconomicjusticemandatesminimalstandardsofeconomicandpoliticalequity.Thismeansthatnohuman being should die of hunger; be without access to adequate health care,bewithoutsafeandaffordablehousingoradequateclothing;lackaccesstoemployment;orbedeniedequalopportunityforeducation.Additionally, all human beings should be protected against violence in any form and discrimination on any basis, including but not limited to age, culture, class, ethnicity, disability, gender, national origin, race, reli-gion,and/orsexualorientation.Socialworkershaveaprofessional,eth-ical,andmoralobligationtousetheirskillsandknowledgetochallengesocialinequities.Socialworkersmustbeleadersinestablishingjustand caring communities wherein all members possess basic economic, social,andpsychologicalgoods.

TheMUSchoolofSocialWorkteachesstudentstounderstandandevaluate the gaps between current conditions and a more just and caring society.WhiletheUniversityofMissouri’slandgrantmissionandtheSchool’s commitment is to publicly funded and administered entities as a means of addressing the needs of poor and oppressed populations, the MUSchoolofSocialWorkalsorecognizesthegrowingimportanceoftheprivatesectorinthisregard.Tothisend,theSchooleducatesBSW,MSWandPhDsocialworkpractitionerstofacilitatechangebyempoweringin-dividuals,families,groups,organizations,andcommunities.Inaddition,theSchoolpreparesPhDsocialworkerstoestablishteaching,research,and professional practices that are grounded in the principles of social andeconomicjustice.

I have read & understand that these are the expectations of the School of Social work and the social work profession.

_________________________________________________________Print Name

_________________________________________________________Signature Date

37

Registration Checklist

1. Meetwithyouradvisoratleastonceasemester.A. Remember that all course are not available each semester and that certain courses serve as foundation/

pre-requisitestoadvancedcourses.

B. RefertoyourcopyoftheMSWSchedule(schedulesarelocatedinthismanual)andmapoutaplanofstudyforyourgraduatecareerwithyouradvisor.

C. Discusselectiveoptionswithyouradvisorandaplanforhowtheywillfitintoyourschedule.

D. CheckoffeachcompletedcoursefromyourMSWScheduleandensurethatyouareontrackforyourintendedgraduationtime.

2. Registerforcourses.Youmayregisterfortheupcomingsemester’scoursesduringdesignatedregistrationperiodsonly.RefertotheUniversityCalendarofimportantdateslocatedinthismanualortheMUScheduleofCoursesdocumentontheMUwebsite(https://myzou.missouri.edu/psp/prd/?cmd=login)forEarlyandRegularRegistrationdates.

3. During Registration times, you may register computer https://myzou.missouri.edu/psp/prd/?cmd=login (MyZou)

4. Items needed for Registration:A. Your PawprintB. Your PasswordC. TheClassnumberandLecturenumberofcoursesyouwishtoenrollin,(e.g.SW7730Lec2)Lookforan

e-mailonMSW-Lforalistingofrequiredclassesandclassnumbers.

5. Arrangeforpaymentoftuitionandfees.

6. Assistance with registration is available from your advisor or the Student Support Specialist, Crystal Null (nullc@missouri.edu)ifneeded.

38

____________________________________________________________________________Sample Plan of Study - Masters of Social Work Program

Advanced Standing, Full-Time – Columbia (39 credit hours) Spring StartSchedule At-A-Glance (All plans of Study are subject to change)

First Year = 12 credits total Spring (First Year) Total: 12 credit hours 7952ResearchDesigninSocialWork (3)7820DSMVPsychopathology (3)7780FundamentalsofSocialWorkAdministration (3)

Plus, Choose Clinical or PP&A Practice course:

Clinical:7770StrategiesofClinicalSocialWorkInterventions (3)

OR

Policy, Planning & Administration:7920AdvancedFoundationsofHumanBehaviorforAdministrators (3)

Second Year = 30 credits totalFall (Second Year) Total: 12 credit hours --- Elective (3) ---Elective (3) 8953EvaluativeResearch (3) Plus the following Practice course from your chosen Concentration - Clinical or Policy or Planning & Administration:

Clinical:--- ClinicalSelective(TBA) (3)

OR

Policy, Planning & Administration: 8350ManagementofaSocialAgency (3)

Spring (Second Year) Total: 15 credit hours 8971GraduateFieldPracticumII (12)8970ProfessionalPracticeSeminar (3)

39

Sample Plan of Study - Masters of Social Work ProgramAdvanced Standing, Part-Time - Columbia (39 credit hours) Spring StartSchedule At-A-Glance (All plans of Study are subject to change)

First Year=18 credits total

Spring (First Year) Total: 6 credit hours 7780FundamentalsofSocialWorkAdministration (3)

Plus the following course from your chosen Concentration - Clinical or PP & A:

Clinical: 7770StrategiesofClinicalSocialWorkInterventions (3)OR

Policy, Planning and Administration: 7920FoundationsofHumanBehavior-PPA (3)

Summer (First Year) Total: 6 credit hours 7820DSMVPsychopathology (3)7952ResearchDesigninSocialWork (3) Fall (First Year) Total: 6 credit hours 8953EvaluativeResearch (3)

Plus the following courses from your chosen Concentration - Clinical or PP & A:

Clinical:____ClinicalSelective(TBA) (3)

OR

Policy, Planning & Administration: 8350ManagementofaSocialAgency (3)

Second Year=21 credits total

Spring (Second Year) Total: 6 credit hours____Elective (3)____Elective (3)

40

Summer (Third Year) Total: 6 credit hours8971GraduateFieldPracticumII (3)8970ProfessionalPracticeSeminar (3)

Fall (Third Year) Total: 9 credit hours 8971 Graduate Field Practicum II (9)

41

Sample Plan of Study - Masters of Social Work ProgramRegular Standing, Full-Time - Columbia (60 credit hours) Fall StartSchedule At-A-Glance (All plans of Study are subject to change)

First Year = 30 credits total

Fall (First Year) Total: 15 credit hours 7000ProfessionalSocialWorkPractice (1)7710SocialPolicy&ServiceDeliveryinSocialWork (3) 7720FoundationsofHumanBehavior (3) 7730SocialWorkSkills (3) 7740LargeGroupTheory (2)7952ResearchDesigninSocialWork (3) Spring (First Year) Total: 15 credit hours 7971GraduateFieldPracticumI (4) 7760SocialJusticeSeminar (2)7820DSMVPsychopathology (3)7780FundamentalsofSocialWorkAdministration (3)

Plus the following courses from your chosen Concentration - Clinical or PP & A:

Clinical:7770StrategiesofClinicalSocialWorkInterventions (3)

OR

Policy, Planning & Administration7920AdvancedFoundationsofHumanBehaviorforAdministrators (3)

Second Year = 30 credits total

Fall (Second Year) Total: 15 credit hours ---Elective (3) ---Elective (3) ---Elective (3) 8953EvaluativeResearch (3)

Plus the following Practice course from your chosen Concentration - Clinical or PP& A:

Clinical:--- ClinicalSelective (3)

OR

42

Policy, Planning & Administration: 8350ManagementofaSocialAgency (3)

Spring (Second Year) Total: 15 credit hours 8971GraduateFieldPracticumII (12) 8970ProfessionalPracticeSeminar (3)

43

____________________________________________________________________________________Sample Plan of Study - Masters of Social Work ProgramRegular Standing, Part-Time – Columbia (60 credit hours) Fall startSchedule At-A-Glance (All plans of Study are subject to change)

First Year = 18 credits total

Fall (First Year) _____________Total: 7 credit hours7000ProfessionalSocialWorkPractice (1)7720FoundationsofHumanBehavior (3)7730SocialWorkSkills (3)

Spring (First Year) _____________Total: 5 credit hours7710SocialPolicy&ServiceDeliveryinSocialWork (3)7740LargeGroupTheory (2) Summer (First Year) ____________Total: 6 credit hours7820DSMVPsychopathology (3)____Elective (3)

Second Year=21 credits totalFall (Second Year) ____________Total: 9 credit hours7952ResearchDesigninSocialWork (3)____Elective (3)____Elective (3)

Spring (Second Year) ___________Total: 6 credit hours7780FundamentalsofSocialWorkAdministration (3)

Plus the following course from your chosen Concentration - Clinical or PP & A:Clinical:7770StrategiesofClinicalSocialWorkInterventions (3) OR

Policy, Planning & Admin�7920FoundationsofHumanBehavior-PPA (3)

Summer (Second Year) ___________Total: 6 credit hours7760SocialJusticeSeminar (2)7971GraduateFieldPracticumI (4)

44

Third Year= 21 credits total

Fall (Third Year) ________Total: 6 credit hours8953EvaluativeResearch (3)

Plus the following course from your chosen Concentration - Clinical or PP & A:

Clinical:____ClinicalSelective(TBA) (3)

OR

Policy, Planning & Admin� 8350ManagementofaSocialAgency (3)

Spring (Third Year) Total: 15 credit hours8971GraduateFieldPracticumII (12)8970ProfessionalPracticeSeminar (3)

45

____________________________________________________________________________________Sample Plan of Study - Masters of Social Work ProgramAdvanced Standing, Part-Time – Online (39 credit hours) Fall startSchedule At-A-Glance (All plans of Study are subject to change)

First Year= 18 credits total

Fall (First Year) Total: 6 credit hours____Elective (3)____Elective (3) Spring (First Year) Total: 6 credit hours7780FundamentalsofSWAdministration (3)

Plus the following courses from your chosen concentration – Clinical or PP&A

Clinical:7770StrategiesofClinicalSocialWorkInterventions (3)or7820DSMVPsychopathology (3)

OR

Policy, Planning & Administration: 7920FoundationsofHumanBehaviorPPA (3)

Summer (First Year) Total: 6 credit hours7952ResearchDesigninSocialWork (3)

Plus the following course from your chosen concentration – Clinical or PP&A

Clinical:7770StrategiesofClinicalSocialWorkInterventions (3)or7820DSMVPsychopathology (3)

OR

Policy, Planning & Administration: 7820DSMVPsychopathology (3)

46

Second Year= 21 credits total

Fall (Second Year) Total: 6 credit hours8953EvaluativeResearch (3)

Plus the following Practice course from your chosen Concentration - Clinical or PP& A:

Clinical:--- ClinicalSelective (3)

OR

Policy, Planning & Administration: 8350ManagementofaSocialAgency (3) Spring (Second Year) Total: 9 credit hours8970IntegrativeProfessionalPracticeSeminar (3)8971GraduateFieldPracticumII (6)

Summer (Second Year) Total: 6 credit hours8971GraduateFieldPracticumII (6)

47

____________________________________________________________________________

Sample Plan of Study-Masters of Social Work Program

Regular Standing, Part Time – Online (60 credit hours) Fall startSchedule At-A-Glance (All plans of Study are subject to change)

First Year=18 credits total

Fall (First Year) Total: 7 credit hours 7000ProfessionalSocialWorkPractice (1)7720FoundationsofHumanBehavior (3)7730SocialWorkSkills (3)

Spring (First Year) Total: 5 credit hours7710SocialPolicy&ServiceDeliveryinSocialWork (3)7740LargeGroupTheory (2) Summer (First Year) Total: 6 credit hours____Elective (3)

Plus the following course from your chosen concentration – Clinical or PP&A

Clinical:7770StrategiesofClinicalSocialWorkInterventions (3)or7820DSMVPsychopathology (3)

OR

Policy, Planning & Administration: 7820DSMVPsychopathology (3)

Second Year=21 credits totalFall (Second Year) Total: 9 credit hours 7952ResearchDesigninSocialWork (3)____Elective (3)____Elective (3)

48

Spring (Second Year) Total: 6 credit hours7780FundamentalsofSocialWorkAdministration (3)

Plus the following course from your chosen Concentration - Clinical or PP & A:

Clinical: 7770StrategiesofClinicalSocialWorkInterventions (3)or7820DSMVPsychopathology (3) OR

Policy, Planning & Administration:7920FoundationsofHumanBehavior-PPA (3)

Summer (Second Year) Total: 6 credit hours7760FoundationsofSocialJusticeSeminar (2)7971GraduateFieldPracticumI (4)

Third Year= 21 credits total

Fall (Third Year) Total: 6 credit hours 8953EvaluativeResearch (3)

Plus the following course from your chosen Concentration - Clinical or PP & A:

Clinical:____ClinicalSelective(TBA) (3)

OR

Policy, Planning & Administration: 8350ManagementofaSocialAgency (3)

Spring (Third Year) Total: 15 credit hours8971GraduateFieldPracticumII* (12)8970ProfessionalPracticeSeminar (3)

* May extend to Summer if needed�** Class times/dates subject to change�

49

MSW Scholarship ApplicationPleaseemailtonullc@missouri.edu,Faxto573-882-8926,ormail/dropofftoMSWProgram,725ClarkHall,Columbia,MO65211

Toreceiveconsiderationforscholarships,studentsmustbeacceptedintotheSchoolofSocialWork.Applicationsmustbesubmittedforeachsemesterofaward.ApplicationDeadline:January15(forSummerandFallsemesters)andSeptember15(forspringsemester).Whenre-ap-plyingforscholarships,pleaseupdateyouressay.

Check one: ___Newor___ContinuingMSWStudent MU Student No. (if applicable):____________________________________________

Full Legal Name:_____________________________________________________________________________________________________Last First Middle

Daytime Phone #: (____) _________________ Evening Phone #:(____) _________________ E-mail:_________________________________

Current mailing address:_______________________________________________________________________________________________Street City State Zip

Permanent address:___________________________________________________________________________________________________Street City State Zip

Birth Date (optional): _ _________________________________

Semesters and Year you wish to be considered for a scholarship:

Fall20____ Spring20____ Summer20____

Date of application submission: _ ______________________

Plan of study: __Full-Timeor__Part-Time Anticipated Graduation Date:_ ____________

In a 500 word statement, describe your professional social work goals. Include any other information about yourself (financial need*, etc.) that you think would be helpful in making a selection for a scholarship� Thisstatementshouldbetypedseparatelyandattached.Becertaintoaddressthefollow-ing questions:

• Describeyourmostmeaningfulachievementsandhowtheyrelatetotheprofessionofsocialworkandyourfuturecareergoals.• Why are you a good candidate to receive this award?• Fromafinancialstandpoint,whatimpactwouldthisscholarshiphaveonyourgraduateeducation?• Howhaveyoubeenfinancingyourcollegeeducation?

Please visit our website: http://ssw.missouri.edu/scholarships.html for the complete list of available scholarships� Students with complete applica-tions will be considered for scholarships� If there are any scholarships that you are particularly interested in, please list them below�

1�___________________________________________________________________________________________________________________

2�___________________________________________________________________________________________________________________

3�___________________________________________________________________________________________________________________

* FAFSA is required for need-based scholarships:Allscholarshipsareawardedprimarilybasedonacademicmeritorpotential.However,insomeinstancesdemonstratedfinancialneedisconsideredinadditiontoacademicmeritorpotential.Wheredemonstratedneedisacriterion,studentsarerequiredtofiletheFreeApplicationforFederalStudentAid(FAFSA).FAFSAformsmaybeobtainedfromtheMUFinancialAidOffice,11JesseHall.TheFAFSAmaybesubmittedbetweenJanuary1-June30eachyear.Approximately4weeksaftersubmittingyourFAFSAyouwillreceiveaSARreport.A copy of your FAFSA applica-tion and SAR report MUST be stapled to this application to be considered for need-based scholarships�

ONLY COMPLETED APPLICATIONS WILL BE CONSIDERED

50

School of Social Work Scholarships

BelowisalistingofsomeoftheSchoolofSocialWorkscholarshipsthatareavailable.

Anita L� Hoffman Graduate Fellowship-AwardedtostudentspursuingagraduatedegreeintheSchoolofSocialWork.

Bettyann Dubansky Memorial Scholarship Fund-EstablishedinmemoryofBettyannDubansky,aformerfacultymem-beroftheSchoolofSocialWorkfrom1964-1992.Awardedtosocialworkstudents,withpreferencegiventostudentswithdisabilitieswhoarepursuingasocialworkcareerworkingwithindividualswithdisabilities.

Charles and Wilba Cowger Peace Scholarship - Established by Charles Cowger, former faculty member and former directoroftheSchoolofSocialWork.AwardedtostudentsenrolledintheMastersofSocialWorkProgram.Recipientsmusthavedemonstratedcommitmenttopeacemakinginallaspectsoflifefrominterpersonaltointernationalandinvestedindevelopingandmaintainingalternativestoviolenceincivilsocietyinthe21stCentury.

Dr� Colleen Galambos Scholarship-EstablishedbyDr.ColleenGalambos,currentfacultymemberandpreviousdirectorfortheSchoolofSocialWork.Thisawardprovidesassistancetosinglemotherswhoarepursuingundergraduateorgradu-atedegreesinsocialworkatMU.Thisassistancewillbeprovidedtohelpoffsetthechallengestheseindividualsfaceandtogive recognition for the courage these individuals demonstrate in pursuing the dream to have a career focused on advanc-ingsocialandeconomicjusticeforallpersons.

Eleanor J� and John W� Watt Scholarship for Social Work-Establishedbyfacultymember,Dr.J.WilsonWatt,inhonorofhisparents’memoryandtoincreaseunderstandingofandappreciationforgay/lesbianissues.Awardedtodoctoralormas-ter’slevelsocialworkstudentsandisintendedtoencourageopenlygay/lesbianstudentswhoareinterestedinconductingresearchongay/lesbianissues.Mayalsobeawardedtonon-gay/lesbiangraduatestudentswhoareinterestedinresearchservicedeliveryissuesforthegay/lesbianpopulation.

Francis Johnson Memorial Scholarship in Social Work - Established by Betty Simon and Chris Simon in memory of motherandgrandmother,FrancisShieldsJohnson.Thisisawardedtograduatestudentsinsocialworkwithpreferencegiventonon-traditionalstudentswhohaveshowndedicationtoworkingwithchildrenandhelpingfamilies.

Jane Bierdeman Fike Doctoral Fellowship Fund in Social Work-EstablishedbytheformerdirectorofsocialworkatFultonStateHospitalandlong-timefriendoftheSchoolinsupportofthePhDprogram.Preferenceshallbegiventodoctor-alstudentswhoseresearchfocusesonpublicmentalhealthservicesforthechronicallymentallyill.

Jennifer Davenport Undergraduate Scholarship in Social Work -EstablishedbyDrs.Joseph&JudithDavenportinhonoroftheirdaughterJenniferSchroeder.Awardswillbeforstudentsthathavedesignatedsocialworkastheirmajor.TheDavenportswantedtocultivateaninterestinSocialWorkwithstudentswhoareMissouriresidentswithdemonstratedfinancialneed.ThescholarshipisoutlinedforFreshmanorTransferstudentswhohaveearnedanAssociatedegreepriortoenrollingatMU.

Joanne Mermelstein Scholarship in Social Work-EstablishedbyFriendsofDr.JoanneMermelstein,formerfacultymem-berfortheSchoolofSocialWork.AwardedtograduatestudentsenrolledintheMastersofSocialWorkProgram.

Joseph and Judith Davenport Scholarship in Rural Social Work-EstablishedbyDr.DavenportinhonoroftheSchool’s75thanniversaryofprofessionalaccreditation.Studentshallbepreferablyfromsmalltowns(lessthan20,000)orruralareas.Thisdoesnotprecludestudentswithaninterestinpractice,policyorresearchinruralareafromreceiving.Recipientshallexhibitacademicexcellenceandshallbeamotivatedstudent.

Dr� Judith A� Davenport Millennium Scholarship Fund in Social Work-EstablishedbyDr.Davenport’shusband,JosephDavenport,anddaughter,JenniferKemper,inhonorofhereightyearsasdirectorandcontinuingservicetotheSchool.Awardedtosocialworkundergraduateorgraduatestudentswithaninterestinmentalhealth.Academicperformance,communityservice,extracurricularactivities,financialneedandpotentialforsignificantcontributiontothefieldofsocialworkshouldbetakenintoconsideration.

Mariana Paull Johns Fellowship in Social Work-EstablishedbyDr.WilliamD.Johns,familymembers,andfriends,inhonorofMarianaPaullJohns,whoreceivedaMasterofSocialWorkin1988attheageof62.Awardedtosocialworkgradu-atestudentswhohaveademonstratedfinancialneed.Preferenceshallbegiventothenon-traditionalstudent.

51

Marjorie R� Sable Endowment for Public Health Social Work - One or more annual scholarship awards may be given to studentsenrolledintheSchoolofSocialWork.Preferencegiventosocialworkstudentswhodemonstrateaninterestinpublichealthsocialwork.ThisincludesbutisnotlimitedtostudentswhoareenrolledinthedualMSW/MPHprogram,orwhoareenrolledintheGraduateCertificateinPublicHealth,orwhoaredoingtheirpracticuminapublicheathsetting.

Dr� Paul Sundet Scholarship for Policy Planning and Administration-EstablishedbyDr.Sundet,aformerfacultymemberandresearcherfortheSchoolofSocialWork.ThisawardisforgraduatestudentsinSocialWorkwithaninterestinpursuingpositionswithinPolicy,PlanningandAdministrationrelatedtoSocialWelfareandSocialServices.

Rintha Mary Carter Social Work Scholarship Fund-EstablishedbytheEstateofRinthaMaryCarter,a1950MasterofSci-enceinSocialWorkgraduate.AwardedtoworthystudentsintheSchoolofSocialWork.

Stemmons Family Scholarship in Social Work-Awardedtostudentspursuingadegreeinsocialworkandwhohaveademonstratedfinancialneed.

Stanley G� and Sondra S� Remer Scholarship Fund - Established by the Remers to provide awards to students in the School ofSocialWorkwhoaremembersoftheMUAssociationofChristianSocialWorkers.Awardedtosocialworkstudentswhoex-emplifythegoalsoftheNorthAmericanAssociationofChristiansinSocialWorkinintegratingChristianfaithandprofessionalsocialwork.

William Bryan Myers II Memorial Scholarship-EstablishedbyDr.ClaraLouiseMyers,aformerfacultymember,inlovingmemoryofherson.Awardedtosocialworkgraduatestudentswhohavedemonstratedacademicpromiseforsuperiorperfor-manceingraduateschoolandwhohaveadocumentedfinancialneed.

52

Release of information Form

Name: Student Number:

I hereby give the University of Missouri-Columbia, School of Social Work permission to release to employers/schools information concerning my graduate career at MU�

Signed by: Date:

53

Address Change FormPlease Return This Form to 725 Clark Hall

BecauseitisoftennecessaryforsomeonefromtheSchoolofSocialWorktoreachyoubyphoneormail,weareaskingthatyoucompletethefollowingformandreturnittotheGraduateSecretaryin724ClarkHall.Asafollowuppleaseletusknowifanyfuturechangesinyouraddressorphonenumberoccur.Thankyouinadvanceforyourcooperation.

NAME: DATE:

YOUR STATUS THIS SEMESTER:

Full-Time: Part-Time:

LOCAL ADDRESS:

STREET/DRIVE:

CITY/STATE/ZIP:

PHONE NUMBER (include area code) HOME:

CELL:

WORK:

PERMANENT ADDRESS:

STREET/DRIVE:

CITY/STATE/ZIP:

PHONE NUMBER (include area code) HOME:

CELL:

WORK:

54

Learning Plan for SW 7085 (Problems), SW 8955 (Independent Study),

& SW 8090 (Research)

Student: __________________________________________ Instructor: __________________________________________ Advisor: __________________________________________ Semester: FS WS SS

Check one: SW 7085 Problems Credits: ___________

SW 8955 Independent Study Credits: ____________

SW 8090 Research Credits: ____________

Purpose and description of the project and/or readings:

Rationale for utilizing this mode of instruction:

What requirement is this course designed to fulfill?

55

Specific tasks and expectations to be accomplished or met by the student and instructor with a calendar for completion (attach additional paper if necessary):

1.

2.

3.

4.

5.

Signatures

Student: __________________________________________ Instructor: __________________________________________

MSW Program Director: __________________________________________ Carol A� Snively, PhD Advisor: __________________________________________

Date: __________________________________________

Distribution List:1 copy to student1 copy to instructor1copytostudent’sfile1 copy to msw program director Revised8/11/06

56

Intent to complete MSW/MPH Dual Degree

Name______________________________________________________StudentNumber___________________

By checking each item and signing below, I am declaring my intention to complete the MSW/MPH dual degree program at the University of Missouri in Columbia, MO and that I understand what is expected of me in the program.

___ I understand that I must apply and be accepted to, both, the Master of Social Work program and the Master of Public Health program in order to complete the MSW/MPH dual degree.

___ I have read the MSW/MPH plan of study and understand that I must, strictly, follow this plan of study in order to complete the dual program, successfully.

___ I understand that it is my responsibility, as a student, to keep in contact with my dual program advisor and inform him/her of any changes to my program, including but not limited to; adding or dropping a class after classes start, taking a leave of absence from the program, and choosing not to pursue the dual degree after I’ve started.

__________________________________________________________________Signature Date

57

GENERALIST AND CONCENTRATION COMPETENCIES

Competency 1: Demonstrate Ethical and Professional Behavior • MakeethicaldecisionsbyapplyingthestandardsoftheNASWCodeofEthics,relevantlawsandregulations,

modelsforethicaldecision-making,ethicalconductofresearch,andadditionalcodesofethicsasappropri-atetocontext;

• Usereflectionandself-regulationtomanagepersonalvaluesandmaintainprofessionalisminpracticesitu-ations;

• Demonstrate professional demeanor in behavior; appearance; and oral, written, and electronic communica-tion;

• Use technology ethically and appropriately to facilitate practice outcomes; and • Usesupervisionandconsultationtoguideprofessionaljudgmentandbehavior.

Competency 2: Engage Diversity and Difference in Practice • Applyandcommunicateunderstandingoftheimportanceofdiversityanddifferenceinshapinglifeexperi-

encesinpracticeatthemicro,mezzo,andmacrolevels;• Presentthemselvesaslearnersandengageclientsandconstituenciesasexpertsoftheirownexperiences;

and • Applyself-awarenessandself-regulationtomanagetheinfluenceofpersonalbiasesandvaluesinworking

withdiverseclientsandconstituencies.

Competency 3: Advance Human Rights and Social, Economic, and Environmental Justice• Apply their understanding of social, economic, and environmental justice to advocate for human rights at

the individual and system levels; and • Engageinpracticesthatadvancesocial,economic,andenvironmentaljustice.

Competency 4: Engage In Practice-informed Research and Research-informed Practice • Usepracticeexperienceandtheorytoinformscientificinquiryandresearch;• Applycriticalthinkingtoengageinanalysisofquantitativeandqualitativeresearchmethodsandresearch

findings;and• Useandtranslateresearchevidencetoinformandimprovepractice,policy,andservicedelivery.

Competency 5: Engage in Policy Practice• Identify social policy at the local, state, and federal level that impacts well-being, service delivery, and ac-

cess to social services; • Assess how social welfare and economic policies impact the delivery of and access to social services;• Applycriticalthinkingtoanalyze,formulate,andadvocateforpoliciesthatadvancehumanrightsandsocial,

economic,andenvironmentaljustice.

Competency 6: Engage with Individuals, Families, Groups, Organizations, and Communities• Applyknowledgeofhumanbehaviorandthesocialenvironment,person-in-environment,andothermulti-

disciplinarytheoreticalframeworkstoengagewithclientsandconstituencies;and• Useempathy,reflection,andinterpersonalskillstoeffectivelyengagediverseclientsandconstituencies.

Competency 7: Assess Individuals, Families, Groups, Organizations, and Communities• Collectandorganizedata,andapplycriticalthinkingtointerpretinformationfromclientsandconstituen-

cies;• Applyknowledgeofhumanbehaviorandthesocialenvironment,person-in-environment,andothermulti-

disciplinarytheoreticalframeworksintheanalysisofassessmentdatafromclientsandconstituencies;• Develop mutually agreed-on intervention goals and objectives based on the critical assessment of strengths,

needs, and challenges within clients and constituencies; and• Selectappropriateinterventionstrategiesbasedontheassessment,researchknowledge,andvaluesand

preferencesofclientsandconstituencies.

58

Competency 8: Intervene with Individuals, Families, Groups, Organizations, and Communities• Critically choose and implement interventions to achieve practice goals and enhance capacities of clients

and constituencies;• Applyknowledgeofhumanbehaviorandthesocialenvironment,person-in-environment,andothermulti-

disciplinarytheoreticalframeworksininterventionswithclientsandconstituencies;• Useinter-professionalcollaborationasappropriatetoachievebeneficialpracticeoutcomes;• Negotiate, mediate, and advocate with and on behalf of diverse clients and constituencies; andfacilitateeffectivetransitionsandendingsthatadvancemutuallyagreed-ongoals.

Competency 9: Evaluate Practice with Individuals, Families, Groups, Organizations, and Communi-ties

• Select and use appropriate methods for evaluation of outcomes;• Applyknowledgeofhumanbehaviorandthesocialenvironment,person-in-environment,andothermulti-

disciplinarytheoreticalframeworksintheevaluationofoutcomes;• Criticallyanalyze,monitor,andevaluateinterventionandprogramprocessesandoutcomes;and• Applyevaluationfindingstoimprovepracticeeffectivenessatthemicro,mezzo,andmacrolevels.

Advanced practice behaviors will be added after October 1, 2017.

59

Notes: