pacific university football 2012 media guide

GOBO

XERS

.COM

Pacific University • 3

Quick Facts/Contents

Contents2012 Pacific Football Quick FactsPACIFIC UNIVERSITYLocation: ForestGrove,Ore.Founded: 1849NationalAffiliation: NCAADivisionIIIConference: NorthwestConferenceEnrollment: 3,302(1,603undergraduate)Colors: Red(PMS1805),Black&WhiteNickname: BoxersPresident: Dr.LesleyHallickDirectorofAthletics: KenSchumannAssociateAthleticDirector: LaurenEsbensenSportsInformationDirector: BlakeTimmHeadAthleticTrainer: LindaMcIntosh

CONTACT INFORMATIONAddress: UCBoxA-154,2043CollegeWay ForestGrove,OR97116AthleticOfficePhone: 503-352-2767AthleticOfficeFax: 503-352-2209SportsInformationPhone: 503-352-2161SportsInformationFax: 503-352-2286Website: www.goboxers.comFacebook: facebook.com/pacificuboxersTwitter: twitter.com/goboxersYouTube youtube.com/pacificuboxers

FACILITY INFORMATIONHomeField: LincolnParkStadiumOpened: 2007SeatingCapacity: 2,800(mainstadium1,160)Surface: FieldTurf

FOOTBALL COACHING STAFFHeadCoach: KeithBuckleyAlmaMater: UCDavis(1996)RecordAtPacific/Years: 1-18/2YearsOverallRecord/Years: 1-18/12YearsOffensiveCoordinator: JimCraft(3rdSeason)DefensiveCoordinator/RecruitingCoordinator: JacobYoro(3rdSeason)OffensiveLineCoach/Strength&Conditioning: IanFalconer(3rdSeason)RunningBacksCoach: MikeMcCabe(3rdSeason)KickersCoach: JasonDaily(3rdSeason)OffensiveAssistantCoach: JustinFritz(2ndSeason)WideReceiversCoach: JamesYen(1stSeason)TightEndsCoach: TylerBowen(1stSeason)DefensiveBacksCoach/EquipmentManager: ErikMonson(1stSeason)DefensiveTacklesCoach: JohnSteiger(1stSeason)DefensiveEndsCoach: MarcMoody(1stSeason)DefensiveAssistantCoach: RandynAkiona(1stSeason)

FOOTBALL INFORMATION2011OverallRecord: 1-82011ConferenceRecord(Finish): 1-5(6th)StartersReturning/Lost: 22/3 (9offensive,10defensive,3specialists)BasicOffense: ProStyleBasicDefense: 4-3HomeUniforms: WhiteHelmets,RedJerseys&PantsAwayUniforms:WhiteHelmets,WhiteJerseys&Pants

2012 Football ScheduleDate Opponent Location TimeThurs., Aug. 30 Simon Fraser Forest Grove 7 p.m.Sat.,Sept.8 atOccidental LosAngeles,Calif. 7p.m.Sat.,Sept.22 atWillamette Salem,Ore. 1:30p.m.Sat., Sept. 29 Whitworth* (Homecoming) Forest Grove 1 p.m.Sat.,Oct.6 atPugetSound* Tacoma,Wash. 1p.m.Sat., Oct. 13 Pacific Lutheran* Forest Grove 1 p.m.Sat.,Oct.27 atLewis&Clark* Portland,Ore. 1:45p.m.Sat., Nov. 3 Willamette* Forest Grove 1 p.m.Sat.,Nov.10 atLinfield* McMinnville,Ore. 1p.m.

*-NorthwestConferenceopponentsHomegamesinbold typeAlltimeslocaltogamesiteandsubjecttochange.PleasevisitGoBoxers.comforscheduleupdates.AllgameswillairinthePortlandareaon1360AMKUIKandviawebcastatGoBoxers.com.AllfivehomegameswillbevideowebcastatGoBoxers.com.

CreditsThe2012PacificFootballMediaGuide&YearbookisaproductionofthePacificUniversitySportsInformationOffice.Writing, Editing & Design:BlakeTimm‘98Photography: BlakeTimm,JaimeValdez,JohnLariviere,andJimFlory.SomephotoscourtesyPacificUniversityArchivesandtheForestGroveNews-TimesEditorial Assistance:MattRichert,JoeLang,ChelseyChamberlain‘12Printing:LaskoPrinting,Portland,Ore.

Additionalcopiesofthisguidewillbeavailableforpurchasefor$10athomePacificfootballgames.Copiesalsoavailablebymailfor$15(includingpostage)bycontactingthePacificUniversitySportsInformationOfficeat503-352-2161ortimmbr@pacificu.edu.

Copyright©2012,PacificUniversityAthletics.Allrightsreserved.

GENERAL INFORMATION 2-4Quick Facts.............................................................................32012 Schedule..........................................3 & Back CoverMedia Information...............................................................4Broadcast Information....................................................4

2012 SEASON PREVIEW 6-8

COACHING STAFF 9-14Head Coach Keith Buckley...........................................10Football Staff.......................................................................11

2012 PLAYERS 15-48Roster.....................................................................16Returning Player Profiles.............................................18Newcomer Player Profiles..........................................38Pronunication Guide........................................................457

2012 OPPONENTS 49-54Simon Fraser/Occidental...........................................50Willamette/Whitworth.....................................51Puget Sound/Pacific Lutheran..................................52Lewis & Clark/Linfield....................................................53Opponents Composite Schedule..............................54

2011 SEASON REVIEW 55-74Season Review..................................................................56By The Numbers..............................................................60Team Statistics.................................................................61Schedule & Results.........................................................61Individual Statistics.........................................................61Defensive Statistics........................................................64Game Highs........................................................................65Game Recaps....................................................................66

NORTHWEST CONFERENCE 75-80About The Northwest Conference..........................76Past Champions..................................................762011 NWC Standings...................................................762011 All-NWC Teams....................................................772011 Team Statistics.....................................................782011 Individual Offensive Statistics..........................782011 Individual Defensive Statistics......................792011 Student-Athletes of the Week.....................802012 Preseason Coaches Poll.................................80Bowl & Postseason History.........................................80

HISTORICAL INFORMATION 81-102Individual Records............................................................82Longest Plays/Streaks...........................................83Team Records...................................................................84Individual Yearly Leaders.............................................85Individual Category Leaders.......................................87Honor Roll............................................................................91Coaching Records............................................................92Year-By-Year Records..........................................92Series History....................................................................95Pacific’s Championship Teams..................................96Columbia Football Association...................................98All-Time Roster..................................................................99

MISCELLANEOUS 103-111Lincoln Park Stadium..................................................104Stoller Center..................................................................105Athletics Facilities..........................................................106Pacific Athletic Hall of Fame......................................107Boxer Club.........................................................................107President Lesley Hallick.............................................108Director of Athletics Ken Schumann....................108Pacific Administration/Coaching Staff..............109About Pacific University.............................................110Helmets & Uniforms....................................................111

PACI

FIC

Foot

ball

4 • Pacific University

Media Information

CREDENTIALSPresscredentialsforfootballgamesmustberequestedinadvancebycontactingBlakeTimm,SportsInformationDirector,at(503)352-2161orbye-mailattimmbr@pacificu.edu.CredentialswillbemadeavailableatthewillcallboothatLincolnParkStadiumonthedayofgame.Credential requests made on day of game will not be honored.

BecauseoflimitedspaceintheLincolnParkStadiumpressbox,seatingwillassignedinthefollowingorder:1.Home&VistingRadio/TVBroadcasters2.DailyPrintMedia3.WeeklyPrintMedia4.OtherElectronicMediaWhoCoverPacificOnARegularBasis5.VisitingSportsInformationDirector

PLAYER & COACH INTERVIEWSAllinterviewswithPacificathletesandcoachesmustbedirectedthroughtheSportsInformationOfficewith24hoursadvance.Homeorcellphonenumbersforstudent-athleteswillnotbereleasedtoreportersunderanycircumstances.PostgameinterviewswillbecoordinatedthroughBlakeTimm,SportsInformationDirector,andwilltakeplaceonthefield.RequeststointerviewspecificplayersshouldbemadetoBlakeTimmnolaterthanthe5-minutemarkofthefourthquarter.

UnderNorthwestConferenceguidelines,teamsareentitledtoa10-minutecooling-offperiodoncetheyentertheirrespectivelockerroom.Thereisnopressaccesstothelockerroomatanytime.

EVENT SERVICESQuickstatisticswillbeprovidedtoworkingmediamembersathalftime.Completestatisticalpackageswillbeavailablewithin30minutesoftheconclusionofthecontest.InternetaccessisavailableattheStollerCenterandallLincolnParkvenuesformediause.PleasecontactthesportsinformationdirectorforaccesstotheUniversity’snetwork.

BROADCAST REQUESTSRadioandtelevisionstationswishingtobroadcastfromPacifichomeeventsshouldcontacttheSportsInformationOfficeatleastoneweekinadvance.Twoanalogphonelinesareavailableforvisitingradio.UseofphonelinesatLincolnParkStadiumiscomplimentary,butlongdistancechargesaretheresponsibilityoftheoriginatingstation.

PHOTOGRAPHYMediamemberswishingforon-fieldaccessforphotographymustcontacttheSportsInformation

Officepriortotheevent.Photographersarerestrictedtosidelineareasstretchingfromthe25-yardlinetotheendzone.Unlessotherwisearranged,photographersareonlyallowedtoshootforeditorialpurposes.ImagesofPacificsportingeventsmaynotbesoldas“copyright”withoutwrittenauthorizationofPacificUniversityAthletics.

INTERNET/SOCIAL MEDIAThePacificAthleticsWebsite,GoBoxers.com,isthemostup-to-dateresourceforinformationonBoxerathletics,includingscheduleupdates.StoriesandstatisticsforallPacifichomeeventswillbepostedonthesitewithin90minutesoftheconclusionoftheevent.Resultsandstatisticsfromawaycontestswillbepostedwithinareasonabletimeframefollowingthatevent.

Inaddition,mediacoveringPacificathleticsareencouragedtofollowtheBoxersthroughtheirsocialnetworkingoutlets.

Facebook: facebook.com/pacificuboxersTwitter: twitter.com/goboxersYou Tube: youtube.com/pacificuboxers

PACIFIC BROADCASTSAllninePacificfootballgameswillbeairedinthePortlandareaon1360AMKUIK,andworldwideviaanaudiowebcastthatcanbeheardthroughthePacificAthleticswebsite,GoBoxers.com.Additionally,alivepay-per-viewvideofeedofPacific’sfourhomegameswillbeavailable.Bothaudioandvideofeedcanbeaccessedatwww.Gozboxers.com/webcasts.

Matt Richert willprovidetheplay-by-playdescriptionsduringthe2012season,withScott Hermoprovidingcoloranalysis.Richertisa20-yearveteranplay-by-playannouncer,mostrecentlyprovidingthedescriptionsofhighschoolfootball,basketballandbaseballonKUIK.Hehasalsodoneextensiveplay-by-playworkforstatehighschoolchampionshipgamesontheOSAARadioNetwork,includinglastyear’s5Aand6Achampionshipfootballcontests.

Hermoisalsoafamiliarvoicetolocalsportsfans,havingservedasacoloranalystonsportsbroadcastsonKUIKsince1994.HermowasthecoloranalystforLinfieldfootballbroadcastsin1998.HehelpedproduceandhosttheOregonPrepReportonKXLRadiofrom2000-2001andagainin2003.Inaddition,HermohasbeenavoiceontheOSAARadioNetworkforeachofthelastthreeyears.

Sports Information OfficeBlake Timm, Sports Information DirectorFootball Contact(503) 352-2161 • E-Mail: [email protected]

Media OutletsPRINTForest Grove News-TimesZack Palmer, Sports Editor503-357-3181/[email protected] Schrag, Publisher503-357-3181/[email protected]

The OregonianNick Daschel, Small College Beat Writer360-607-4824/[email protected] Hester, Sports Editor503-221-8548/[email protected]

Hillsboro ArgusLawrence Kreifels, Sports Editor503-648-1131/[email protected]

Associated PressAnne Peterson/Sports Reporter503-228-8169/[email protected] E-Mail: [email protected]

Pacific IndexTyler Grant, Sports Editor503-352-2855/[email protected]

Honolulu Star-AdvertiserBilly Hull, Sports Reporter808-529-4786/[email protected] Arnett, Sports Editor808-529-4786/[email protected]

RADIOKUIK-AM (1360)Matt Richert, Sports Director503-640-1360/[email protected]

KEX-AM (1190)Scott Lynn, Sports Director503-323-6437/[email protected]

750 The Game (KXTG-)Jay Allen, Sports Director503-243-7595/[email protected]

KPAM-AM (860)Ron Callan, Sports Director503-417-8783/[email protected]

TELEVISIONKATU (ABC)Craig Birnbach, Sports Director503-221-5559/[email protected]

KOIN (CBS)Dan Christopherson, Sports Director503-464-0769/[email protected]

KGW (NBC)Joe Becker, Sports Reporter503-226-5152/[email protected] Berk, Sports Reporter503-226-5119/[email protected]

KPTV (FOX)Dan Sheldon, Sports Director503-548-6541/[email protected]

INTERNETD3Football.comPat Coleman/Executive Editor612-237-4855/[email protected]

Chelsey Chamberlain, Assistant Sports Information Director(503) 352-1578 • E-Mail: [email protected]

2012Season PreviewPACIFIC UNIVERSITY FOOTBALL

PACI

FIC

Foot

ball


Season Preview

Taking another step with experience on their side

• Another year older and another year stronger, Pacific will lean on their experience to take another step up the Northwest Conference ladder

Thewin-lossrecorddoeslittletotellthestoryofhowmuchPacificfootballgrewinitssecondseasonbackonthefield.

TheBoxers’1-8recorddidreflectthefirstwinfortheyoungprogram,anexciting44-25victoryoverPugetSoundonhomecomingweekend.Butthewin-lossrecorddoeslittletoshowthegrowththecoachingstaffobservedinexperience,confidence,maturityandstrength.

“OurgoalwasnottofinishatthebottomoftheNorthwestConferencelastyear.Weaccomplishedthat,”saidthirdyearHeadCoachKeithBuckley.“Nowwewanttocontinuetoimproveasafootballteam.”

Thatsophomoreseasonrecordalsodidn’treflecthowpotentofapassinggamethatBuckleyandhisstaffhavedevelopedinjusttwoyears.TheBoxersranked23rdamongDivisionIIIteamswith282passingyardspergameand65thwithapassefficiencyrankingof134.63.

Andwithanotheryearofexperienceunderthebeltsoftheteam’s90returners,thereseemstobenoplacetogobutup.“Acrosstheboard,thelevelofplayisimproved,”Buckleysaid.“Physically,ourjuniorsareatanimprovedlevelbothintermsofstrengthandexperience.Becauseofthat,wehavebeenabletopushfartherandfasterintermsofinstallingour

schemes.”Alongwiththatexperiencedgroupof90

returnerscomesaclassof65freshmenthatentersasthemosttalentedsincetherestartoftheprogramin2010.Theexperienceinthereturninggroupallowedthecoachingstafftobemoretargetedinrecruiting,shoringupweakerareasandfurtherstrengtheningothers.

ButwhatBuckleythinkswillhelpPacificclimbanotherstepuptheladderinthejunioryearisthededicationthatthejuniorandsophomoreplayershaveshowntonotonlyimprovingthemselves,buttoimprovingtheteamoverall.Thathasmadetheteamhungriernotonlyformoreonfieldsuccess,butalsoforplayingtime.

“Youcouldtellonthefirstdayofcampthattheguysputtheworkintocomeinasstrongastheycouldbe,inshapeastheycouldbeandreadytocompete,”Buckleysaid.“Thisisacompetitivemodelandthosejuniorsknowthattheyhavesophomoresandfreshmenontheirheelsandchasingthemfortheirjobs.Wehaveguysthatarephysicallyreadytoplaynowandwillcontributesignificantly.”

QUARTERBACKSWhileHonorableMentionAll-NorthwestConferencequarterbackT.C.Campbellhasstarted17of18gamesintheneweraofPacific

football,Buckleyisstillconvincedthattheycanbesuccessfulwithatwoquarterbacksystemthatgivestheteamtwodistinctlydifferentlooks.

Campbell’snumbersspeakvolumesforthepotencyofthePacificpassinggame.Hesetaschoolsingleseasonrecordbycompleting59.4percentofhispassesandranked41stamongDivisionIIIquarterbackswithanefficiencyratingof141.08.HetiedhisownschoolrecordbythrowingforfivetouchdownsinthebreakthroughwinoverPugetSound.

WhenCampbelldidn’thaveagoodgamewithhiscontrolledstyle,P.J.Minayamadethingshappenwithhisscramblingstyle.HenearlythrewtheBoxerstoacome-from-behindvictoryintheseasonfinaleatPacificLutheran,completing23of34passesfor223yardsandthreetouchdowns.

“P.J.hashadatremendouscamp,”Buckleysaid.“Heisagoodballthrowerandatremendouscompetitor.Ontheflipside,T.C.isagamemanagerandatoughplayer.Hewillsthingstohappen.

“There’sadebateastowhetheryoucanhavetwoquarterbacksandbesuccessful.Ithinkthatwehavetwoverytalentedguysthatgiveusachancetowingames.”

WarnerShawwillapprenticeunderhistwoHawaiiteammateswithabrightfutureahead.

Wide receiver Jordan Fukumoto was Pacific’s first All-NWC First Team selection since 1984.

GOBO

XERS

.COM


Season Preview

Shawpassedforover2,000yardsasasenioronhiswaytoearningconferenceoffensiveplayeroftheyearhonors.

RECEIVERSWithoutquestion,Pacific’sreceivercorpscontinuestobetheteam’sdeepestpositionandit’sbiggeststrength.Thereceiversaccountedfor18oftheBoxers’22touchdownsin2011andtheir282.3yardspergamewas23rdbestamongallDivisionIIIteams.Ofthe11returnersattheposition,sevensawsignificanttimeonthefield.

ThedynamicJordanFukumotobecamePacific’sfirstAll-NWCFirstTeamselectioninnearly30yearsthankstoaninnateplay-makingability.FukumotoledtheBoxersandfinishedfourthintheNWCwitheighttouchdownsandfinishedsecondintheleaguewith844yardsand93.8yardspergame.

WhatimpressesBuckleyisnotonlyFukumoto’sability,buthisdesiretocontinueimproving.“Thereisnorestingonhislaurels,”Buckleysaid.“Hecontinuestoworkonhisgameandworkonhimself,whichonlyraisestheentirelevelofourreceivingcorps.”

KelsonKawaicontributedbothonoffenseandspecialteams,finishingthirdfortheBoxerswith299receivingyardsandsecondonreturnswith226yardson12returnattempts.BlakeAnthonymadequiteasplashinhisfreshmanseason,finishingwith275yardsandanaverageof13.8yardspercatch.

CalebRoherwasalsoanimpactcontributoronbothoffenseandspecialteams.HeledtheBoxerswith363returnyardson20carries,butalsofinishedwith188yardsreceivingandtwotouchdowns.

JakobLawrence,BrandonSelveyandCameronYipallsawlimitedtouchesduring2011,butstandtoearnmoreplayingtimein2012.

Complementingtheplay-makingabilitiesofFukumotowillbethereturnofDarinKamealoha,whoplayedjusttwogamesintheinaugural2010seasonbeforehavingtositthenextyearandahalfwithinjuries.TaylorHicksonalsoreturnsaftermissing2011asherecoveredfromaninjurysufferedduringthe2011trackandfieldseason.

RUNNING BACKSFortheBoxerstoexperiencegreateroffensivesuccessin2012,theywillneedtoseesignificantimprovementintherunninggame.TheBoxersaveragedjust1.2yardspercarryin2011,seventhintheNWC,whiletheteam’sopponentsaveragedfiveyardspercarryagainsttheBoxers.

Buckleypointsoutthatamoresolidrunninggamewillhelpthereceiversperformatanevenhigherlevel.“Forthereceivingcrewtobeassuccessfulastheycanbeinthegrandschemeoffullteamsuccess,wehavetobeabletoruntheball,”hesaid.“Inthefirsttwoyears,wewerenowherenearthelevelwewantedtobe.Thathadtodowiththephysicalmaturityinbothourrunningbacksandoffensiveline.Nowthatwehavethephysicalcapabilitiestomovesomepeoplearound,weshouldhavemoresuccess.”

GuntherSchultzeistheteam’stopreturningrunningback,netting124yardson54carriesandaveraged2.3yardspercarry.Buckleylaudedthejuniorforhispreparationduringthesummer.“Heistryingtotakeonsome

leadershipcomponents,”Buckleysaid.“Hehadworkedhardonhisgameandonhisabilities,andwethinkhecamebeveryserviceable.”

BobbyLadigesandDevenMcKinney(willbothcompetefortimeaftergainingsomesizeovertheoffseason.Ladigessawlimitedactioninhisfreshmancampaign,whileMcKinneyplayedasignificantroleonspecialteamswith179yardsandanaverageof19.9yardsperreturn.

BronsonBarretto,KamanaPimentelandJonDoberleadthelistofnewcomerswiththegreatpotentialforplayingtime.Barrettowasanall-stateselectionatthepositioninHawaii,runningfor584yardsasasenior.PimentelearnedSecondTeamHawaiiAll-Statehonorswithhis964yardsand11touchdownswhileDoberearnedall-conferencehonorsatForestGroveHighSchool.

TIGHT ENDSBrianTaylorandWillMarchbanksstandatthetopofthedepthchartattightend.Taylorstartedallninegamesinhissophomorecampaignandfinishedwith141receivingyardsandthreetouchdowns.“Brianistheepitomeofthatgrowththathashappenedoverthefirstcoupleofyears,”Buckleysaid.“Hehasputonabout25poundssincehewalkedinthedoor.Thathasallowedhimtoprogressfromjustapass-catchingtightendtoaversatiletightend.”

Marchbanksplayedineightgameslastyear,playinganeffectiveroleinblocking.Buckleysaidthathehasalsobenefitedfromincreasedsizeandexperience.“Ithasallclickedincamp,”Buckleysaid.“Itisallstartingtocometogetherintermsofblocking.”

CharlieReed-DustinandTaylorSchadbothstandtoseemoreplayingtimeassophomoresthankstostrongshowingsincamp.Bothsawlimitedactionduringtheirfreshmenseasons.JackMichelshasalsoshownpromiseincampafteranall-conferenceprepcareerinWashington.

OFFENSIVE LINEThechangeintheoffensivelinehascomenotwithaninfusionofnewplayers,butratherthroughthehardworkofthereturners.Allfivestartersareback,havingputinaggressivesummersintheweightroom.

AaronVictorinoreturnsasthestartingcenter,asdoguardsNikkNoveroandEricGietzenandtacklesSeanDalton,a2010HonorableMentionAll-NWCselection,andKevinPeterson.Allfiveplayersstartedallninegamesin2011.

Whiletheexperiencecertainlyhelpsthosefive,thestartinglineupisfarfromsetthankstosomeyoungtalentrightbehind.BrandonSattelmeiersawactioninsevengameslastyearandhasbenefitedfromasummerintheweightroom.WillUlrichsawspottimeasafreshman,buthasputon25poundssincethen.

Pacific will benefit from an extra year of experience in the running game, anchored by Gun-ther Schultze (left), and a more mature offensive line with the likes of tackle Sean Dalton (middle). John Lariviere photo.

PACI

FIC

Foot

ball


Season Preview

Devin Lagorio’s breakout season on the defensive line earned the Stockton, Calif., native Honorable Mention All-Northwest Conference honors. John Lariviere photo.

TaylorMackhasbeenimpressivetothecoachingstaffaswellandcouldviefortimeafteranall-conferenceprepcareer.

DEFENSIVE LINEMuchliketheiroffensivecounterparts,theimprovementonthedefensivelineisthanksprimarilytohardworkbyreturnersintheoffseason.

DevinLagorioshowedgreatpromiseafterstartingeightgameslastyear,comingupwith27tacklesand3.5tacklesforloss.Buckleybelievesthe2011HonorableMentionAll-NWCselectionisonthecuspofabreakoutyear.“Hehasputatonofworkin,”Buckleysaid.“Heisbigandexplosiveandhasfinallybeguntounderstandthenuancesofthepositionandhasthechancetobedynamite.”

LagoriowillagainbecoupledwithLandonAanoontheinteriorpositions.Alsoastarterineightgames,Aanofinishedwith23tackles,ledtheteamwiththreesacksandwastiedfortheteamleadwith6.5tacklesforloss.

EddieCarrillostandsagoodchanceforastartingtackleroleafteranimpressivefreshmanseason.Hehad13tacklesand1.5sackswhileseeingactioninallninegames,includingonestart.MikeSmithandIraeHoseaalsostandtobetacklecandidatesastheyreturnfrominjuries.

Attheends,SeanBangsandChrystianJohnsonreturnassteadymainstays.Bangsearnedthestartinallninegameslastyear,finishingwith13tacklesandasack.Johnsonalsostartedinallninegamesandrackedup15tackles,includingtwoforloss.

JaysonManningandBrandonHandarebothcandidatesforincreasedplayingtimeafterstrongoffseasonimprovements.AlexPateis

alsointhemixafteraprepcareerwherehewasanall-conferenceselectiononbothlines.

DEFENSIVE BACKSThedefensivebackunitreturnsPacific’smostexperienceonthedefensivesideoftheballwiththereturnofapairofAll-NWCselectionsandthreestarters.

BryanMillswasanHonorableMentionAll-NWCselectionatsafety.HeledtheBoxerswith62tackles,placinghim10thamongtheleague’sdefensiveplayers.His35solotacklesandhis6.9tacklespergamerankedseventhintheNWC.Hissophomoreseasonwillbebestknownforaspecialteamsplay,though,wherehereturnedablockedextrapointkick100yardsforadefensivetwo-pointconversionthatlandedPacificonSportsCenter.

JoshBrinkworthstartedatsafetyinfiveofhisninegamesandwasanimpactplayerasafreshman.HefinishedthirdfortheBoxerswith42tackles,madethreeforlossandtiedMillswithtwoforcedfumbles.

Buckleyisexcitedtoseewhereasolidoff-seasonofworkwilltakethem.“Iwasthrilledwiththefocusandshapetheycameinwith,”Buckleysaid.“Theytooktheiroff-seasonveryseriouslyandcameinplayingfromdayoneatadifferentlevelthantheyendedatlastyear.”

KamuMoritawasjustaseffective,finishingwith31tackleswhileseeingactionineightgames.JoeyMichaelwillalsoviefortimethanksinparttohis6-foot-3frame.

CraigBaileyshowedthatthelearningcurvetoadjustfromwidereceivertocornerbackwasashortone.AnHonorableMentionAll-NWCselectiononthecorner,Baileyfinishedwith18tacklesandledtheconferencewith11passbreak-ups.“Craigsurvivedforawhilepurely

onhisathleticism,butnowhehasbecomeaverysmartandsavvycorner,”Buckleysaid.“Wearelookingforwardtoagreatyearfromhim.”

Aquartetofplayerswillcompeteforthestartingroleattheoppositecornerback.BrandonHarmsplayedinallninegamesasafreshman,comingupwith15tackles.“BrandonisoneofthesmartestguysIhaveeverbeenaroundatthatposition,whichgiveshimaheckofachancetomakeplaysbecauseheisprocessingitfasterthananyone,”Buckleysaid.

AndyHarrismadeanimpressioninhisfivegamesasafreshmanandwillstandachancetocompetethankstohis6-foot-3frame,whichcancovertallerreceivers.KaseyDukeswillseearoleaftermissingmostofthe2011seasonwithaninjurywhileJaquariPeoplehasalsoshowngreatnaturaltalentthatwillmakehimacandidateforplayingtime.

LINEBACKERSPacificwillbenefitfromanexperiencedcrewatlinebackerthatseesallthreeregularstartersreturn.TimHastiestartedallninegamesatmiddlelinebacker,finishingsecondfortheBoxerswith56tacklesandsharetheteamleadwith6.5tacklesforloss.His23assistedtacklesranked11thintheNWC.

ShaneFeuerbachalsostartedallninegamesonthestrongside,finishingwith24tackles.ChrisSantiagocompletedasuccessfultransitionfromsafetytoweaksidelinebacker,startingallninegameswhilerackingup30tackles.

HunterDassonville,JackPerezandJustinRevillawillallcompetetoback-upHastieinthemiddle.Dassonvilleplayedinthefinalsixgamesoftheseason,finishingwithninetackles,includingthreeforloss.PerezwasaCaliforniaall-regionselectionondefensewhileRevillahadasuccessfulprepcareerinHawaii.

AlenSukljereturnsafteramedicalredshirtseasonintheshapetocompetefortimeatstrongsidelinebacker.GabeFloryandAustinBrownwillcompetefortimeatweaksidelinebackerafterseeinglimitedactionin2011.

KICKERSForthethirdstraightyear,Pacificstandstoscorefromastrongkickinggame.MosesVillareal-GomezbecamethesecondstraightBoxers’placekickertoearnHonorableMentionAll-NWChonors.

Afteraroughstartthatsawhimmissfourhisfirstfivefieldgoalattempts,Villareal-Gomezcamebacktomakefivestraighttoendtheseasonandconnecton17of19point-afterattempts.

AaronKofordreturnsforhisthirdseasonastheBoxers’primarypunter.Thejuniorworkedhardonhisconsistencyintheoff-seasonafterayearwherehefinishedfifthintheleagueinaverageandthirdwith13ballsinsidethe20-yardline.TylerGilmorehasalsoshownastronglegincamp.

CoachingStaff

PACIFIC UNIVERSITY FOOTBALL

PACI

FIC

Foot

ball


Coaching StaffKeith Buckley

Head Football Coach • 3rd Season3rd Season Overall

UC Davis (1996)

The Buckley FileEDUCATIONBA, Rhetoric/Communications and English, UC Davis, 1996MS, Physical Education (Sport Philosophy emphasis), Idaho, 2001

PREVIOUS COACHING EXPERIENCEAssistant Head Coach, UC Davis, 2007-2009Defensive Backs Coach, UC Davis, 2005-2008Assoc. Director of Football Operations, Stanford, 2002-2005Defensive Backs Coach, Humboldt State, 2001-2002Defensive Graduate Assistant Coach, Idaho, 1999-2001Assistant Football Coach/Defensive Backs Coach, UC Davis, 1996-1999

PLAYING EXPERIENCEPlayed defensive back at UC Davis from 1992 to 1995.

PERSONALNative of Milpitas, Calif. He and wife Kara have two daughters, Kristen and Kaitlyn.

AsheentershisthirdyearastheheadcoachofthePacificfootballprogram,KeithBuckleyisbeginningtoseethefruitsofthelaborhehasspentbuildingtheprogramfromscratch.

In2011,BuckleyledtheBoxerstotheirfirstvictorysincetheprogram’sreinstatementin2010astheywowedasellouthomecomingcrowdwitha44-25victoryoverPugetSound.ThevictorywasadefiningmomentinaseasonthatsawtheBoxerslandsevenAll-NorthwestConferenceselections,whichincludedtheselectionofwidereceiverJordanFukumotoasPacific’sfirstfirstteamselectionsince1984.

Workingwithacoreofnearly100freshmencomingoutforthefirstseasonoftheprogram,BuckleyledaPacificteamthatearnedareputationforneverquittingonthefield,evenagainstthebestofopponents.FourofhisplayersearnedspotsontheAll-NorthwestConferenceTeam,ledbysecondteamwidereceiverJordanFukumoto.

Buckley’s2011campaignalsoincludedtwoNorthwestConferenceOffensiveStudent-AthleteoftheWeekselectionsforquarterbackT.C.Campbell,aD3Football.comTeamoftheWeekhonorfordefensivebackCraigBaileyandanunusualdefensivetwo-pointconversionplaybysafetyBryanMillsthatputtheBoxersonESPNSportsCenter’sTopPlays.

ThegrowthofthePacificprogramiscontinuingonanuphillswingunderBuckley’sleadership.TheBoxerswelcome65newcomerstoForestGrovein2012afterbringingin75newplayersin2011and110duringtheinaugural2010campaign.

BuckleywasnamedtheheadcoachofthenewPacificfootballprogramonJuly31,2009.HearrivedinForestGroveafterfourseasonsaspartofthecoachingstaffatUCDavisafterheemergedfromanexhaustivenationalsearchthatsawover125peopleapplytoleadPacific’sfirstfootballteamsince1991.

Buckleyrelishesthechancetobepartofbuildinganewprogram.“Thisisacoach’sdream,”Buckleysaid.“Therearefewsituationswhereyouhavethechancetobuildaprogramfromthegroundup,developyoungtalentandhaveachancetoputPacificonthefootballmap.Iamexcitedforthisopportunity,notonlyformeprofessionallybutalsoformyfamily.”

BuckleyarrivedatPacificafterafour-yearstintatUCDavis,whereheservedasassistantheadcoachandcoordinatedrecruitingeffortsfortheAggies’NCAADivisionI-FCSprograminadditiontocoachingthesafeties.Priortobeingpromoted,BuckleyspentthreeseasonsastheAggies’defensivebackscoach.

Duringhistimeathisalmamater,Buckleyplayedaninstrumentalroleintheteam’stransitionfromDivisionIItoDivisionIunderHeadCoachBobBiggs.TheAggiessucceededinextendingtheirstringof37consecutivewinningseasonsinadditiontopullingoffanupsetofStanfordintheirthirdseasonoftransitiontoDivisionI.BuckleywasalsotheprimarypositioncoachforUCDavis’firstDivisionIAll-American,freesafetyJ.J.Barsi(2006).

Inadditiontohiscoachingduties,BuckleycreatedandcoordinatedtheAggies’annualhighschoolfootballskillscampandworkedasalecturerinthephysicaleducationprogram,teachingcoursesinelementaryphysicaleducation,sportinsocietyandactivitycourses.

A1996graduateofUCDaviswithdegreesinrhetoricandcommunicationsandEnglish,BuckleyplayedfortheAggiesasadefensiveback.Duringhistimeontheline,theAggiesadvancedtotheNCAADivisionIIplayoffstwiceandtheteamcompileda30-11-2record.

AninjuryforcedBuckleytothesidelinesinhisjuniorseason,butgavehimajump-startinhiscoachingcareer.Hespentthe1996seasonasaundergraduateassistantcoachbeforebeingnamedcornerbackscoachin1997anddefensivebackscoachin1998.

BuckleymadehisfirstmovetotheNorthwestin1999,coachingdefensivebacksandoutsidelinebackersfortwoseasonsatIdahowhileearningamaster’sdegreeinphysicaleducation.AtIdaho,BuckleyworkedforbothformerOaklandRaidersheadcoachandcurrentSeattleSeahawksassistantheadcoachTomCableandWyomingdefensivecoordinatorChrisTormey.

Afteraone-yearstintasadefensivebackscoachatHumboldtStateinArcata,Calif.,forthe2001season,BuckleyspentoneyearasadefensiveassistantandtwoyearsastheassociatedirectoroffootballoperationsatStanfordunderBuddyTeevensandWaltHarris.

AnativeofMilpitas,Calif.,Buckleyandhiswife,Kara,aretheproudparentsoftwodaughters,KristenandKaitlyn.HewasinductedtotheHallofFameathisprepalmamater,MilpitasHighSchool,earlierthisyear.

GOBO

XERS

.COM


Coaching StaffJacob Yoro

Defensive CoordinatorRecruiting Coordinator

3rd Season • Hawaii (2008)

Jim CraftOffensive Coordinator

3rd Season • Portland State (1998)

JimCraftentershisthirdseasonasPacific’soffensivecoordinator,bringingawealthofexperienceattheDivisionIlevelandawideknowledgeofthevauntedWestCoastoffensetotheForestGrovesidelines.

Inhisfirsttwoseasons,CrafthasbuiltateamcomprisedexclusivelyofunderclassmenintooneofthetoppassingattacksinallofNCAADivisionIIIfootball.TheBoxersfinished2011rankedthirdintheNorthwestConferenceand23rdamongDivisionIIIteamswithanaverageof282.3yardspergame.Pacific’sfourquarterbackscombinedforapassefficiencyratingof134.63,thirdbestintheNWCand65thamongallDivisionIIIprograms.

Craft’steamsuccesseshavealsoresultedinsomesignificantindividualsuccess.JuniorquarterbackT.C.Campbellhassetsinglegamerecordsforpassingyardsandtouchdownsinhisfirsttwoyearsandbrokethesingleseasonrecordwitha59.4completionpercentage.WidereceiverJordanFukumotohasbeenonthereceivingendoftwooftheschool’slongesteverpassingplayswhilebecomingPacific’sfirstFirstTeamAll-NWCselectionsince1984.

InhisfirstseasonleadingtheBoxers,CraftsawPacificfinishfourthintheNWCinpassingoffensewhileusingfivedifferentquarterbacksoverthecourseoftheyear.Theteamcappedthatinauguralcampaignwitha419-yardperformanceatMenlothatjustmissedateamsinglegamerecord.

CraftarrivedatPacificpriortothe2010seasonafteralongcareerathisalmamater,PortlandState.Duringthattime,CraftbecameastudentoftheWestCoastoffenseunderthelegendaryMouseDavisandformerheadcoachTimWalsh.

CraftwaselevatedtooffensivecoordinatorforPortlandStatein2009bythenHeadCoachJerryGlanvilleaftertheretirementofrun-and-shootmasterDavis.Astheprogram’splaycaller,Craftwaschargedwithcoordinatingtheoffensiveinsertioncalendar,gamepreparationanddesigningtheoffensivescheme.AmongtheseasonhighlightswastheselectionofquarterbackDrewHubeltotheESPNTheMagazine/CoSIDAAcademicAll-DistrictVIIIFootballTeam.

CraftplanstorunmanyaspectsofaWestCoastoffense,withsomerun-and-shootflairsthathelearnedunderDavis.“Theoffenseisexcitingbecausewewillrunamultitudeofsets,”Craftsaid.“Overthefirstcoupleofyearswewillconstantlybeevaluatingandfindingwhattoolswehaveforthebestchanceofsuccess.”

BeforebeingelevatedtooffensivecoordinatoratPortlandState,Craftspentoneseasonastheoffensivelinecoachandoneseasonasthewidereceiverscoach.UnderWalsh,Craftspentfiveseasonsasthetightendscoachandoneyearasquarterbackscoach.Healsoassumedthedutyofspecialteamscoordinatorforfourseasons.HecoachedPortlandStateall-conferenceperformersScottWeaver,AdamWhiteheadandTonyCurtis,aformermemberoftheNFL’sKansasCityChiefs.

Asspecialteamscoordinator,Craftsawthe2005VikingsleadtheBigSkyConferenceinpuntreturnaverageandrankedinthetop20inthenationinbothpuntreturnaverageandkickoffreturnaverage.TheVikingsweresecondinpuntcoveragein2004,19thinpuntreturnsand22ndinkickoffreturns.

PriortojoiningthePortlandStatestaff,Craftspentthe1999and2000seasonsasthetightendscoachatLewis&ClarkCollege.

CraftplayedhiscollegiatefootballatPortlandStatefrom1995to1998,catching57passesandscoringninetouchdowns.Heearnedhisbachelor’sdegreeinpsychologyfromPortlandStatein1998andamaster’sinteachingin2003.Craft,36,residesinTualatinwithhiswife,Kelley,daughtersKayla(10)andStellaMarie(1)andsonTyler(6).

JacobYoroentershisthirdseasonasPacific’sdefensivecoordinator,usinghiswealthofexperienceattheDivisionI-FCSandNAIArankstomoldthisyoungPacificprogramforsuccess.Inadditiontohiscoordinatorduties,YorodoesspecificpositionworkwiththeBoxers’linebackers.

YoroalsorecentlycompletedhisfirstfullseasonasPacific’srecruitingcoordinator,wherehehassucceededincontinuingtodrawgreattalenttoForestGrove.Hehelpedtobring65newplayerstoPacificthisseasonafterplayingakeyroleinHawaiirecruitingoverhisfirsttwoyearswiththeprogram.

YoroarrivedatPacificafteroneseasonasthelinebackerscoachattheUniversityofMontanaWesterninDillon,wherehehelpedleadtheBulldogstoa4-6record.

Priortoreturningtothemainland,YorospenteightseasonscoachinginthehighschoolranksinhisnativeHawaii.Hespentthe2008seasonatalinebackerscoachanddefensiveconsultantatWaipahuHighSchool.PriortoWaipahu,YorospentsixyearsattheSt.LouisSchoolinHonoluluwherebebeganaslinebackerscoachbeforespendingthreeseasons(2005-2007)asdefensivecoordinator.YorobeganhiscoachingcareeratMililaniHighSchoolwherehewasthelinebackerscoach.

YoroplayedhiscollegiatefootballattheUniversityofMontana,wherehewasatwo-yearletterwinnerbeforeseeinghiscareercutshortbyakneeinjury.HewasapartofGrizzlies’teamsthatadvancedtotheDivisionI-FCSplayoffsin1998and1999.YoroplayedhishighschoolballattheSt.LouisSchoolwhereheearnedall-leagueandall-statehonorsinfootball.

AnativeofMililani,Hawaii,Yoro,32,earnedhisbachelor’sdegreeinhistoryfromtheUniversityofHawaii-Manoain2008.

PACI

FIC

Foot

ball


Coaching StaffIan Falconer

Offensive Line CoachStrength & Conditioning Coach


Mike McCabeRunning Backs Coach

3rd Season • Pacific (1977)

IanFalconerentershisthirdseasonastheBoxers’offensivelinecoachandisinhissecondyearastheUniversity’sstrengthandconditioningcoach.

Falconerfigurestoplayakeyroleintheconstruc-tionoftheBoxers’futuresuccessesonthegridiron.Despiteworkingwithanundersized,youngcorpsoflinemanintheBoxers’firstseason,Falconersawhischargesmakesignificantimprovementfromstarttofinish.HecoachedfreshmanlinemanSeanDaltontoHonorableMentionAll-NorthwestConferencehonorsineachoftheprogram’sfirsttwoseasons.

Inhisroleasstrengthandconditioningcoach,FalconerassiststheentirePacificprogramindevelopingweightprogramsdesignedtoproducemaximumperformance.His“PowerHour”programs,offeredtwiceweeklyduringtheyear,haveprovedpopularforallsegmentsoftheathleticprogram.

FalconeralsospenttwoseasonsastherecruitingcoordinatorfortheBoxerfootballprogram.Hesucceededinnetting110freshmentotakepartonthenewteamandfollowedthatupwith75moreforthepro-gram’ssecondseason.

FalconercametoPacificfromLewis&Clarkwhereheservedasoffen-sivelinecoachandoffensivecoordinatoratLewis&Clarkfrom2006to2009.Hedevelopedadiverseonebackpackagethatincludedzone,gapandoptiontechniquevariations.Inadditiontohiscoordinatorduties,FalconerspentthelasttwoseasonsasthePioneers’recruitingcoordinator.Healsocoordinatedvideoresponsibilitiesandspentthreeseasonscoordi-natingtheteam’soff-seasonstrengthandconditioningprogram.

FalconerbeganhiscollegecoachingcareeratLewis&Clark,servingastightendscoachandrecruitingcoordinatorduringthe2003season.InbetweenLewis&Clarkstints,FalconerspenttwoyearsatNCAADivisionIIIOberlinCollegeinOberlin,Ohio,whereheworkedastheoffensivelinecoachandassistantheadcoach.HealsoservedastheYeo-men’sstrengthandconditioningcoachandrecruitingcoordinator.

Inadditiontohiscollegeexperience,Falconerspentthe2002seasonastheassistantoffensivelinecoachatWestLinnHighSchool.

FalconerplayedhiscollegefootballatPortlandStateUniversity,andjoinshisformerteammate,JimCraft,onthePacificstaff.Falconerwasafour-yearoffensivelinestandoutfortheVikings,earningAll-BigSkyConferencehonorsatcenterasasenior.HeplayedakeyroleinaPortlandStateoffensivelinethatgaveuponly12sacksduringthe2000season.

AnativeofLakeOswego,FalconerisagraduateofLakeridgeHighSchoolandearnedhisbachelor’sdegreeinsocialsciencefromPortlandStatein2000.Heandhiswife,Angel,resideinMilwaukiewiththeirone-year-olddaughter,Leta.

MikeMcCabe,aformerPacificfootballplayerandlongtimeheadfootballcoachatForestGroveHighSchool,isinhisthirdseasonasrunningbackscoach.

A1977graduateoftheprogramandaveteranofhighschoolcoachingcircles,McCabewillprovidevaluableknowledgeandassistanceinlocalrecruitingastheBoxersworkonbuildingtheirprogramfortheFall2010kickoff.

McCabewasateacherandheadfootballcoachatForestGroveHighSchoolfor12yearsbeforeretiringfromeducationin2009.Asheadcoach,McCabeledtheVikingstostateplayoffappearancesin2003and2007.Inadditiontocoaching,McCabeworkedasaphysicaleducationandweighttrainingteacher.

Inadditiontofootball,McCabeservedasanassistanttrackandfieldcoachfrom2001to2006.Healsoservedasanassistantvarsitybaseballcoachfrom1997to2001withbothForestGrove’shighschoolandAmericanLegionbaseballprograms.

Asateacher,McCabespenthisfirst20yearsasaphysicaleducationteacherinvariouslocalelementaryandjuniorhighschools.HemovedtoForestGroveHighSchoolin1997.

AnativeofHayward,Calif.,andagraduateofForestGroveHighSchool,McCabeearnedhisdegreeinphysicaleducationfromPacificin1977.HeplayedtwoseasonsoffootballfortheBoxersatcenterfrom1973-1974andalsoplayedfouryearsofbaseball.McCabealsoearnedhisMasterofScienceinteachingfromPacificin1984.Heandhiswife,Bonnie,continuetoliveinForestGrove.

Jason DailyKickers Coach


JasonDailyreturnstothePacificcoachingstaffforhisthirdseasonaskickerscoachafterastandoutcollegekickingcareer.

DailyspentoneseasonasthepunteratPortlandStatein2003,workingundercurrentPacificoffensivecoordinatorJimCraft.Inhisoneseason,Dailyaveraged40.5yardsperpunt.PriortoarrivingontheParkBlocks,DailyspentoneseasonastheprimarypunteratMichiganState.HefinishedfifthintheBigTenwitha40.4-yardperpuntaverageandhadaseason-long66-yardbootagainstNotreDame.

PriortomovingontoDivisionI,DailyspenttwoseasonspuntingatCollegeoftheCanyonsinValencia,Calif.A2001JCGrid-WireFirstTeamAll-American,DailyearnedAll-WesternStateandAll-Californiahonorsasasophomoreafteraveraging40.7yardsperpunt.DailyhelpedleadCanyonstoanimpressive19-3overallrecord.

AnativeofSanLuisObispo,Calif.,DailywasanAll-CaliforniaInterscholasticFederationinbothfootballandbaseball.Afteramassinga14-1recordasastartingpitcherhissenioryear,hewasdraftedbySanFranciscoGiantsinthe2000MajorLeagueBaseballdraft.

DailyisagraduateofPortlandStateandhasworkedthelastsevenyearsasafinancialplanner.Heandhiswife,Stephanie,aretheproudparentsofsonGarrett(2).Daily’sgrandfather,RobertClarke,isaformerPacificfootballplayer.

GOBO

XERS

.COM


Coaching Staff

James YenWide Receivers Coach

Video Coordinator1st Season • Linfield (2002)

Justin FritzOffensive Assistant Coach

2nd Season • Oregon (2011)

JustinFritz,aproductofthenationallyrankedOregonfootballprogram,entershissecondseasonwithPacificasanoffensiveassistantcoach.

Fritzplayedthe2009seasonfortheDucks,playingonOregon’sPac-10championshipteamthatwenttotheRoseBowl.In2010,heworkedasastudentinternunderassistantheadcoachSteveGreatwoodwhentheDuckswontheirsecondstraightPac-10titleandadvancedtothe2011BCSNationalChampionshipgame.

PriortohisarrivalinEugene,FrtizplayedplayedtwoseasonsatWeberStateUniversityinOgden,Utah.Hecamebackfroma2005kneeinjurytoplayatoffensiveguardin2006andcenterin2007.

AnativeofSublimity,FritzletteredfourtimesinfootballatRegisHighSchool.Atwo-timeall-stateselectiononboththeoffensiveanddefensivelines,hewasnamedthe2004all-statelinemanoftheyearaswellastheTri-RiverConferenceLinemanoftheYear.Inaddition,Fritzwasalsoaletterwinneringolfandtrackandfield.

FritzgraduatedfromOregonin2010withadegreeinenvironmentalgeographyandearnedaseconddegreeinpoliticalsciencein2011.

AfterspendingthelastdecadeatDivisionIIIpowerLinfield,JamesYenbringshisexperienceasbothaDivisionIIIplayerandcoachtoForestGroveforhisfirstseasonasPacific’swidereceiverscoach.

YenspentthelastnineseasonsworkingwithwidereceiversatLinfield,coachingnumerousplayerstoAll-NorthwestConferenceandAll-Americanhonors.DuringtheWildcats’2004nationalchampionshipseason,YenhelpedcoachCaseyAllenandGeorgeCartertoAll-Americanhonors,withAllenreceivingfirstteamhonorsfromD3Football.com.

Inadditiontohisfootballduties,YenservedinSpring2012asLinfield’sheadwomen’sgolfcoach.BeforehisworkwithLinfieldgolf,YenservedastheheadsoccercoachatAmityHighSchool.

YenplayedhiscollegefootballatLinfield,earningavarsityletterin2002atwidereceiver.AnativeofHonolulu,YenwasamultipleletterwinnerattheKamehamehaSchoolsinfootball,soccerandtrackandfield.

Yen,31,graduatedfromLinfieldin2002withadegreeinappliedphysics.Heisworkingtowardshismaster’sdegreeinsportsmanagementfromAmericanPublicUniversityandexpectstograduatenextyear.

Tyler BowenTight Ends Coach

1st Season • Pacific Lutheran (2012)

Freshoffafour-yearplayingcareeratPacificLutheran,TylerBowenjoinsthePacificcoachingstaffastightendscoach.

Bowenwasafour-yearletterwinner(2008-2011)fortheLutes,playingwidereceiverunderScottWestering.Bowenmade45catchesinhiscareer,rackingup500yardandthreetouchdowns.Hemade14catchesinhisseniorseason,averaging16.1yardspercatchandscoringtwotouchdowns.

Asaprepathlete,Bowenwasathree-timefootballletterwinnerforRogersHighSchoolinPuyallup,Wash.HewasnamedtheSouthPugetSoundLeague’sDefensiveBackoftheYearin2007whilealsoearningfirstteamhonorsasawidereceiver.TheTacomaNewsTribunenamedBowentotheirall-areasecondteamasadefensivebackandheearnedaspotinWashington’sEast-WestAll-StarGame.

Inadditiontohisworkonthefootballfield,Bowenwasatwo-yearletterwinnerinbaseballwhereheplayedsecondbase,shortstopandtheoutfield.

AnativeofPuyallup,BowengraduatedfromPLUin2012withadegreeinhistoryandminorsinpoliticalscienceandreligion.Hisfather,Gene,istheheadfootballcoachatRogersHighSchool.Hisbrother,Shawn,isinhissecondyearasadefensivebackatPLU.

Erik MonsonDefensive Backs Coach

Equipment Manager1st Season • Bemidji State

ErikMonsonisinhisfirstyearwithPacificfootballastheBoxers’defensivebackscoach.Inadditiontohiscoachingduties,Monsonalsoservesastheprogram’sequipmentmanager.

MonsonspentthepreviousfiveseasonsasthewidereceiverscoachatDivisionIIICalLutheraninThousandOaks,Calif.HeplayedinroleinhelpingtheKingsmenreachthe2010and2011NCAADivisionIIIplayoffs,wheretheylosttoLinfieldinthefirstroundeachseason.In2010,MonsonsawreceiverEricRogerssettheprogramrecordforreceivingwith216yardsintheplayoffgameagainsttheWildcats.

PriortohisarrivalatCalLutheran,MonsonspentoneseasonaslinebackerscoachatMacalester(2006)andoneseasonasthejuniorvarsitycoachatValleyCityState,aNAIAschoolinValleyCity,N.D.HealsospentsingleseasonscoachingatthehighschoollevelinWashingtonandTexas.

MonsonplayedhiscollegiatefootballatNCAADivisionIIBemidjiStateinBemidji,Minn.HealsoplayedoneseasonforNorthlandCommunityCollegeinEastGrandForks,Minn.

AnativeofWashingtonstate,Monsonearnedhisbachelor’sdegreefromBemidjiStateandamaster’sdegreefromNorthDakotaState.

PACI

FIC

Foot

ball


Coaching StaffJohn Steiger

Defensive Tackles Coach1st Season • Oregon (2012)

JohnSteigerbringsfouryearsofundergraduateexperienceonthesidelinesatOregontoForestGrove,whereheisinhisfirstseasonasPacific’sdefensivetacklescoach.

SteigerspentthelastfourseasonsasanundergraduateassistantcoachwiththeDucks,wherehisdutiesincludedassistingwiththetightends,workingonfilmbreakdownanddevelopingtheoffensiveplaybook.SteigerhelpedpreparetheDucksfortheirappearancesin2010and2012RoseBowlsandthe2011BCSNationalChampionshipGame.

AnativeofSanDiego,SteigerplayedhisprepfootballatScrippsRanchHighSchoolwhereheplayedatrunningback,defensivetackle,defensiveendandlongsnapper.

SteigergraduatedfromOregonin2012withadegreeinsociologyandaminorinbusinessadministration.HeearnedhisBoyScoutsofAmericaEagleScoutawardin2008.

Marc MoodyStudent Assistant Coach

1st Season

Randyn AkionaDefensive Assistant Coach

1st Season • Montana (2002)

RandynAkionaentershisfirstyearasadefensiveassistantcoachfortheBoxersafterdevelopingnearlyadecadeofexperienceasahighschoolcoachandarenaleagueplayer.

AkionamostrecentlyservedasreceivercoachattheIolaniSchoolinHonolulufrom2007to2009,helpingtheRaiderstothreestraightHawaiiDivisionIIchampionships.PriortohisarrivalatIolani,AkionaspenttwoseasonsatDamienMemorialHighSchool,whereheworkedwiththereceiversandreturnspecialists.

Inadditiontohiscoachingduties,Akionaspentfrom2006to2009asanelementaryschoolphysicaleducationteacher.

AkionaplayedhiscollegefootballatNCAADivisionI-FCSpowerhouseMontana,wherehewasateammatewithcurrentPacificdefensivecoordinatorJacobYoro.InisfiveyearswiththeGrizzlies,AkinoawaspartoffiveBigSkyConferencechampionships,aDivisionI-FCSchampionshipin2001andarunner-upfinishin2000.

FollowingMontana,AkionaplayedtwoseasonsintheArena2FootballLeague,spendingthe2003seasonwiththeMaconKnightsbeforereturninghomeforthe2004seasonwiththeHawaiianIslanders.Hesawtimeatwidereceiver,lionbackeranddefensiveback.

AnativeofHonolulu,Akionawasanall-leagueandall-stateselectionfortheSt.LouisSchoolinbothfootballandtrackandfield.HegraduatedfromMontanain2002withadegreeinorganizationalcommunication.

AmemberofthefirsttwoteamsofthereinstatedPacificfootballprogram,MarcMoodywillserveduringtheteam’sthirdseasonasastudentassistantcoach.HewillfocusspecificallyonworkwiththeBoxers’defensiveends.

Moodyreturnedfromaninjurysufferedduringthe2010seasontoplayinsevengamesfortheBoxersatlinebackerin2011,makingapairofstarts.TheyearwashighlightedbysixtacklesamassedagainstClaremont-Mudd-ScrippsonSept.10.Moodystartedthreegamesduringtheinaugural2010seasonbeforesufferingaseason-endingkneeinjuryintheBoxers’NorthwestConferenceopeneratLewis&Clark.Hefinishedwith18tacklesinthosethreecontests.

PriortoarrivinginForestGrove,MoodyspentoneseasonatSaddlebackJCinMissionViejo,Calif.,oneseasonatHawaiiandoneseasonatMississippiValleyState.MoodyplayedhisprepfootballattheSt.LouisSchoolinHonolulu,wherehewasa2007HawaiiHonorableMentionAll-Stateselectionatfresssafety.

AnativeofEwaBeach,Hawaii,MoodyisontracktograduatefromPacificinDecemberwithadegreeinphilosophy.Heandhiswife,Ashley,weremarriedoverthesummer.

The Players


PACI

FIC

Foot

ball


2012 RosterALPHABETICAL ROSTER

No. Name Pos.49 Landon Aano DL34 Greg Alip RB25 Austin Alvarez RB89 Blake Anthony WR3 Sean Arbogast WR30 Adam Armstrong DB89 Heron Azevedo WR15 Craig Bailey DB54 Keli’i Balada OL54 Sean Bangs DL20 Bronson Barretto RB39 Ryan Beck LB90 Nick Bieber FB3 Josh Brinkworth DB40 Austin Brown LB10 T.C. Campbell QB81 Nick Capuzzi LB92 David Carr WR91 Eddie Carrillo DL25 Austin Cherry LB58 Jarom Ching LB29 Daniel Chun DB68 Tim Claussen OL48 Scotty Cooper DL Justin Cornair LB70 Sean Dalton OL41 Petr Danchev RB43 Hunter Dassonville LB9 Nick Datray QB26 Ronnie De Guzman DB11 Jon Dober RB28 Matthew Dodier DB38 Dominique Donaghy LB78 Kevin Dopps OL7 Kasey Dukes DB95 Miles Durant DL32 Hyaden England DB74 Justin Fa’agau DL88 Nate Farrell WR5 Shane Feuerbach LB35 Gabe Flory LB79 Andy Fujimoto OL29 Jordan Fukumoto WR56 Travis George DL36 Sam Gesicki WR77 Eric Gietzen OL86 Tyler Gilmore P23 Caleb Gottschalk WR28 Zack Greenbaum DB46 Brandon Hand DL64 Carson Hannibal LB85 Josh Hannum DL8 Brandon Harms DB23 Andy Harris DB47 Tim Hastie LB30 Taylor Hickson WR33 Lee Holscher DB98 Wesley Hooper DL19 Frank Howard LB99 Irae Hosea DL59 Travis James DL93 Kevin Jo DL75 Chrystian Johnson DL83 Jordan Johnson WR5 Nick Johnson WR9 Darin Kamealoha WR28 Kelson Kawai WR33 Bryce Kershner RB20 Trey Kodama LB83 Aaron Koford P90 Zach Krause DL27 Bobby Ladiges RB52 Devin Lagorio DL31 David Lary DB4 Jakob Lawrence WR53 Taylor Mack OL55 Jayson Manning DL87 Will Marchbanks TE

No. Name Pos. Ht. Wt. Yr./Elig. Hometown (Previous School)1 MosesVillareal-Gomez K 5-11 165 So./So. Stockton,Calif.(St.Mary’s)2 ShayneTanabe DB 5-8 170 Fr./Fr. Mililani,Hawaii(Mililani)2 P.J.Minaya QB 5-11 180 Jr./Jr. Wahiawa,Hawaii(Hanalani)3 SeanArbogast WR 6-1 195 So./So. Monroe,Ore.(Monroe)3 JoshBrinkworth DB 6-1 200 So./So. ElkGrove,Calif.(Sheldon)4 JakobLawrence WR 6-2 195 So./So. Sherwood,Ore.(Sherwood)5 ShaneFeuerbach LB 6-1 220 Jr./Jr. Rocklin,Calif.(Whitney)5 NickJohnson WR 5-9 155 So./So. Salem,Ore.(BlanchetCatholic)6 JoeyMichael DB 6-3 220 Fr./Fr. Dryden,Wash.(Cashmere)7 KaseyDukes DB 5-9 160 Jr./Jr. Wahiawa,Hawaii(Leilehua)8 BrandonHarms DB 5-10 185 So./So. Canby,Ore.(Canby)8 JulianPerea-Schaefer WR 5-11 170 Fr./Fr. Phoenix,Ariz.(Horizon)9 NickDatray QB 6-3 200 Fr./Fr. Atwater,Calif.(BuhachColony)9 DarinKamealoha WR 5-10 175 Jr./So. Waipahu,Hawaii(Hanalani)10 T.C.Campbell QB 5-11 190 Jr./Jr. Kaimuki,Hawaii(Kamehameha)11 JonDober RB 5-6 170 Fr./Fr. ForestGrove,Ore.(ForestGrove)11 HaydenPyatt DB 6-0 185 Fr./Fr. Anchorage,Alaska(NorthMarion,Ore.)12 WarnerShaw QB 6-1 190 Fr./Fr. Waimea,Hawaii(Kamehameha-Hawaii)13 ChrisSantiago LB 6-0 215 Jr./So. Waipahu,Hawaii(St.Louis)14 SethSiddle-Mitchell QB 6-0 200 Jr./Jr. Lodi,Calif.(Tokay)15 CraigBailey DB 5-10 182 Jr./Jr. Fairfield,Calif.(Fairfield)16 CadeSchultz DB 6-1 190 Fr./Fr. Monrovia,Calif.(Monrovia)16 NathanSuyematsu WR 5-9 160 Fr./Fr. Tualatin,Ore.(Tualatin)17 JaquariPeople DB 5-9 175 Fr./Fr. Merced,Calif.(Merced)17 BenjaminSchmid QB 6-1 205 Fr./Fr. Sandpoint,Idaho(Sandpoint)18 BrianTaylor TE 6-2 205 Jr./Jr. Lewiston,Idaho(Lewiston)19 NathanSelby WR 5-9 175 Fr./Fr. Hillsboro,Ore.(Liberty)20 BronsonBarretto RB 5-8 190 Fr./Fr. Mililani,Hawaii(Kamehameha)20 TreyKodama LB 5-8 165 Fr./Fr. PearlCity,Hawaii(Kamehameha)21 CalebRoher WR 6-0 190 So./So. Gresham,Ore.(SamBarlow)21 LamarWilliams DB 5-9 170 Fr./Fr. Spanaway.Wash.(Bethel)22 GabeRamirez DB 5-8 175 So./So. Lodi,Calif.(Tokay)23 CalebGottschalk WR 6-0 205 So./So. ElDoradoHills,Calif.(VistadelLago)23 AndyHarris DB 6-3 195 So./So. Midvale,Utah(Hillcrest)24 KamuMorita DB 5-11 185 Jr./Jr. Honolulu,Hawaii(Kamehameha)24 JoshPaiement WR 6-1 175 Fr./Fr. Eugene,Ore.(Marist)25 AustinAlvarez RB 5-9 190 Jr./Jr. Stockton,Calif.(Linden)25 AustinCherry LB 5-11 215 Fr./Fr. BayCity,Ore.(Neah-Kah-Nie)26 RonnieDeGuzman DB 5-10 180 So./So. Dublin,Calif.(Dublin)26 GuntherSchultze RB 5-10 205 Jr./Jr. Bellflower,Calif.(St.JohnBosco)27 BobbyLadiges RB 5-10 225 So./So. Escalon,Calif.(Manteca)27 NickO’Donnell DB 6-4 215 So./So. Portland,Ore.(Coll.oftheSiskiyous)28 ZackGreenbaum DB 5-8 195 Fr./Fr. Waikoloa,Hawaii(HawaiiPrep)28 KelsonKawai WR 5-7 155 Jr./Jr. NorthKohala,Hawaii(Kohala)29 DanielChun DB 5-9 180 So./So. Hilo,Hawaii(Kamehameha-Hawaii)29 JordanFukumoto WR 5-10 170 Jr./Jr. Mililani,Hawaii(St.Louis)30 AdamArmstrong DB 5-9 185 Jr./So. Ventura,Calif.(VenturaJC)30 TaylorHickson WR 6-3 200 Jr./Jr. RedBluff,Calif.(RedBluff)31 DavidLary DB 5-8 165 Fr./Fr. LakeLosAngeles,Claif.(Littlerock)31 CameronYip WR 5-9 175 Jr./Jr. Waihe’e,Hawaii(Kamehameha-Maui)32 HaydenEngland DB 5-10 185 Fr./Fr. Creswell,Ore.(Creswell)32 KamanaPimentel RB 5-6 185 Fr./Fr. Kaneohe,Hawaii(St.Louis)33 LeeHolscher DB 5-8 180 So./Fr. ForestGrove,Ore.(ForestGrove)33 BryceKershner RB 5-11 210 Jr./Jr. JordanValley,Ore.(JordanValley)34 GregAlip RB 5-7 210 Fr./Fr. Kealakekua,Hawaii(Waipahu)34 ChaseRogers DB 5-9 175 So./So. Lahaina,Hawaii(Lahianaluna)35 GabeFlory LB 5-10 200 Jr./Jr. Davis,Calif.(Davis)35 JonathonTangalin WR 5-8 150 Fr./Fr. Kekaha,Hawaii(Waimea)36 SamGesicki WR 6-1 190 Fr./Fr. Tracyton,Wash.(Olympic)36 BryanMills DB 5-11 195 Jr./Jr. Imbler,Ore.(Imbler)37 JordanSpencer DL 5-9 238 Fr./Fr. Seattle,Wash.(Ingraham)37 AlenSuklje LB 6-0 205 Jr./So. Portland,Ore.(Beaverton)38 DominiqueDonaghy LB 5-10 220 So./So. Shoreline,Wash.(Shorecrest)38 DevenMcKinney RB 6-0 210 So./So. Spanaway,Wash.(SpanawayLake)39 RyanBeck LB 6-1 190 Fr./Fr. Scottsdale,Ariz.(Chaparral)39 SteelRocha RB 5-4 170 Jr./Jr. Modesto,Calif.(CentralCatholic)40 AustinBrown LB 6-1 205 So./So. KlamathFalls,Ore.(Henley)41 PetrDanchev RB 5-6 205 So./So. Salem,Ore.(McKay)42 JackPerez LB 6-1 235 Fr./Fr. Petaluma,Calif.(Petaluma)43 HunterDassonville LB 5-10 210 Jr./Jr. Gladstone,Ore.(Gladstone)44 LandonWeimar LB 6-1 215 So./So. Glide,Ore.(Glide)45 AlexWilleford LB 6-1 210 Jr./So. Keizer,Ore.(McNary)46 BrandonHand DL 6-1 235 So./So. Auburn,Wash.(AuburnRiverside)

GOBO

XERS

.COM


2012 RosterALPHABETICAL ROSTERNo. Name Pos.87 Shahin Marzband WR67 Cesar Mason LB38 Deven McKinney RB91 Michael Mejia TE85 Kyle Merriam WR6 Joey Michael DB81 Jack Michels TE36 Bryan Mills DB2 P.J. MInaya QB Charlie Moren LB24 Kamu Morita DB65 Nikk Novero OL61 Neil Ochs OL27 Nick O’Donnell DB24 Josh Paiement WR61 Alex Pate DL66 James Peckham OL17 Jaquari People DB8 Julian Perea-Schaefer WR42 Jack Perez LB72 Kevin Peterson OL32 Kamana Pinentel RB62 Zak Porche LB97 Patrick Powell DL63 Jacob Powers LB88 Cameron Pumphrey WR11 Hyaden Pyatt DB22 Gabe Ramirez DB60 Riley Rankin OL82 Charlie Reed-Dustin TE51 Justin Revilla LB50 Nick Reynolds LB39 Steel Rocha RB34 Chase Rogers DB21 Caleb Roher WR13 Chris Santiago DB73 Brandon Sattelmeier OL86 Taylor Schad OL51 Nicholas Schilla OL17 Benjamin Schmid QB16 Cade Schultz DB26 Gunther Schultze RB19 Nathan Selby WR80 Brandon Selvey WR12 Warner Shaw QB14 Seth Siddle-Mitchell QB80 Andrew Simons DL84 Jason Smith WR76 Mike Smith DL37 Jordan Spencer DL69 Tyler Stewart DL37 Alen Suklje LB16 Nathan Suyematsu WR2 Shayne Tanabe DB35 Jonathon Tangalin WR18 Brian Taylor TE59 Jacob Torquato OL52 Christopher Torres OL60 Zach Tucker LB63 Will Ulrich OL11 Sean Valente RB57 Aaron Victorino OL1 Moses Villareal-Gomez K82 Tyler Watkins RB44 Landon Weimar LB45 Alex Willeford LB21 Lamar Williams DB53 Zach Willits LB94 Caleb Wistock DL31 Cameron Yip WR71 Austin Zimbrick DL

No. Name Pos. Ht. Wt. Yr./Elig. Hometown (Previous School)47 TimHastie LB 6-1 240 Jr./Jr. Auberry,Calif.(Sierra)48 ScottyCooper DL 6-3 220 So./So. Fullerton,Calif.(Servite)49 LandonAano DL 5-9 245 Jr./Jr. EwaBeach,Hawaii(Kamehameha)50 NickReynolds LB 5-10 230 Jr./Jr. Chimacum,Wash.(Chimacum)51 JustinRevilla LB 5-8 190 Fr./Fr. Mililani,Hawaii(Mililani)51 NicholasSchilla OL 6-0 280 Fr./Fr. Honolulu,Hawaii(Punahou)52 DevinLagorio DL 6-2 275 Jr./Jr. Stockton,Calif.(St.Mary’s)52 ChristopherTorres OL 6-1 290 Jr./Jr. SanJose,Calif.(WestValleyJC)53 TaylorMack OL 6-1 275 Fr./Fr. BonneyLake,Wash.(BonneyLake)53 ZachWillits LB 5-9 195 Jr./Jr. Medford,Ore.(NorthMedford)54 Keli’iBalada OL 5-10 255 Fr./Fr. Portland,Ore.(Westview)54 SeanBangs DL 6-3 230 Jr./Jr. Portland,Ore.(Sunset)55 JaysonManning DL 6-3 225 Sr./Jr. Lahaina,Hawaii(Univ.ofHawaii-Maui)56 TravisGeorge DL 6-0 250 Jr./Jr. GrantsPass,Ore.(NorthValley)57 AaronVictorino OL 6-1 280 Jr./Jr. Lihue,Hawaii(Kauai)58 JaromChing LB 5-10 225 Fr./Fr. Kapolei,Hawaii(Kamehameha)59 TravisJames DL 5-8 235 Fr./Fr. Modesto,Calig.(Escalon)59 JacobTorquato OL 5-11 275 Fr./Fr. Holtville,Calif.(Holtville)60 RileyRankin OL 6-2 250 Fr./Fr. Florence,Ore.(Suislaw)60 ZachTucker LB 5-11 205 Fr./Fr. Dublin,Calif.(Dublin)61 NeilOchs OL 6-1 270 So./Fr. Wilsonville,Ore.(Wilsonville)61 AlexPate DL 6-2 225 Fr./Fr. Brookings,Ore.(Brookings-Harbor)62 ZakPorche LB 5-11 210 Fr./Fr. Olympia,Wash.(Timberline)63 JacobPowers LB 5-10 190 Fr./Fr. Hillsboro,Ore.(Hillsboro)63 WillUlrich OL 6-1 260 So./So. LakeElsinore,Calif.(Elsinore)64 CarsonHannibal LB 6-0 215 Fr./Fr. Salem,Ore.(Sprague)65 NikkNovero OL 6-3 265 Jr./Jr. Antioch,Calif.(Antioch)66 JamesPeckham OL 6-5 299 Fr./Fr. Everett,Wash.(ArchbishopMurphy)67 CesarMason LB 5-11 230 Fr./Fr. Kapolei,Hawaii(Kapolei)68 TimClaussen OL 6-4 220 Fr./Fr. Yamhill,Ore.(Yamhill-Carlton)69 TylerStewart DL 6-0 210 Fr./Fr. St.Helens,Ore.(St.Helens)70 SeanDalton OL 6-3 270 Jr./Jr. SanJose,Calif.(Leland)71 AustinZimbrick DL 6-1 240 Fr./Fr. St.Helens,Ore.(St.Helens)72 KevinPeterson OL 6-3 245 So./So. LakeOswego,Ore.(LakeOswego)73 BrandonSattelmeier OL 6-6 290 So./So. Temecula,Calif.(TemeculaValley)74 JustinFa’agau DL 6-2 250 So./So. Kahalu’u,Hawaii(DamienMemorial)75 ChrystianJohnson DL 6-3 200 Jr./Jr. RogueRiver,Ore.(RogueRiver)76 MikeSmith DL 6-3 275 Jr./Jr. Tumwater,Wash.(Tumwater)77 EricGietzen OL 6-0 305 Sr./Jr. Fargo,N.D.(PortlandStateUniv.)78 KevinDopps OL 5-11 285 So./So. Hermiston,Ore.(Hermiston)80 BrandonSelvey WR 6-0 190 Jr./Jr. Ventura,Calif.(Buena)80 AndrewSimons DL 6-1 205 Fr./Fr. OregonCity,Ore.(OregonCity)81 NickCapuzzi LB 5-11 190 Fr./Fr. Temecula,Calif.(TemeculaValley)81 JackMichels TE 6-5 240 Fr./Fr. Kirkland,Wash.(LakeWashington)82 CharlieReed-Dustin TE 6-2 210 So./So. Portland,Ore.(Madison)83 JordanJohnson WR 6-3 195 So./So. Wilsonville,Ore.(Wilsonville)83 AaronKoford P 6-1 190 Jr./Jr. Wilsonville,Ore.(Wilsonville)84 JasonSmith WR 6-1 189 Fr./Fr. BlackDiamond,Wash.(Tahoma)85 JoshHannum DL 6-0 220 Fr./Fr. Kailua,Hawaii(Iolani)85 KyleMerriam WR 5-8 175 Jr./Jr. WestLinn,Ore.(WestLinn)86 TylerGilmore P 6-3 175 Fr./Fr. Newberg,Ore.(Newberg)86 TaylorSchad OL 6-6 245 So./So. Aumsville,Ore.(Cascade)88 NateFerrell WR 5-8 157 Fr./Fr. Warrenton,Ore.(Warrenton)87 WillMarchbanks TE 6-3 250 Jr./Jr. Brownsville,Ore.(CentralLinn)87 ShahinMarzband WR 5-11 168 Fr./Fr. Hayward,Calif.(MoreauCatholic)88 CameronPumphrey WR 5-11 175 Jr./Jr. Quinault,Wash.(LakeQuinault)89 BlakeAnthony WR 5-7 160 So./So. Valencia,Calif.(Valencia)89 HeronAzevedo WR 5-9 175 Jr./Jr. RiodeJaneiro,Brazil(DiabloValleyJC)90 NickBieber FB 5-11 205 Fr./Fr. Gresham,Ore.(Barlow)90 ZachKrause DL 6-2 225 So./So. Clatskanie,Ore.(Clatskanie)91 EddieCarrillo DL 5-10 260 So./So. Milpitas,Calif.(Milpitas)91 MichaelMejia TE 6-2 190 Fr./Fr. Fresno,Calif.(SanJoaquinMemorial)92 DavidCarr WR 6-2 195 Fr./Fr. Gaston,Ore.(Gaston)93 KevinJo DL 6-0 215 So./Fr. Concord,Calif.(ClaytonValley)94 CalebWistock DL 6-2 215 Jr./Jr. Stayton,Ore.(Stayton)95 MilesDurant DL 6-0 225 Fr./Fr. Larkspur,Calif.(Redwood)97 PatrickPowell DL 5-10 265 Fr./Fr. GrantsPass,Ore.(GrantsPass)98 WesleyHooper DL 6-0 260 Sr./Sr. Estacada,Ore.(ClackamasCC)99 IraeHosea DL 5-10 340 Jr./So. Modesto,Calif.(Modesto) JustinCornair LB 5-9 185 So./So Kailua,Hawaii(Maryknoll) CharleyMoren LB 6-2 215 So./So. Seaside,Ore.(Seaside)

PACI

FIC

Foot

ball


2012 ReturnersLandon Aano

Junior • Defensive Lineman • 5-9 • 245Ewa Beach, Hawaii

Kamehameha HS

49

AANO’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 11 12 23 6.5 23 1 1 0 12010 9 9 8 17 3.5 10 0 0 0 1TOTAL 18 20 20 40 10.0 33 1 1 0 2

Sacks G UA A Total Yds2010 9 2 0 2 72011 9 3 0 3 17TOTAL 18 5 0 5 24

Austin AlvarezJunior • Running Back • 5-9 • 190

Stockton, Calif.Linden HS

25

ALVAREZ’S PACIFIC CAREER STATISTICSRushing G Att. Gain Loss Net Avg. TD Long Avg/G2011 4 0 0 0 0 0.0 0 0 0.02010 6 4 22 2 20 5.0 0 19 3.3TOTAL 10 4 22 2 20 5.0 9 19 3.3

Returns KO Returns Punt Returns No. Yds. Avg. Long No. Yds. Avg. Long 2011 0 0 0.0 0 0 0 0 02010 1 7 7.0 7 0 0 0 0TOTAL 1 7 7.0 7 0 0 0 0

2011:Playedinallninegamesandmadeeightstartsatdefensiveend…LedBoxerswith6.5tacklesforlossforatotalof23yards…AlsoledPacificwiththreesacks…Registeredfivetackleswith1.5tacklesforlossagainstMenloon9/10/11…Thenextweek,alsohadfivetackleswithonetackleforlossatClaremont-Mudd-Scrippson9/17/11…Alsopostedfive-tackleperformancewithatackleandasackagainstWillametteon10/8/11…InopeneragainstSimonFraseron9/3/11,finishedwithfourtackleswith1.5tacklesforloss,onesack,ablockedkickandrecoveredafumble.2010:Startedallninegamesatdefensiveend…Cameupwithseason-highthreetackles,allsolos,againstPugetSoundon10/30/10…FinishedwithtwosolotacklesandasackagainstLewis&Clarkon10/2/10andagainstWhitworthon10/23/10…AlsohadablockedkickattemptagainstthePioneers…Finishedseasonwith13tacklesandninesolotackles.

High School: PlayedforDavidStantatKamehamehaHighSchool…2009:FirstTeamHawaiiAll-StateandSecondTeamAll-InterscholasticLeagueofHonolulu(ILH)atdefensivetackle…OC16TeamPlayerAward…HawaiiPrepBowlparticipant….SeniorPlayeroftheYearawardrecipient…HelpedleadKamehamehatoHawaiistatechampionship…Finishedwith60tackles,including43forlosswith22sacksandtwoforcedfumbles…2008:HonorableMentionAll-ILHatdefensivetackle…Receivedtheteam’sUnderclassmanAward…Finishedwith45tackles,36forloss,and15sackswithtwoforcedfumbles…Alsoparticipatedinbasketballandtrackandfield…WasanHonorableMentionAll-ILHbasketballplayeratcenterandforward.Personal: SonofPaul&ReneAano…Businessmajorwithmarketingemphasis…ChosePacificbecauseofthegreateducationifoffers,becauseofitsreputationwithHawaiistudentsandforthefootballprogram…FavoriteTVShow:SonsofAnarchy…FavoriteQuote:Doyourjobthebestsothattheliving,thedeadandtheunborncannotdoitanybetter(Dr.MartinLutherKing,Jr.)…CareerAmbition:ToworkhiswayupinaFortune500company,becomeaneventplanner/managerandtoopenhisownrestaurant.

2011: Playedinfourgamesatrunningback.

2010:Playedinsixgamesatrunningback…Hadaseasonhighthreerushesfor19yardsagainstWhitworthon10/23/10…RegisteredonekickreturnforsevenyardsagainstClaremont-Mudd-Scrippson9/18/10.

High School: PlayedforMikeHuberatLindenHighSchool…FirstTeamAllMotherLodeLeagueinboth2008and2009whileplayingquarterback,runningbackanddefensiveback…Passedfor1,890yardsandrushedfor750yardwith30touchdownsin2009…Finishedwitha61.3completionpercentageatquarterback…Ledtheteamwith50tacklesin2010…Alsocompetedinvarsitybasketballandtrackandfield…WasaSecondTeamAll-MotherLodeLeagueselectioninbasketballandwasasectionalsqualifierintrackinthelongjumpandtriplejump.

Personal: SonofEricAlvarez&MarianLindo…Businessmajor…Hisfatherandcousin,RockyMartin,bothplayedsocceratUCDavis…ChosePacifictoplayfootballandtogetaqualityeducation…FavoriteTVShows:Grimm&NecessaryRoughness…FavoriteBook:ThePowerOfOne(BryceCourtenay)…FavoriteClassInSchool:Economics…CareerAmbition:Businessowner.

Blake AnthonySophomore • Wide Receiver • 5-7 • 160

Valencia, Calif.Valencia HS

89

2011:Playedinallninegamesandstartedfinalthreeofseasonatwidereceiver…FinishedthirdfortheBoxersinreceivingyardswith275yardson20catches…Hadseasonhighfourcatchesfor80yards,includingaseasonlong44-yardreception,againstMenloon9/10/11…Finishedwith64yardsonfourcatchesatWillametteon10/8/11.

High School: PlayedforLarryMuiratValenciaHighSchool…2010:FirstTeamAll-FoothillLeagueatreceiver…Scholar-AthleteAwardrecipient…Finishedwith540yardsreceivingwithfivetouchdowns.

Personal: SonofPatrick&Julie-AnneAnthony…Physicsandmathmajor…ChosePacificfortheexcellentacademicreputation,forthebeautifulcampusandforthefootballprogram…FavoriteTVShow:Mythbusters…FavoriteClassInSchool:Math…FavoriteQuote:Milkwasabadchoice(RonBurgundyinAnchorman)…CareerAmbition:Aerospaceengineer.

ANTHONY’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 9 20 275 13.8 0 44 30.6TOTAL 9 20 275 13.8 0 44 30.6

GOBO

XERS

.COM


2012 Returners

Craig BaileyJunior • Defensive Back • 5-10 • 182

Fairfield, Calif.Fairfield HS

15

BAILEY’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 13 5 18 0 0 11 0 0 02010 8 11 6 17 1 4 3 0 0 0TOTAL 17 24 11 35 1 4 14 0 0 0

Interceptions G No Yds Avg TD Lg2011 9 1 28 28.0 0 28TOTAL 9 1 28 28.0 0 28

Sean ArbogastSophomore • Wide Receiver • 6-1 • 195

Monroe, Ore.Monroe HS

3

2011:SawloneactionoftheseasonagainstLinfieldon10/15/11atwidereceiver.

High School: PlayedforBillCrowsonatMonroeHighSchool…2010:HonorableMention2AAll-StateselectionandFirstTeamAll-MountainViewConferenceatdefensiveback…SecondTeam2AAll-StateselectionandFirstTeamAll-MountainViewConferenceatreceiver…2009:HonorableMention2AAll-StateandFirstTeamAll-MountainViewConferenceselectionatreceiver…Four-yearvarsityletterwinner…Alsoplayedvarsitybasketballandbaseballandwasafour-yearletterwinnerinbothsports…WasanAll-MountainViewConferenceselectionatbothcatcheranddesignatedhitterandwasanall-stateselectionatdesignatedhitter…Wasalsoanall-leagueselectioninbasketball.

Personal: SonofMichael&AmieBodi…Businessmajorwithmarketingemphasisandcoachingminor…Chosebecausehereallylikedthecampusandthepeopleandforthechancetoplaywithanewandupcomingfootballteam…FavoriteTVShow:TrueBlood…FavoriteBook:Eragon(ChristopherPaolini)…FavoriteClassInSchool:History…CareerAmbition:ToworkatNike.

ARBOGAST’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 1 0 0 0.0 0 0 0.0TOTAL 1 0 0 0.0 0 0 0.0

Adam ArmstrongSophomore • Defensive Back • 5-9 • 185

Ventura, Calif.Ventura JC/Ventura HS

21

2011: Playedinthreegamesatdefensiveback.

High School: PlayedforBradStewardatVenturaHighSchool…2009: HonorableMentionAll-ChannelLeagueselectionatstrongsafety…Alsoplayedatlinebacker…Finishedwith63tacklesandonefumblerecovery…Alsoplayedvarsityfootball.

Personal:SonofAdam&KimberlyArmstrong…Historymajorandeducationandcoachingminor…HisyoungerbrotherwillplayfootballatCornellin2012…ChosePacificforthegreatopportunitytoplayfootballandtogetanamazingeducation…FavoriteTVShow:Workaholics…FavoriteBook:MadeInAmerica(MattHughes)…FavoriteClassInSchool:History…CareerAmbition:Historyteacherandfootballcoachorfirefighter.

2011: HonorableMentionAll-NWCatdefensiveback…Startedinallninegames…LedtheNWCwith11passbreakups…WastiedforthePacificleadwithoneinterception,pickingapassfora28-yardreturnagainstPugetSoundon10/29/11…Alsohadfourtacklesandfourpassbreakupsinthegame…Finishedwithfourtacklesinseasonopenervs.SimonFraseron9/3/11.

2010: Playedineightgamesandstartedthefinalthreegamesoftheyearatcornerback…Madeaseasonhigh5.5tackles,includingfivesolotackles,andonetackleforlossagainstWhitworthon10/23/10…Finishedwith3.5tacklesatPugetSoundon10/30/10.

Track & Field: CompetedasasprinterforthePacifictrackandfieldteamin2011…Competedinthe200metersattheNorthwestConferenceChampionships…Hadseasonbestsof11.45secondsinthe100meters,23.25secondsinthe200metersand51.77secondsinthe400meters.

High School: PlayedforJackCanavesioatFairfieldHighSchool…2009: All-MontecelloEmpireandall-countyselectionatwidereceiver…Rushedfor270yardswithtwotouchdowns…Alsoplayedatdefensiveback…Alsoparticipatedinvarsitybasketballandtrackandfield…Wasanall-leagueperformerandCaliforniastatemeetqualifierasasprinter.

Personal: SonofDarrell&DeniseBailey…Businessmajor…Hisbrother,James,competedintrackandfieldatChicoStateandSacramentoStatefrom2005to2009…ChosePacificbecausehelikedtheatmosphere,thepeopleandthecommunity…FavoriteTVShow:Martin…FavoriteBook:TheHungerGames(SuzanneCollins)…FavoriteClassInSchool:Economics…FavoriteQuote:Tobesuccessfulyouhavetobeselfishorelseyouneversucceed.Onceyougettothehighestlevel,thenyouhavetounselfish,stayreachable,stayintouch,don’tisolate(MichaelJordan)…CareerAmbition:Tobesuccessful.

Sean BangsJunior • Defensive Lineman • 6-3 • 230

Portland, Ore.Sunset HS

54

BANGS’ PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 6 7 13 1 8 0 0 1 02010 9 9 11 20 1 6 0 0 0 0TOTAL 18 15 18 23 2 14 0 0 1 0

Sacks G UA A Total Yds2011 9 1 0 1 8TOTAL 9 1 0 1 8

2011:Startedinallninegamesatdefensiveend…Notchedseasonhighthreetackles,ahalftackleforlossandregisteredahalfsackagainstWillametteon10/8/11…PickedupafumblerecoveryagainstClaremont-Mudd-Scrippson9/17/11…Postedtwo-tackleperformancesinthreegames.

2010:Playedinallninegamesandstartedthefirstfiveatdefensiveend…Finishedwithseasonhighfourtackles(2solo,4assist)atLewis&Clarkon10/2/10…Hadthreetackles(2solo,2assist)andonetackleforlossagainstWillametteon10/9/10.

High School: PlayedforMikeMitchellatSunsetHighSchool…2009:ThirdTeamAll-MetroLeagueselectionatoffensivelineanddefensiveend…ScholarAthleteandApolloPrideawardrecipient…2008:Varsitystarter…ScholarAthleteAward…Alsocompetedinvarsitytrackandfield.

Personal: SonofSean&KristinBangs…Historymajor…Hisuncle,BenBangs,playedfootballatWesternOregonandWesternState(Colo.)…ChosePacificforhighqualityeducationandthenewopportunityinfootball…FavoriteMovie:FightClub…FavoriteClassInSchool:History…FavoriteQuote:Doyouknowthatmyfavoritepartofthegameis?Theopportunitytoplay(MikeSingletary)…CareerAmbition:Highschoolhistoryteacherandcoach.

PACI

FIC

Foot

ball


2012 ReturnersT.C. Campbell

Junior • Quarterback • 5-11 • 190Kaimuki, Hawaii

Kamehameha HS

10

CAMPBELL’S PACIFIC CAREER STATISTICSPassing G Att. Cmp Int Yds TD Lg Pct. Avg/G Effic2011 9 130 219 10 1,838 13 87 59.4 206.4 141.02010 9 180 104 9 1,217 11 70 57.8 135.2 124.7TOTAL 18 399 234 19 3,075 24 87 58.6 170.8 133.7

Rushing G Att. Gain Loss Net Avg. TD Long Avg/G2011 9 49 65 141 -76 -2.0 0 20 -8.42010 9 49 108 237 -129 -2.6 0 15 -14.3TOTAL 18 87 173 378 -205 -2.4 0 20 -11.4

Josh BrinkworthSophomore • Defensive Lineman • 6-1 • 200

Elk Grove, Calif.Sheldon HS

3

2011:Playedinallninegamesandstartedthefinalfiveoftheseasonatdefensiveback…FinishedthirdfortheBoxerswith42tacklesandwasalsoamongtheteamleaderswiththreetacklesforloss…Registeredseasonhigheighttacklesontwooccasions…HadfoursoloandfourassistedtacklesalongwithahalftackleforlossagainstLewis&Clarkon10/1/11…HadfivesoloeffortsandthreeassistedtacklesalongwithasackagainstPugetSoundon10/29/11…Alsopostedapairofseven-tackleperformances,mostrecentlyatPacificLutheranon11/5/11…ScoredoneoftheBoxers’twosafetiesoftheseason,scoringinthefourthquarteragainstPugetSoundon10/29/11.

High School: PlayedforEdLombardiatSheldonHighSchool…2010:FirstTeamAll-DeltaLeagueselectionatsafety…WasselectedforOptimistAll-StarGame…2009:HonorableMentionAll-DeltaLeagueatmiddlelinebacker…2008:Selectedastheteam’sDefensivePlayeroftheYear…2007:Selectedastheteam’sDefensivePlayeroftheYear.

Personal: SonofJames&MelissaGilchrist…Majorisundecided…FavoriteTVShow:Dexter…FavoriteAthlete:AlexVanDyke…FavoriteMovie:FridayNightLights…FavoriteQuote:Nothinginlifeworthhavingcomeseasy.

BRINKWORTH’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 26 16 42 3 6 4 2 1 0TOTAL 9 26 16 42 3 6 4 2 1 0


Austin BrownSophomore • Linebacker • 6-1 • 205

Klamath Falls, Ore.Henley HS

40

2011:Playedinfourgamesatlinebacker...FinishedwithanassistedtackleagainstWillametteon10/8/11andasolotackleagainstPugetSoundon10/29/11.

High School:PlayedforBillHewesatHenleyHighSchool…Playedallfouryearsonvarsityatlinebacker,defensivebackandreceiver...Alsoparticipatedinvarsitybaseballandwrestling…WastheSkylineConferencechampionat171poundsin2011andhelpedleadHenleytothe2011Oregon4Astatewrestlingchampionship.

Personal: SonofBrian&ToniaBrown…Exercisesciencemajor…Hisuncle,JohnFairbank,playedfootballatOregonStatefrom1992to1996…ChosePacificfortheacademicprogramsthatPacificoffersandforthefootballprogram…FavoriteTVShow:BigBangTheory…FavoriteBook:OldHatNewHat(Stan&JanBererstain)…FavoriteClassInSchool:History…FavoriteQuote:Whenyoustopdoingthingsforfunyoumightaswellbedead(ErnestHemingway)…CareerAmbition:Teacherandcoach.

BROWN’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 4 1 1 2 0 0 0 0 0 0TOTAL 4 1 1 2 0 0 0 0 0 0

2011:HonorableMentionAll-NWCatquarterback…Startedallninegames…FinishedfourthintheNWCwithaverageof206.4passingyardspergame,fourthwith1,858yardspassingandfifthwith130completionsand13touchdowns…Setschoolsingleseasonrecordwithcompletionpercentageof59.4percent,betteringmarkof58.8percentsetbyFrankBuckiewicz,Jr.,in1976…Tiedhisownsinglegamerecordwithfivetouchdownpasseswhilethrowingfor387yardsinPacific’swinoverPugetSoundon10/29/11…Threwfor343yardswithtwotouchdownsinseasonopeneragainstSimonFraseron9/3/11…ThrewforthreescoresagainstLewis&Clarkon10/1/11…Connectedforan87-yardtouchdownpasstoJordanFukumotoatClaremont-Mudd-Scrippson9/17/11thatranksasthesecondlongestpassingplayinschoolhistory.

2010: Playedinallninegamesandstartedeightatquarterback…RankedseventhintheNWCinpassingyardspergame(135.2yardspergame)andeighthinbothpassefficiency(124.7)andtotaloffense(120.9yardspergame)…LedPacificquarterbackcorpsthatfinishedfourthintheNWCinpassingoffense(231.9yardspergame)…SetaPacificsinglegamerecordwith405yardspassingandtiedarecordwithfivetouchdownsin44-42season-endinglosstoMenloon11/13/10…Finishedwith222yardsofpassingandthreetouchdownsatPugetSoundon10/30/10…Hadseasonlong70-yardtouchdownpasstoJordanFukumotovs.Menloon11/13/10.

High School: PlayedforDavidStantatKamehamehaHighSchool…2009:HonorableMentionAll-InterscholasticLeagueofHonolulu(ILH)selectionatquarterback…HelpedleadKamehamehatotheHawaiistatechampionship…WasnamedPlayeroftheGameforthestatesemifinalgame…Alsoplayedvarsitybaseball…WasaFirstTeamAll-ILHselectionandHonorableMentionAll-Stateselectionatthirdbase.

Personal: SonofBruce&JeanCampbell…Physicsmajorandphilosophyminor…Hisuncle,GaryCampbell,playedfootballatColoradoandfortheChicagoBears…Hiscousin,NainoaCampbell,wasaDivisionIIAll-AmericanatMesaState(Colo.)…ChosePacificforthegoodeducationandforthebaseballandfootballplayers…FavoriteTVShow:HowIMetYourMother…FavoriteBook:TheHarryPotterseries(J.K.Rowling)…FavoriteAthleticMoment:WinningaHawaiistatefootballchampionship.

GOBO

XERS

.COM


2012 ReturnersEddie Carrillo

Sophomore • Defensive Lineman • 5-10 • 260Milpitas, Calif.

Milpitas HS

91

2011: Playedinallninegamesatdefensivelineman…MadefirstcollegiatestartagainstLewis&Clarkon10/1/11,finishingwiththreetacklesincludingoneforloss…Alsoregisteredthreetackles,allassistedefforts,atClaremont-Mudd-Scrippson9/17/11…HaslonesolosackoftheseasonagainstPugetSoundon10/29/11.

High School: PlayedforKellyKingatMilpitasHighSchool…2010:FirstTeamAll-SCVALDeAnzaLeagueselectionatdefensivetackle…Finishedwith87tackles,including35forlossandfoursacks…2009:Finishedwith37tackles,including11forlosswithfoursacksandtwoforcedfumbles.

Personal: SonofJose&SilviaCarrillo…Psychologymajor…ChosePacificforthegreatatmosphereandtogetagreateducation…FavoriteTVShow:FamilyGuy…FavoriteBook:TheCatcherInTheRye(J.D.Salinger)…FavoriteClassInSchool:Psychology…FavoriteQuote:Winningisn’teverything,butwantingtowinis(VinceLombardi)…CareerAmbition:Clinicalpsychologist.

CARRILLO’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 5 8 13 2.5 7 0 0 0 0TOTAL 9 5 8 13 2.5 7 0 0 0 0

Sacks G UA A Total Yds2011 9 1 1 2.5 7TOTAL 9 1 1 2.5 7

Daniel ChunSophomore • Defensive Back • 5-9 • 180

Hilo, HawaiiKamehameha-Hawaii HS

32

2012:Playedintwogamesatdefensiveback…CreditedwithasolotackleagainstWillametteon10/8/11.

High School:PlayedforDavidBaldwinatKamehameha-HawaiiHighSchool…2010: PlayedlinebackerofKamehameha’sBigIslandInterscholasticFederationchampionshipteam.

Personal:SonofAndrew&GinaChun…Businessmajor…HisfatherplayedfootballatDrake…Hisuncle,Jeff,playedfootballforPacificandanotheruncle,Mike,playedbaseballfortheBoxers…ChosePacificbecauseitseemedliketherightfitforhim…FavoriteTVShow:BigBang…FavoriteClassInSchool:Economics…Hobbies:Bowhuntingandlisteningtomusic.

CHUN’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 2 1 0 1 0 0 0 0 0 0TOTAL 2 1 0 1 0 0

Scotty CooperSophomore • Defensive Lineman • 6-3 • 220

Fullerton, Calif.Servite HS

48

2011:Playedineightgamesonthedefensiveline…CreditedforanassistedtackleagainstSimonFraseron9/3/11.

High School: PlayedforTroyThomasatServiteHighSchool…Sawtimeattightend,defensiveendandlongsnapper…2010:HelpedServitetoTrinityLeagueandPAC-5regionalchampionship…2009:MemberofServite’sCaliforniaInterscholasticFederationDivisionIIchampionshipteam…2008:MemberofServite’sTrinityLeaguechampionshipteam….Alsoparticipatedinvarsitytrackandfield.

COOPER’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 8 0 1 1 0 0 0 0 0 0TOTAL 8 0 1 1 0 0 0 0 0 0

Justin CornairSophomore • Linebacker • 5-9 • 185

Kailua, HawaiiMaryknoll HS

2011:Didnotplayduetoinjury.

High School: PlayedforKipBothellhoatMaryknollHighSchool…2010: HonorableMentionAll-InterscholasticLeagueofHonolulu(ILH)selectionatlinebacker…Finishedwithover100tackles…2009: HonorableMentionAll-ILHselectionatlinebacker…Alsoparticipatedinvarsitypaddlingwherehewasatwo-timeHonorableMentionAll-ILHselection.

Personal: SonofRexCornair…Businessmajorwithartminor…ChosePacificbecausehereallylovedtheschoolwhenhevisited…FavoriteTVShow:House…FavoriteBook:ToKillAMockingbird(HarperLee)…FavoriteClassInSchool:Psychology…FavoriteQuote:Themostimportantdayofyourlifeisnotthedayyouareborn,itisthedayyoufindoutwhy(JoeOnosai)…CareerAmbition:Businessowner.

Personal:SonofKen&ThereseCooper…Majorisundecided…FavoriteTVShow:TheSimpsons…FavoriteBook:TheBible…FavoriteClassInSchool:Philosophy…FavoriteQuote:Withoutfaith,nothingispossible.Withit,nothingisimpossible(MaryMcLeodBethune)…CareerAmbition:whateveritis,hewantstobethebest.

Sean DaltonJunior • Offensive Lineman • 6-3 • 270

San Jose, Calif.Leland HS

70

DALTON’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 0 1 1 0 0 0 0 0 02010 9 0 1 1 0 0 0 0 0 0TOTAL 9 0 1 1 0 0 0 0 0 0

2011: HonorableMentionAll-NorthwestConferenceselectionontheoffensiveline…Startedallninegames…EarnedcreditforanassistedtackleatWillametteon10/8/11.

2010:HonorableMentionAll-NorthwestConferenceatoffensiveline…Startedallninegames…RegisteredoneassistedtackleagainstMenloon11/13/10.

High School:PlayedforMikeCorrozzoatLelandHighSchool…2009:FirstTeamAll-Mt.HamiltonAthleticLeague(MHAL)selection…SecondTeamAll-SanJoseMercuryNewsteamasalineman…Wastheteam’sMostValuablePlayerontheoffensiveline…2007:SecondTeamAll-MHALselection…Alsocompetedinvarsitywrestling.

Personal: SonofSusanDalton…Sociologymajorandarthistoryminor…ChosePacificbecauseoftheenvironmentandthefootballcoachingstaff…FavoriteTVShow:AnythingontheDiscoveryChannel…FavoriteBook:TheHungerGames(SuzanneCollins)…FavoriteClassInSchool:Sociology.

PACI

FIC

Foot

ball


2012 ReturnersPetr Danchev

Sophomore • Running Back • 5-6 • 205Salem, Ore.McKay HS

41

2011: Playedinsixgamesatrunningback.

High School:PlayedforJayMinyardatMcKayHighSchool…2010: All-CentralValleyConferenceselectionatbothtailbackandlinebacker.

Personal:SonofPetr&VeraDanchev…Businessadministrationmajor…WasborninRussiaandlivedtheiruntilage4…FavoriteTVShow:BigBangTheory…FavoriteClassInSchool:Economics…FavoriteAthlete:AdrianPeterson.

DANCHEV’S PACIFIC CAREER STATISTICSRushing G Att. Gain Loss Net Avg. TD Long Avg/G2011 6 1 -1 0 -0.1 -0.1 0 0 -0.2TOTAL 6 1 -1 0 -0.1 -0.1 0 0 -0.2

Hunter DassonvilleJunior • Linebacker • 5-10 • 210

Gladstone, Ore.Gladstone HS

43

DASSONVILLE’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 6 5 4 9 3 5 0 0 0 02010 5 1 1 2 0 0 0 0 0 0TOTAL 11 6 5 11 3 5 0 0 0 0

2011: Playedinthefinalsixgamesoftheseasonatlinebacker…Finishedwithseasonhighfourtackles(2solo,2assist)andatackleforlossagainstPugetSoundon10/29/11…Hadtwotackles,includingoneforloss,againstLinfieldon10/15/11.

2010:Playedinfivegamesatlinebacker…SawhisfirstactioninfirsthomeNorthwestConferencegameagainstWillametteon10/9/10.

High School: PlayedforJonWolfatGladstoneHighSchool…2009:FirstTeamAll-CapitolConferenceatguard…Teamcaptain…Alsosawtimeatmiddlelinebacker…WasfinalistforNationalFootballFoundationandCollegeHallofFameScholar-AthleteoftheYear…2008: Receivedteam’sCoachibilityAward…Sawtimeatbothtightendandmiddlelinebacker…Alsocompetedinvarsitybaseball.

Personal: SonofAllan&DonnellDassonville…Physicsmajorandmathandcomputerscienceminor…ChosePacificbecauseofthecombinationofgreatschoolingandthechancetoplayonabrandnewfootballteam…FavoriteTVShow:BigBangTheory…FavoriteBook:InheritanceCycle(ChristopherPaolini)…FavoriteClassInSchool:Technology…FavoriteQuote:Perfectionisnotattainable,butifwechaseperfectionwecancatchexcellence(VinceLombardi)…CareerAmbition:Mechanicalengineer.

Ronnie De GuzmanSophomore • Defensive Back • 5-10 • 180

Dublin, Calif.Dublin HS

26

2011:Playedinfourgamesatdefensiveback…Finishedwithfourtackles,includingthreesoloefforts,atWillametteon10/8/11…AlsohadsingletacklesagainstLinfieldon10/15/11andPugetSoundon10/29/11.

High School: PlayedforCaseyMorenoatDublinHighSchool…Wasatwo-yearletterwinneratrunningbackanddefensiveback…Alsoparticipatedinvarsitytrackandfieldandbasketball…WasmemberofNorthCoastSectionchampionshipteamsinbothsports.

Personal:SonofRonald&CherylDeGuzman…Pre-occupationaltherapymajor…ChosePacificforacademics,athleticsandtheoccupationaltherapyprogram…FavoriteTVShow:ESPN…FavoriteBook:TheHarryPotterseries(J.K.Rowling)…FavoriteClassesInSchool:Frenchandhistory…FavoriteQuote:Weneverworriedabouttheopponent,onlyabouthowweweregoingtoplay(JohnWooden)…CareerAmbition:Occupationaltherapist.

DE GUZMAN’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 4 5 1 6 1 1 0 0 0 0TOTAL 4 5 1 6 1 1

Dominique DonaghySophomore • Linebacker • 5-10 • 220

Shoreline, Wash.Shorecrest HS

38

2011:MadeloneappearanceatlinebackeragainstLinfieldon10/15/11.

High School: PlayedforBrandonChristensenatShorecrestHighSchool…2010:FirstTeamAll-WescoLeagueselectionandselectedasShorecrest’sMostValuablePlayer…2009:FirstTeamAll-WescoLeagueselection…Wasnamedtheteam’sMostImprovedPlayer…2008:“ToughGuysOnlyAward”recipient…Alsoparticipatedintrackandfield.

Personal: SonofMichael&MarquittaDonaghy…Computersciencemajor…ChosePacificbecauseofthesmallclasssizesandthenewfootballprogram…FavoriteTVShow:SouthPark…FavoriteBand:Outkast…FavoriteAthlete:AndreJohnson.

Kevin DoppsSophomore • Offensive Lineman • 5-11 • 285

Hermiston, Ore.Hermiston HS

78

2011:Playedintwogamesatoffensivelineman.

High School:PlayedforMarkHodgesatHermistonHighSchool…WasaSecondTeamAll-ColumbiaRiverConferenceselection…Sawactionatcenter,guardanddefensivetackle…Alsoparticipatedinvarsitywrestling…WasamemberofHermiston’s2011wrestlingstatechampionshipteam.

Personal:SonofKen&KathyDopps…Majorisundecided…ChosePacificbecauseoffootballandpharmacyprograms…FavoriteTVShow:Sportscenter…FavoriteBook:Holes(LouisSachar)…FavoriteQuote:Detailsareeverythingandeverythingisadetail(Hisfather,KenDopps)…CareerAmbition:Somethinginbusinessandcoachingfootball.

DOPPS’ PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 2 0 0 0 0 0 0 0 0 0TOTALS 0 0 0 0 0 0 0 0 0 0

GOBO

XERS

.COM


2012 ReturnersKasey Dukes

Junior • Defensive Back • 5-9 • 160Wahiawa, Hawaii

Leilehua HS

7

DUKES’ PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 2 0 0 0 0 0 0 0 0 02010 8 11 2 13 0 0 0 0 1 0TOTAL 8 11 2 13 0 0 0 0 1 0

2011:Playedintwogamesatdefensivebackininjury-shortenedseason.

2010:Playedineightgamesandstartedthefirstsixgamesoftheseasonatdefensiveback…Hadseasonhighofthreetackles(allsolotackles)againstWillametteon10/9/10andWhitworthon10/23/10

High School: PlayedforNolanTokudaatLeilehuaHighSchool…2009:HonorableMentionAll-StateandAll-OahuInterscholasticAssociation(OIA)selectionatcornerback…AlsonamedaSecondTeamRedWestAll-Star.Personal: SonofPattyDukes…Sociologymajor…ChosePacificbecauseofthehomefeeling,thegreatcoachesandthefinancialaid…FavoriteTVShow:Sportscenter…FavoriteBook:AgathaChristiebooks…FavoriteClassInSchool:Orchestra….FavoriteQuote:Theimmaturemandoesnoblyforacause,whereasthematuremanliveshumblyforone…CareerAmbition:Counselor.

Justin Fa’agauSophomore • Defensive Lineman • 6-2 • 250

Kahalu’u, HawaiiDamien Memorial HS

74

2011: Playedinthreegamesonthedefensiveline…NotchedasolotackleagainstWillametteon10/8/11.

High School:PlayedforPunahouAinaatDamienMemorialHighSchool…2010: SecondTeamAll-InterscholasticAssociationofHonoluluselectionatoffensiveline…Alsosawtimeatdefensiveend…Laosplayedvarsityvolleyballasamiddleblocker.Personal:SonofTalosaga&Barbie-JoFa’agau…Businessmanagementmajor…ChosePacificbecauseofthewelcomingcommunityandcampusandtheup-and-comingfootballprogram…FavoriteSporttoWatch:Football…Hobbies:Goingtothebeach,cruisingwithfriendsandhavingagoodtime.

FA’AGAU’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 3 1 0 1 0 0 0 0 0 0TOTALS 3 1 0 1 0 0

Shane FeuerbachJunior • Linebacker • 6-1 • 220

Rocklin, Calif.Whitney HS

5

FEUERBACH’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 16 8 24 2 2 1 1 0 02010 9 9 9 18 1 1 0 0 0 0TOTAL 18 25 17 42 3 3 1 1 0 0

2011:Startedallninegamesatlinebacker…FinishedeighthfortheBoxerswith24tackles,including16solotackles…Finishedwithagame-higheighttackles,includingsevensoloeffortsandatackleforlossatClaremont-Mudd-Scrippson9/17/11…Finishedwiththreetacklesonthreedifferentoccasions,mostrecentlyagainstPugetSoundon10/29/11,wherehealsoforcedafumble.

2010:Playedinallninegamesandmadetwostartsatlinebacker...MadefirstcareerstartagainstWillametteon19/9/10...Finishedwithseasonhigh3.5tacklesagainstClaremont-Mudd-Scrippson9/18/10...HadapairofsolotacklesagainstWhitworthon10/23/10.

High School:PlayedforMikeGimenezatWhitneyHighSchool…2009: FirstTeamAll-PioneerValleyLeagueandHonorableMentionAll-Metroselectionatlinebacker…Teamcaptain…Finishedwith106tackles,twoforloss,threeinterceptionsandtwoforcedfumbles…Alsoparticipatedinvarsitytrackandfield.

Personal:SonofMark&JanFeuerbach…PoliticalsciencemajorandGermanminor…HisfatherplayedfootballatFresnoState…BrotherZacplaysfootballatMidlandLutheran(Neb.)andbrothersJasonandAdambothplayedfootballatUCDavis…ChosePacificforthelocation,theacademicreputationandthefootballprogram…FavoriteTVShow:FamilyGuy…FavoriteClassInSchool:Frenchhistory…FavoriteQuote:YougottalooklikeNo.1tobeNo.1(DeionSanders)…CareerAmbition:Tobeinanuclearexplosionandgainsuperpowers,thensavetheworld.

Gabe FloryJunior • Linebacker • 5-10 • 200

Davis, Calif.Davis HS

35

FLORY’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 16 8 24 2.0 2 1 1 0 02010 9 15 6 21 2.5 8 0 0 0 0TOTAL 18 31 14 45 4.5 10 1 1 0 0


2011:Playedinthreegamesatlinebacker…Inhisonlystartoftheseason,madefourtacklesincludingonesolotackleandahalftackleforlossagainstSimonFraseron9/3/11…HadsingletacklesagainstLinfieldon10/15/11andWhitworthon10/23/11.

2010: Playedinallninegamesatlinebacker...Notchedseasonhighfourtackles,allsolos,againstWhitworthon10/23/10...Finishedwith2.5tacklesagainstPacificLutheranon11/6/10...Totalof18tackleswaseighthbestfortheBoxers.

High School:PlayedforDanGazzanigaatDavisHighSchoolasalinebacker.

Personal:SonofJohn&DebiFlory…Exercisesciencemajorwithmotorbehavioremphasis…ChosePacificbecausethetownandthecollegeseemedtofithimperfectly...FavoriteTVShow:TheOffice...FavoriteBook:TheArtOfRacingInTheRain(GarthStein)…FavoriteClassInSchool:Physiology…FavoriteQuote:Don’tcrybecauseit’sover.Smilebecauseithappened(Dr.Seuss)...CareerAmbition:Acareerinnutritionandpersonaltraining.

PACI

FIC

Foot

ball


2012 ReturnersJordan Fukumoto

Junior • Wide Receiver • 5-10 • 170Mililani, Hawaii

St. Louis HS

29

FUKUMOTO’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 9 50 844 16.9 8 87 93.82010 9 30 603 20.1 9 79 67.0TOTAL 18 80 1,447 18.0 17 87 80.3

Rushing G Att. Gain Loss Net Avg. TD Long Avg/G2011 9 2 9 7 2 1.0 0 9 0.22010 9 1 1 0 1 1.0 0 1 0.1TOTAL 18 3 10 7 3 1.0 0 9 0.3

Returns KO Returns Punt Returns No. Yds. Avg. Long No. Yds. Avg. Long 2010 1 9 9.0 9 1 0 0.0 0TOTAL 1 9 9.0 9 1 0 0.0 0

2011:FirstTeamAll-NorthwestConferenceatwidereceiver…BecamePacific’sfirstAll-NWCFirstTeamselectionsince1984…Startedallninegames…LedPacificandrankedsecondintheNWCwith844receivingyards,93.8yardspergameand16.9yardspercatch…Finishedranked32ndamongNCAADivisionIIIplayersinreceivingyardspergameand64thwith5.56receptionspergame…AlsoledBoxersandrankedfourthinNWCwitheighttouchdowns…ScoredthreetouchdownsonsixreceptionsagainstLewis&Clarkon10/1/11…Caughtan87-yardtouchdownreceptionagainstClaremont-Mudd-Scrippson9/17/11,whichranksasthesecondlongestinschoolhistory…Hadseasonhigh313yardsinthatcontest…Scoredapairoftouchdownsonfivereceptionswith115yardsinwinoverPugetSoundon10/29/11.

2010: SecondTeamAll-NorthwestConferenceatwidereceiver,becomingPacific’sfirstAll-NWCselectionsince1984...StartedallninegamesfortheBoxers...FinishedrankedsixthintheNWCwith67receivingyardspergame...LedPacificintotalreceivingyards(603)andreceivingtouchdowns(6)andrankedthirdinall-purposeyards(68.1pergame)...Hadthesecondlongestreceptionintheconferenceallseason,takingaP.J.Minayapass79yardsforatouchdownagainstLinfieldon10/15/10...Caughtaseasonhighthreetouchdownpasses,includinga70-yardstrike,atMenloon11/13/10...Hadseasonbest180yardsreceivinginthatgame...Openedseasonwitha111-yardperformanceagainstPugetSoundon9/4/10.

High School: PlayedatSt.LouisHighSchoolinHonolulu,Hawaii.Personal:SonofJillIchikawa&JamesFukumoto…Pre-physicaltherapymajorandbiologyminor...Hisbrother,Jayson,playedfootballandbaseballfortheBoxersin2010-11…ChosePacificfortheacademics...FavoriteMovie:RushHour2…FavoriteQuote:Everydayisanotherdaytogetbetter…CareerAmbition:Physicaltherapist.

Travis GeorgeJunior • Offensive Lineman • 6-0 • 250

Grants Pass, Ore.North Valley HS

56

GEORGE’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 7 0 2 2 0 0 0 0 0 02010 9 2 5 7 0 0 0 0 0 0TOTAL 16 2 7 9 0 0 0 0 0 0

Eric GietzenJunior • Offensive Lineman • 6-0 • 305

Forest Grove, Ore.Forest Grove HS

77

2011: Appearedinsevengamesatlinebacker…FinishedwithonetackleagainstLinfieldon10/15/11andatWhitworthon10/22/11.

2010:Playedinallninegamesatlinebacker...Hadseasonhigh1.5tackles(1solo,1assist)againstLewis&Clarkon10/1/10...AlsoparticipatedonthePacifictrackandfieldteam...HadPacific’sfourthbestmarkinthediscusat144feet,5inches.

High School:PlayedforToddWillimanatNorthValleyHighSchool…EarnedFirstTeamAll-SkylineConferenceselectionatcenterandSecondTeamAll-SkylineConferenceatlinebacker…Alsoparticipatedinvarsitytrackandfieldandwrestling…WasaFirstTeamAll-SkylineConferenceandfifthplacestatefinisherat189pounds…WasalsoaSecondTeamAll-SkylineConferencepickintrackandfield.

Personal: SonofJon&KarenGeorge…Bioinformaticsmajor…Hisuncle,MikeGeorge,playedbasketballatLaneCC…HisfatherandunclePatGeorgealsoattendedPacific…ChosePacificfortheacademicprestige,thelocationawayfromhomeandforthefootballprogram...FavoriteQuote:Holdnoregrets…CareerAmbition:Doctor.

2011:Startedallninegamesontheoffensiveline.

2010:Startedallninegamesatoffensiveline..Sawmostofhistimeatguard.

High School: PlayedforcurrentPacificassistantcoachMikeMcCabeatForestGroveHighSchool…Two-wayplayersawactiononboththeoffensiveanddefensiveline.

Personal:SonofJon&RobinGietzen…Sociologymajor…Hisfatherearnedhismaster’sdegreefromPacificandhisbrotherJoshisa2010graduatewithadegreeinmusic…ChosePacificbecausetheschoolhasalwaysbeenapartofhislifeandbecauseofhisfamilyconnections…FavoriteTVShows:30Rock,ArrestedDevelopment,TheKilling,FuturamaandDocMartin…FavoriteBooks:GameofThrones(GeorgeR.R.Martin)andtheBugManseries(TimDowns)…FavoriteClassInSchool:Introductiontoclassicalmusic…FavoriteQuote:Gowearthet-shirtandstandonthesidelineifthat’swhatyouwant.Buildingabride,adamoracollegefootballprogramisnotfortheweek(IanFalconer)…CareerAmbition:Socialworkcounselor.

GOBO

XERS

.COM


2012 ReturnersBrandon Hand

Sophomore • Defensive Lineman • 6-1 • 235Auburn, Wash.

Auburn Riverside HS

46

2011:Playedinfourgamesasadefensivelineman…Hadseasonhighthreetackles,includingonetackleforloss,atWillametteon10/8/11…AlsohadthreesolotacklesatWhitworthon10/22/11…Hadtwotackles,includingahalfsackandhalftackleforlossatPacificLutheranon11/5/11.

High School:PlayedforBobMorganatAuburnRiversideHighSchool…2010:Washingtonall-stateselectionatoffensiveline…FirstTeamAll-SouthPugetSoundLeague(SPSL)selectionatbothoffensiveanddefensiveline…Wasnamedtheteam’smostinspirationalplayer…Finished52tackles,threeforcedfumbles,17tacklesforlossand4.5sacks…2009:All-SPSLpickatdefensiveline…Alsoparticipatedinvarsitytrackandfieldandswimming…HelpedsetAuburnRiverside’sschoolrecordinthe200-yardfreestylerelay.

Personal:SonofKen&SuziHand…Majorisundecided…ChosePacificitwasoneofthefewschoolshereallyconnectedwithandforthefootballprogram…FavoriteTVShow:House…FavoriteClassInSchool:Psychology…FavoriteAthlete:VernonDavis.

HAND’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 4 5 4 9 1.5 10 0 0 0 0TOTAL 4 5 4 9 1.5 10 0 0 0 0

Sacks G UA A Total Yds2011 4 0 1 0.5 5TOTAL 4 0 1 0.5 5

Brandon HarmsSophomore • Defensive Back • 5-10 • 185

Canby, Ore.Canby HS

8

2011: Playedinallninegames,withmostofhisworkcomingonspecialteamsasareturnspecialist…Hadtwokickreturnsforatotalof41yards,includingalongof22yards,againstLinfieldon10/15/11…Hadseason-longpuntreturnof22yardsagainstSimonFraseron9/3/11…Alsosawactionasadefensiveback,registeringaseasonhighofsixtackles(4solo,2assist)atPacificLutheranon11/5/11.

High School:PlayedforMikeDotyandMikeVaughtatCanbyHighSchool…2010: SecondTeamAll-ThreeRiversLeagueselectionatdefensiveback…Alsoplayedatrunningback…Alsoparticipatedinvarsitywrestling…WasThreeRiversLeaguechampionin2011.

Personal:SonofJohn&CarolStrnad…Physicsandmathematicsmajor…ChosePacificfortheverysuccessfulacademicprogramsandthefootballprogram…FavoriteTVShow:JerseyShore…FavoriteBook:Ender’sGame(OrsonScottCard)…FavoriteClassInSchool:Math…FavoriteQuote:Ifyouain’tfirst,you’relast(RickyRobby)…CareerAmbition:Engineer.

HARM’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 12 3 15 0 0 1 0 0 0TOTAL 9 12 3 15 0 0 1 0 0 0

Returns KO Returns Punt Returns No. Yds. Avg. Long No. Yds. Avg. Long 2011 2 42 20.5 22 10 42 4.2 22TOTAL 2 42 20.5 22 10 42 4.2 22

Andy HarrisSophomore • Defensive Back • 6-3 • 195

Midvale, UtahHillcrest HS

23

2011:Playedinfivegamesatdefensiveback…Finishedwithseasonbesttwotackles(onesolo,oneassist)againstWillametteon10/8/11.

High School:PlayedforKirkMerishatHillcrestHighSchool…2010:All-Region4selectionatcornerback…AcademicAll-Regionselection…Registered51tacklesandforcedonefumble..2009:All-Region4selectionatcornerback…AcademicAll-Regionselection…Finishedseasonwith44tackles…Alsoparticipatedinvarsitybasketballandtrackandfield.

Personal: SonofMike&BeckyHarris…Businessmajor…ChosePacificbecausehereallylikedtheschool,coachingstaffandplayers…FavoriteTVShow:CriminalMinds…FavoriteBook:TheHungerGames(SuzanneCollins)…FavoriteClassInSchool:Math…FavoriteQuote:Noregrets…CareerAmbition:Financialadvisor.

HARRIS’ PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 5 2 2 4 0 0 0 0 0 0TOTAL 5 2 2 4 0 0 0 0 0 0

Tim HastieJunior • LInebacker • 6-1 • 240

Auberry, Calif.Auberry HS

47

HASTIE’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 27 29 56 6.5 19 1 0 0 12010 9 23 17 40 1.5 10 0 0 0 0TOTAL 18 50 46 96 8.0 29 1 0 0 1

Sacks G UA A Total Yds2011 9 1 0 1 22010 9 1 0 1 10TOTAL 18 2 0 2 12

Interceptions No Yds Avg TD Lg2011 1 3 3.0 0 3TOTAL 1 3 3.0 0 3

2011:Startedallninegamesatlinebacker…FinishedsecondforBoxerswith62totaltackles…LedBoxersandfinished11thintheNWCwith29assistedtackles…Sharedteamleadwith6.5tacklesforlossfor19yards…Finishedwithteamhighninetacklesand2.5tacklesforlossagainstMenloon9/10/11…Alsopostednine-tackleperformancewithonetackleforlossagainstLinfieldon10/15/11…Hadapairofeight-tackleperformancesagainstWhitworthon10/22/11andPugetSoundon10/29/11…HadPacific’sfirstinterceptionoftheseasonagainstSimonFraseron9/3/11.

2010: Playedinallninegamesandstartedthefinalfivegamesoftheyearatlinebacker...Totalof31.5tackleswassecondmostforBoxers...Finishedwith1.5tacklesforlossandonesack...Notchedseasonhighof6.5tackles(4solo,5assists)atMenloon11/13/10...FinishedwithsixsolotacklesagainstPugetSoundon10/30/10.

High School:PlayedatSierraHighSchool…2009: FirstTeamAll-NorthSequoiaLeagueandSecondTeamCaliforniaSmallSchoolAll-Stateatlinebacker…Finishedwith165tackles…2008:FirstTeamAll-NorthSequoiaLeagueatlinebacker…Finishedwith96tackles…Alsosawtimeatrunningback,tightendandguard…Alsoparticipatedinvarsitybasketballandtrackandfield…HelpedSierraplaytoabasketballstatesectionalchampionship.

Personal: SonofRob&KathyHastie…Philosophymajorwithemphasisonethics,lawandsocietyandbusinessadministrationminor…Hisuncle,JimHastie,playedfootballatUCDavis…ChosePacificbecausehewantstohelpstartafootballlegacy…FavoriteSportToWatch:Basketball…CareerAmbition:Lawyer.

PACI

FIC

Foot

ball


2012 ReturnersTaylor Hickson

Junior • Wide Receiver • 6-3 • 200Red Bluff, Calif.

Red Bluff HS

30

HICKSON’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2010 7 6 98 16.3 2 32 14.0TOTAL 7 6 39 18.3 2 32 14.0

2011: Didnotplayduetoinjury.

2010:Playedinsevengamesatwidereceiver...ScoredthefirsttouchdownofthereinstatedPacificprogramona32-yardpassplayagainstPugetSoundon9/4/10...Hada10-yardtouchdownreceptionagainstWhitworthon10/23/10.

High School: PlayedatRedBluffHighSchool…2009:Finishedwith464yardsandseventouchdownsatwidereceiver…Alsocompetedinvarsitywrestlingandtrackandfield…Wasasectionalplacewinnerinbothsports.

Personal:SonofScott&NancyHickson…Historymajorandpoliticalscienceminor…Hiscousin,PaulNewman,playedbaseballatWyoming…ChosePacificforitsatmosphere,itsclosetohomelocationandthefootballprogram…FavoriteTVShow:Squidbillies…FavoriteBook:GodDelusion(RichardDawkins)…FavoriteClassInSchool:U.S.inforeignaffairs…FavoriteQuote:Thesuperiormanasksnotwhyhsisnotknown,butratherwhathemustdotobeknown(Confucious)…CareerAmbition:Highschoolhistoryteacherandcoach.

Wesley HooperSenior • Defensive Lineman • 6-0 • 260

Estacada, Ore.Clackamas CC/Estacada HS

98

2011:Playedintwogamesonthedefensiveline.

2010:Playedinthreegamesonthedefensiveline.

High School: PlayedforBrighamBakeratEstacadaHighSchool…Sawactionatdefensiveend,defensivetackle,offensiveguard,offensivetackleandcenter…Alsoplayedvarsitytennis.

Personal: SonofJames&MaraHooper…Historymajor…ChosePacificbecausehelovedtheareaandbecauseit’sagreatschool…FavoriteTVShow:NFLTopTen…FavoriteBook:RicochetRiver(RobinCody)….FavoriteQuote:Ifirmlybelievethatanyman’sfinesthour,thegreatestfulfillmentofallthatheholdsdear,isthatmomentwhenhehasworkedhisheartoutinagoodcauseandliesexhaustedonthefieldofbattle(VinceLombardi).

Irae HoseaSophomore • Defensive Lineman • 5-10 • 340

Modesto, Calif.Modesto HS

99

2011: Didnotplay.

2010:Didnotplay.

High School: PlayedforRodLongatModestoHighSchool…WasanAllModestoMetropolitanConferenceandall-districtselectionatdefensivetackle.

Personal:SonofFareti&GauiHosea…Filmandcreativewritingmajor…ChosePacificbecauseitwasinOregon…FavoriteTVShow:Supernatural…FavoriteBook:PercyJackson&TheOlympians(RickRiordan)…FavoriteClassInSchool:Expositorywriting…CareerAmbition:Musicvideodirectorandradiopersonality.

Chrystian JohnsonJunior • Defensive Lineman • 6-3 • 200

Rogue River, Ore.Rogue River HS

75

JOHNSON’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 8 7 15 2 4 0 0 0 02010 8 10 7 17 3 17 1 1 0 0TOTAL 17 18 14 32 5 21 1 1 0 0

Sacks G UA A Total Yds2011 9 0 1 0.5 02010 8 1 1 2.0 14TOTAL 17 1 2 2.5 14

2011:Startedallninegamesatdefensiveend…Notchedseasonhighfourtackles,includingahalftackleforloss,atClaremont-Mudd-Scrippson9/17/11…Puttogetherthree-tackleperformancewithahalfsackagainstLewis&Clarkon10/1/11…Hadatackleinallbutonegame.

2010:Playedineightgamesandstartedthefinalsevenatdefensiveend...Finishedwithaseason-high3.5tacklesagainstWhitworthon10/23/10,whichincludedanassistedtackleforloss...Had2.5tacklesandassistedonasackagainstPugetSoundon10/30/10...EarnedcreditforaforcedfumbleatLinfieldon10/16/10.

High School:PlayedforMarvinGroveratRogueRiverHighSchool…2009:HonorableMentionAll-SunsetConferenceatdefensiveend…NamedtotheGrantsPassDailyCourier’sAll-AreaDefensiveTeam…Finishedseasonwith61tackles,sixsacksandtwofumblerecoveries…Teamcaptain…2008:SecondTeamAll-SunsetConferenceattightend…NamedtoGrantsPassDailyCourier’sAll-AreaOffensiveTeam…SelectedastheOldSpiceRedZonePlayeroftheYearforRogueRiver…Teamcaptain…2007:HonorableMentionAll-SkylineConferenceatdefensiveend…2006:HonorableMentionAll-SkylineConferenceatoffensiveline…Alsocompetedinvarsitytrackandfieldandbasketball…Finishedsixthatthe2010Oregonstatechampionshipsinthe110-meterhighhurdles.

Personal:SonofLewisJohnsonandAmyFrantz…Internationalstudiesandpoliticalsciencemajorandpublichealthminor…ChosePacificbecauseithadagreatblendofstrongacademicsandbuildinganewfootballprogram…FavoriteTVShow:TheFreshPrinceOfBel-Air…FavoriteBook:TheBible…FavoriteQuote:Wemustusetimewiselyandforeverrealizethereisalwaystimetodotherightthing(NelsonMandela)…CareerAmbition:UnitedStatesambassador.

Jordan JohnsonSophomore • Wide Receiver • 6-3 • 195

Wilsonville, Ore.Wilsonville HS

83

2011:SawloneactionoftheseasonatwidereceiveragainstLinfieldon10/15/11.

High School:PlayedforAdamGuentheratWilsonvilleHighSchool...2010:All-NorthwestOregonConference(NWOC)selectionatcornerback...Finishedwith23tacklesandrecoveredthreefumbles...Alsoplayedvarsitybaseball.

Personal:SonofTroyJohnson&AngieWebbers…Businessmajorwithfinanceemphasis…ChosePacificforthegreatcampus,goodcoaches,goodfacilitiesandgoodpeople…FavoriteTVShow:TheOffice…FavoriteBook:ForOneMoreDay(MitchAlbom)…FavoriteClassInSchool:Economics…FavoriteQuote:Ifbetterispossible,thenbeinggoodisn’tenough…CareerAmbition:Chieffinancialofficer.

GOBO

XERS

.COM


2012 ReturnersNick Johnson

Sophomore • Wide Receiver • 5-9 • 155Salem, Ore.

Blanchet Catholic HS

5

2011:Playedinonegameatwidereceiver.

High School:PlayedforMattArnoldatBlanchetCatholicHighSchool…2010:FirstTeamAll-Pac-WestConferenceandFirstTeamOregon3AAll-Stateselectionatdefensiveback…HonorableMentionAll-Pac-WestConferenceatwidereceiver…SelectedtoEast-WestShrineGame…Finishedwith500receivingyardand490rushingyardswith15touchdowns…Had22tacklesasadefensivebackwithtwofumblerecoveries…2009:FirstTeamAll-Pac-WestConferenceatbothwidereceiverandrunningback…HonorableMentionOregon3AAll-Stateselectionatwidereceiver…Finishedwith600yardsreceivingand100yardsrushingwith12touchdowns…Ledthestateinreceptions…Alsoplayedvarsitygolfandbasketball…Wasathree-timeall-stateselectionandtwo-timePac-WestConferencechampioningolf.

Personal: SonofRockyJohnson…Historymajorandmathminor…HisfatherplayedbaseballatOregon…Hisuncle,Marty,playedfootballatWesternOregonanduncleLaneplayedbasketballatLewis&Clark…Hiscousin,Jordan,playsfootballatMontana…ChosePacificbecausehelikedthecampusandthefootballprogram…FavoriteTVShow:ModernFamily…FavoriteBook:10,000to1(BenPetrick)…FavoriteClassInSchool:Math…FavoriteQuote:Togiveanythinglessthanyourbestistosacrificethegift(StevePrefontaine)…CareerAmbition:Highschoolmathteacherandfootballcoach.

Darin KamealohaSophomore • Wide Receiver • 5-10 • 175

Waiphahu, HawaiiHanalani HS

9

2011:Didnotplayduetoinjury.

2010: Playedintwogamesatwidereceiverbeforeseeingseasonendedbyinjury…Madefourcatchesfor31yardsatPugetSoundon9/4/10.

HighSchool:PlayedforKipBotelhoattheHanalaniSchool…2009:SecondTeamHawaiiAll-StateandFirstTeamAll-InterscholasticLeagueofHonolulu(ILH)atreceiver…Finishedwith1,172yardsoftotaloffensewithninetouchdowns,65receptionsand24rushingattempts…2008:ThirdTeamAll-StateandFirstTeamAll-ILHselection…Finishedwith579receivingyardsand183rushingyardswith11touchdowns…Alsoplayedvarsitybasketballandvolleyball…WasanHonorableMentionAll-StateandFirstTeamAll-ILHDivisionIIselectionatpointguardandaSecondTeamAll-ILHDivisionIIselectioninvolleyball.

Personal:SonofGuy&KaleoKamealoha…Exercisesciencemajor…Hisuncle,WesleyPhillips,playedfootballatSantaRosaJC…ChosePacificbecauseithadthedegreehewantedandforthefootballprogram…FavoriteTVShow:HowIMetYourMother…FavoriteAthlete:ChadOwens…CareerAmbition:Physicaltherapist.

KAMEALOHA’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2010 2 5 39 7.8 0 11 19.5TOTAL 2 5 59 7.8 0 11 19.5

Kelson KawaiJunior • Wide Receiver • 5-7 • 155

North Kohala, HawaiiKohala HS

28

KAWAI’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 9 17 299 17.6 1 70 49.82010 6 30 603 7.0 1 23 17.8TOTAL 15 47 902 19.1 2 70 60.1

Rushing G Att. Gain Loss Net Avg. TD Long Avg/G2010 9 1 4 0 4 4.0 0 4 0.4TOTAL 9 1 4 0 4 4.0 0 4 0.4


2011:Playedinsixgamesandstartedthefirstfivegamesoftheyearatwidereceiver…Missedthreegamesduetoinjury…FinishedsecondforBoxerswith299yardsreceivingon17catches…Finishedwith70yardsandatouchdownonthreecatchesagainstMenloon9/10/11…Amassed115yardsonfivecatcheswithaseasonbest77-yardreceptionagainstLewis&Clarkon10/1/11…Alsoplayedkeyroleonkickreturnandfinishedsecondforteamwith226yardsandan18.8yardsperreturnaverage…Finishedwithseasonhigh95returnyardsatWillametteon10/8/11.

2010: Startedallninegamesatwidereceiverandalsoplayedkeyroleonspecialteams...FinishedRankedfourthintheNWCandledBoxersinkickreturnswithanaverageof20.4yardsperreturn(552yardstotal)...LedtheBoxerswith716all-purposeyards...RankedsecondfortheBoxerswith17.8yardspercatchreceivingon23catches...Hadseasonhighof57yardsreceivingandhadhisonlytouchdownoftheseasonagainstPacificLutheranon11/6/10...Finishedwith42yardsagainstMenloon11/13/10...Finishedwith105yardsonfourkickreturns,includinga78-yardrunback,againstWhitworthon10/23/10...Finishedwith87yardsonreturnsagainstWillametteon10/9/10.

High School:PlayedatKohalaHighSchool.Personal: SonofKeoki&MargaretKawai…Exercisesciencemajor…ChosePacificbecauseofthesmallenvironmentandforthefootballandtrackprograms…FavoriteMovie:FridayNightLights…FavoriteMusician:BobMarley.

PACI

FIC

Foot

ball


2012 ReturnersBryce Kershner

Sophomore • Running Back • 5-11 • 200Jordan Valley, Ore.

Jordan Valley HS

33

KERSHNER’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 9 4 22 5.5 0 9 3.22010 9 2 20 10.0 0 11 2.2TOTAL 18 6 42 7.0 0 11 2.3

Rushing G Att. Gain Loss Net Avg. TD Long Avg/G2011 9 17 57 4 53 3.1 2 9 5.82010 9 2 4 0 4 2.0 0 4 0.4TOTAL 18 19 61 4 57 3.0 2 9 3.3

Aaron KofordJunior • Punter • 6-1 • 190


83

KOFORD’S PACIFIC CAREER STATISTICSPunting G No Yds Avg Long TB FC I20 Blkd2011 9 48 1,599 33.3 52 2 9 13 32010 8 4 121 30.2 40 0 1 0 0TOTAL 17 52 1,720 33.0 52 2 10 13 3

Kickoffs G No Yds Avg TB OB2011 9 32 1,730 54.1 0 02010 8 3 146 48.7 0 0TOTAL 17 35 1,876 53.6 0 0

2011:PlayedinallninegamesastheBoxers’primarypunter…FinishedrankedsecondintheNWCwith48punts,thirdwith1,599puntingyardsandfifthwithpuntingaverageof33.3yardsperkick…Hadlongpuntof52yardstwice,againstMenloon9/10/11andatPacificLutheranon11/5/11…IntheMenlogame,fiveofhissevenpuntslandedinsidethe20-yardline…AlsoservedasPacific’sprimarykickoffkickerandaveraged54.1yardsperkickoff.

2010:Playedineightgamesbothatreceiverandonkickoffandpuntingduties...Puntedfourtimesfor121yardsandalongpuntof40yardsagainstWillametteon10/9/10...HadkickoffdutiesinthreeoftheBoxers’finalfourgames,whichincludeda52-yardkickagainstPacificLutheranon11/6/10.

High School: PlayedforDougSommeratWilsonvilleHighSchool…Three-yearvarsityathleteatoutsidelinebacker…SecondTeamAll-NorthwestOregonConferencein2009atoutsidelinebacker…Alsoparticipatedinvarsitybasketballandtrackandfield…WasaFirstTeamAll-NorthwestOregonConferenceandHonorableMentionAll-Stateselectioninboththe200metersandthediscus.

Personal:SonofTad&CariKoford…Literaturemajor…HismothercompetedinvolleyballandheruncleDaveplayedbaseballatTreasureValleyCC…HisuncleScottCampbellwrestledandgrandfatherDaveCampbellcompetedinfootball,wrestlingandtrackatBlackHillsStateinSouthDakota…ChosePacificbecauseitwasagreatacademicschool,nearbytohomeandfamilyandbecauseofthenewfootballteam…FavoriteTVShow:Grimm…FavoriteBook:JurassicPark(MichaelCreighton)…FavoriteClassInSchool:Poetry…FavoriteQuote:Nowifthere’sonethingyoucanbesureof,it’sthatnothingismorepowerfulthanayoungboy’swish.ExceptanApachehelicopter(PatrickStewart)…CareerAmbition:Highschoolteacherandcoach.

Bobby LadigesSophomore • Running Back • 5-10 • 225

Escalon, Calif.Manteca HS

27

2011:Playedintwogamesatrunningback…Hadseasonbestsofeightyardsrushingand10yardsreceivingatPacificLutheranon11/5/11.

High School: PlayedforEricReisatMantecaHighSchool...2010:WasaSecondTeamCaliforniaAll-Stateandfirstteamall-districtselectionatrunningback...Wasalsofirstall-leagueandall-districtselectionatlinebacker...WasnamedManteca’steammostvaluableplayer...Finishedwith1,650yardsreceivingand2372yardsrushingwith27touchdowns...Ondefense,had33tackles,includingnineforloss,twosacksandthreeforcedfumbles...2009:Honorablementionall-leagueselectionatfullback...Finishedwith248yardsrushingwithfivetouchdowns...Defensively,had41tackles,includingnineforlossandfoursacks...Alsocompetedinvarsitytrackandfield.Personal: SonofJoshFarris…Exercisesciencemajor…ChosePacificbecauseitwasclosetohomeandhehadtheopportunitytoplayrightaway...FavoriteTVShow:TwoAndAHalfMen...FavoriteMovie:Twister...FavoriteClassInSchool:Art.

2011:Playedinallninegamesatrunningback…FinishedasPacific’sthirdleadingrusher,gainatotalof51yardsontheground…Scoredhisfirstcollegiatetouchdownonashorttwo-yardrushagainstSimonFraseron9/3/11…Scoredthree-yardreceivingtouchdownagainstLewis&Clarkon10/1/11andalsoscoredonatwo-yardpassplayatPacificLutheranon11/5/11…Rushedforseasonhigh22yardsonsixcarriesagainstPugetSoundon10/29/11.

2010: Playedinallninegamesatrunningback...CollectedaseasonhighfouryardsonthegroundagainstPugetSoundon10/30/10...Hadtworeceptionsfor20yardsagainstMenloon11/13/10.

High School: PlayedforTimMcBrideatJordanValleyHighSchool…FirstTeamAll-HighDesertLeagueandnamedastheleague’sPlayeroftheYearin2009whileplayingatrunningback,cornerbackandonkickreturn…Passedfor753yardsandrushedfor1,593yardswith31touchdowns…Defensivelyhad175tacklesand34forlosstogoalongwithonesack…AlsoplayedbasketballwherehewasaHonorableMentionAll-HighDesertLeagueselection.

Personal: SonofKenny&TeresaKershner…Businessadministrationmajorandexercisescienceminor…ChosePacificforthegreateducationalopportunityandthechancetostartanewfootballtradition…FavoriteTVShow:TheBigBangTheory…FavoriteBook:SalughterhouseFive(KurtVonnegut)…FavoriteClassInSchool:Economics…CareerAmbition:Togetajob.

LADIGES’ PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 2 1 10 10.0 0 10 5.0TOTAL 2 1 10 10.0 0 10 5.0


GOBO

XERS

.COM


2012 ReturnersDevin Lagorio

Junior • Defensive Lineman • 6-2 • 275Stockton, Calif.

St. Mary’s HS

52

LAGORIO’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 16 11 27 3.5 9 1 0 0 12010 6 10 3 13 3.0 5 0 0 0 0TOTAL 15 26 14 40 6.5 14 1 0 0 1


2011:Startedallninegamesonthedefensiveline…FinishedseventhfortheBoxerswith27tackles…Finishedwithseasonhighoffivetacklestwice…HadfivetacklesandoneforlossagainstLewis&Clarkon10/1/11…Finishedwithfivetackles(4solo)andahalftackleforlossatWhitworthon10/22/11…HadasackagainstPugetSoundon10/29/11…InLewis&Clarkgame,hadtheblockedextrapointkickthatledtoBryanMills’100-yarddefensivetwo-pointconversionthatwasfeaturedonESPN’sSportsCenter.

2010: Playedinsixgamesandstartedthefirsttwooftheseasonatdefensiveend...Postedseasonhighfourtackles,includingoneforloss,againstClaremont-Mudd-Scrippson9/18/10...FinishedwiththreesolotacklesagainstLewis&Clarkon10/2/10.

High School: PlayedforTonyFranksatSt.Mary’sHighSchool…2009:FirstTeamAll-Tri-CountyAthleticLeague(TCAL)andfirstteamall-areaselectionasalineman…HelpedleadSt.Mary’stofirstundefeatedregularseasonin30years…Finishedwith65tackles,sixsacksandonecausedfumble…Wasnamedtheteam’sOutstandingDefensiveLineman…2008:Finishedwith28tackles,twosacksandtwofumblerecoveries…ParticipatedintheCaliforniaDivisionIIStateBowlGame.

Personal:SonofKevin&MistiiLagorio…Politicalsciencemajor...HisfatherplayedoneofyearofbasketballattheUniversityofthePacific…ChosePacifictoreceiveaqualityeducation,theatmosphereoftheschoolandtocontinueplayingthesportheloves…FavoriteTVShow:BlueMountainState...FavoriteBook:WhenTheGameStandsTall(NeilHayes)...FavoriteClassInSchool:Politicalscience...FavoriteQuote:Ourdeepestfearisnotthatweareinadequate.Ourdeepestfearisthatwearepowerfulbeyondmeasure(MarianneWilliamson)...CareerAmbition:Lawyer.

Jakob LawrenceSophomore • Wide Receiver • 6-2 • 195

Sherwood, Ore.Sherwood HS

4

2011:Playedinsevengamesatwidereceiver…Hadseasonbest16-yardcatchagainstLewis&Clarkon10/1/11.

HighSchool:PlayedforGregLawrenceatSherwoodHighSchool...2010:FirstTeamAll-NorthwestOregonLeagueselectionatbothwidereceiverandlinebacker...Finishedwith415yardsandfourtouchdowns,averaging18yardspercatch...Ondefense,finishedwith58tackles,asack,threefumblesandtwointerceptions...2009:Finishedwith186yardsreceivingwithfourtouchdowns...Defensively,had49tackles,twofumblesandtwointerceptions...Alsoplayedvarsitybasketballandbaseball...WasanHonorableMentionOregon5AAll-StateselectioninbasketballandwasanAll-NWOCselectioninbaseballatfirstbase.

Personal:SonofGreg&KathiLawrence…Majorisundecided...HisfatherplayedbothfootballandbaseballatWesternOregon...ChosePacificofthegreatacademicopportunities,thefootballprogramandbecauseitwasclosetohome…FavoriteTVShow:Lost...FavoriteBook:TwelveMightyOrphans(JimDent)...FavoriteClassInSchool:Economics...CareerAmbition:Highschoolteacherandcoach.

LAWRENCE’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 7 4 50 12.5 0 16 7.1TOTAL 7 4 50 12.5 0 16 7.1

Jayson ManningJunior • Defensive Lineman • 6-3 • 250

Lahaina, HawaiiLahinaluna HS

55

2011:MadeloneappearanceoftheseasononthedefensivelineatWillametteon10/8/11.

High School:PlayedforGarretTihadaatLahainalunaHighSchool...WasaFirstTeamAll-MauiInterscholasticLeague(MIL)selectionatdefensiveend...Alsoplayedvarsityvolleyballandbasketball...WasteamMVPinvolleyballandwasaSecondTeamAll-MILselectioninbasketballatforward.

Personal:SonofMichael&SherrieManning…Exercisesciencemajorandpublichealthminor...Hasatwinbother(Jake)...ChosePacificfortheoutstandingeducationandthenewfootballprogram…FavoriteBook:Hatchet(GaryPaulsen)…FavoriteClassInSchool:Woodshop…CareerAmbition:Physicaltherapistandtrainer.

Will MarchbanksJunior • Tight End • 6-2 • 250

Brownsville, Ore.Central Linn HS

87

MARCHBANKS’ PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 8 0 0 0.0 0 0 0.02010 8 2 13 6.5 1 8 1.6TOTAL 16 2 13 6.5 1 8 0.8

2011: Playedineightgamesattightend.

2010:Playedineightgamesattightend...HadonereceptionforeightyardsagainstLinfieldon10/16/10...HadonereceptionforfiveyardsagainstWillametteon10/9/10.

High School:PlayedforRichHillsmanatCentralLinnHighSchool…2009:FirstTeamOregonAll-StateattightendandSecondTeamAll-Stateatlinebacker…2008:SecondTeamAll-StateandFirstTeamAll-MountainViewConferenceattightend…Alsoplayedvarsitybaseball,basketballandtrackandfield…EarnedFirstTeamAll-MountainViewConferenceselectionsinbothbaseballandbasketball.

Personal: SonofTim&TerryMarchbanks…Publichealthmajorandphilosophyminor…Hiscousin,MackenzieMarchbanks,playedsoftballatCorban…ChosePacificforthegreatphysicaltherapyandoptometryprogramandforthechancetocontinuetoplayfootball…FavoriteTVShow:SouthPark…FavoriteClassInSchool:Ethics...FavoriteQuote:Sixtypercentofthetimeitworkseverytime(RonBurgundyinAnchorman)...CareerAmbition:Tofindajob.

PACI

FIC

Foot

ball


2012 Returners

McKINNEY’S PACIFIC CAREER STATISTICSRushing G Att. Gain Loss Net Avg. TD Long Avg/G2011 5 1 7 0 7 7.0 0 7 1.4TOTAL 5 1 7 0 7 7.0 0 7 1.4

Returns KO Returns Punt Returns No. Yds. Avg. Long No. Yds. Avg. Long 2011 9 179 19.9 41 0 0 0 0TOTAL 9 179 19.9 41 0 0 0 0

Deven McKinneySophomore • Running Back • 6-0 • 210

Spanaway, Wash.Spanalway Lake HS

38

2011: Appearedinfivegamesatrunningback…Sawsignificantamountoftimeonspecialteams…Hadseasonlong41-yardkickoffatWhitworthon10/22/11…Finishedwith69returnyardsatPacificLutheranon11/5/11.

High School: PlayedatSpanawayHighSchool...Alsocompetedinvarsitywrestlingandtrackandfield.

Personal: SonofJasonMcKinney…Exercisesciencemajor…ChosePacificforthecoachesandthecampus...FavoriteTVShow:TrueBlood...FavoriteBook:TheVampire(LestatAnneRice)...FavoriteClassInSchool:Biology…FavoriteQuote:Idonotbelieveinpleasureinlife,onlyarelieffrompain.Youmustsuffertobeontop(GeorgeSt.Pierre)…CareerAmbition:Strength&conditioningcoachandtrainertothestars.

Kyle MerriamJunior • Wide Receiver • 5-8 • 175

West Linn, Ore.West Linn HS

85

MERRIAM’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 3 1 4 4.0 0 4 1.32010 4 2 25 13.0 0 25 6.5TOTAL 7 3 29 9.6 0 25 4.1

Bryan MillsJunior • Defensive Back • 5-11 • 195

Imbler, Ore.Imbler HS

36

MILLS’ PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 35 27 62 4 6 2 2 0 12010 9 28 18 46 1 7 4 0 0 0TOTAL 18 63 45 108 5 13 6 2 0 1


Interceptions G No Yds Avg TD Lg2011 9 1 40 40.0 0 402010 9 3 87 29.0 1 66TOTAL 9 3 87 29.0 1 66

2011:Playedinthreegamesatwidereceiver…HadonecatchforfouryardsatWillametteon10/8/11.

2010: Playedinfourgamesatdefensivelinemanandreceiver...Hadaseasonhightwocatchesfor26yardsagainstPugetSoundon9/4/10.

High School: PlayedforRonChappellatWestLinnHighSchool…WasanHonorableMentionAll-ThreeRiversLeagueselectionatwidereceiver…Alsocompetedinvarsitywrestlingandbaseball…WastherecipientoftheKyleCurranSportsmanshipAwardfromthebaseballteam.Personal:SonofBill&CherylMerriam…Exercisesciencemajorandphysicsminor…Hisgrandfather,DonaldHedrick,playedfootballatGrinnellCollege…ChosePacificfortheuniqueopportunitytostartanewfootballteamandthechancetoplayrightaway…FavoriteTVShow:JerseyShore…FavoriteBook:Twilight(StephanieMeyer)…FavoriteClassInSchool:Women’sstudies…CareerAmbition:Physicaltherapist.

2011: HonorableMentionAll-NorthwestConferenceselection…Startedallninegamesatsafety…LedBoxersandfinished10thintheNWCwith62tackles…RankedseventhintheNWCwith6.9tacklespergameandseventhwithhisteam-leading35solotackles…Hadseasonhigh12tackles,includingahalf-tackleforloss,atWhitworthon10/22/11…Finishedwithninetackles,onetackleforlossandoneforcedfumbleatClaremont-Mudd-Scrippson9/17/11…HadhisloneinterceptionoftheseasonagainstPugetSoundon19/29/11,returningtheball40yards…Returnedablockedextrapointkickfora100-yarddefensivetwo-pointconversionagainstLewis&Clarkon10/1/11…TheunusualplaywasfeaturedasESPNSportsCenter’sTopPlayoftheDay.

2010: Playedinallninegamesandstartedsixatsafety...RankedamongtheNWCleadersandledPacificwith37tackles(28solo,18assists)...AlsoledBoxersandwastiedforfifthintheleaguewiththreeinterceptions...Hadaseasonhighof8.5tacklesandhadaninterceptionagainstPacificLutheranon11/6/10...FinishedwithsixtacklesagainstClaremont-Mudd-Scrippson9/17/10...Rananinterceptionbackfor66yardsandatouchdownagainstMenloon11/13/10...AlsohadapickagainstWhitworthon10/23/10.

High School: PlayedforLeeLoweatImblerHighSchool…2009:FirstTeamAll-OldOregonLeagueselectionatquarterbackanddefensiveback…FirstTeamOregonAll-Stateselectionasadefensivebackandsecondteamasaquarterback…Threwfor1,196yardandrushedfor644yardswith32touchdowns…Votedtheteam’sMostValuableTeammate…2008:FirstTeamAll-OldOregonLeagueandFirstTeamAll-Stateatquarterback…Secondteamall-leagueselectionatdefensiveback…Threwfor2,057yardsandrushedfor930yardswith38touchdowns…Namedtheteam’sMostValuableTeammate…2007:FirstTeamAll-OldOregonLeagueandSecondTeamAll-Stateatrunningback…Rushedfor1,493yardswith23touchdowns…Votedtheteam’sMostValuableTeammate…2006:SecondTeamAll-OldOregonLeagueselectionatrunningback…Rushedfor630yardsandscoredeighttouchdowns…Alsoparticipatedinvarsitybaseball,basketballandtrackandfield…Wasanall-leagueselectioninbothbasketballandbaseball…Competedinboththe1AAll-StarGameandtheEast/WestShrineGamein2010.

Personal: SonofMike&SandyMills…Educationmajor…Hisfatherplayedcollegefootballandhismotherplayedcollegevolleyball,bothatEasternOregon…ChosePacifictoreceiveaqualityeducationandtobepartofthebrandnewfootballprogram…FavoriteTVShow:TheFreshPrinceofBel-Air…FavoriteClassInSchool:Yoga…FavoriteAthlete:KobeBryant…FavoriteQuote:Saywhen(DocHolliday).

GOBO

XERS

.COM


2012 ReturnersP.J. Minaya

Junior • Quarterback • 5-11 • 180Wahiawa, Hawaii

Hanalani HS

2

MINAYA’S PACIFIC CAREER STATISTICSPassing G Att. Cmp Int Yds TD Lg Pct. Avg/G Effic2011 8 63 99 2 671 5 53 63.6 83.9 133.22010 5 42 28 1 385 2 79 66.7 77.0 154.6TOTAL 13 105 127 3 1,056 7 79 64.5 81.2 139.6

Rushing G Att. Gain Loss Net Avg. TD Long Avg/G2011 8 25 112 85 27 1.1 0 25 3.42010 5 11 0 69 -69 -6.3 0 0 -13.8TOTAL 13 36 112 154 -42 -1.2 0 25 -3.2

2011:Playedineightgamesatquarterback…PlayedmostofthesecondhalfatPacificLutheranon11/5/11,throwingfor223yardsandthreetouchdownson23of34passingashenearlyledtheBoxerstoacome-from-behindwin…Threwfor167yardsandatouchdownon13of18completedatWillametteon10/8/11…Finishedwith107yardson6of10completedpassesagainstLinfieldon10/15/11.

2010:Playedinfivegamesandmadeonestartatquarterback...MadeonlystartoftheseasonatLinfieldon10/16/10beforebeinginjuredfortheseason...Inthegame,hada79-yardtouchdownpasstoJordanFukumotoonhisfirstplayfromscrimmage...Passedfor117yardson9of14completionsagainstClaremont-Mudd-Scrippson9/17/10...PassedforatouchdownagainstWillametteon10/9/10...Threwfor100yardson9of13completionsagainstPugetSoundon9/4/10.

High School:PlayedforKipBotelhoattheHanalaniSchools…2009:SecondTeamHawaiiAll-StateandFirstTeamAll-InterscholasticLeagueofHonolulu(ILH)selectionatquarterback…Finishedwith3,721yardspassingwith45touchdowns…SetHawaiistatewitheighttouchdownpassesinagameonAug.22…WasnamedaKHONAthleteoftheWeek,atwo-timeAthleteoftheWeekbytheHonoluluAdvertiserandwasnamedtheSportspersonoftheMonthbytheHonoluluQuarterbackClubinAugust…2008:HonorableMentionAll-StateandHonorableMentionAll-ILHselection…Passedfor2,663yardswith25touchdowns…Setstaterecordwith513passingyardsinagameonSept.5…Alsoplayedvarsitybaseballwherehewasatwo-timeAll-ILHDivisionIITeamselectionatshootingguard.

Personal: SonofPeter&CarmelaMinaya…Exercisesciencemajor…ChosePacificforthegoodacademicsandbecausehewantedtocontributetobuildingthenewfootballprogram…FavoriteTVShow:Sportscenter.

Charley MorenSophomore • Linebacker • 6-2 • 215

Seaside, Ore.Seaside HS

2011: Didnotplay.

High School:PlayedforStubbyLyonsatSeasideHighSchool...2010: FirstTeamAll-CowapaLeagueselectionatrightguard...East-WestShrineGameparticipant...2009: FirstTeamAll-CowapaLeagueselectionatrightguard...Alsoparticipatedinvarsitytrackandfield.Personal:SonofGailMoren…Exercisesciencemajor…Hisuncle,KellyBritz,rantrackatOregon...ChosePacificforthehighlevelofeducationandtoplayfootball…FavoriteTVShow:BMS…FavoriteClassInSchool:Writing...FavoriteQuote:Donotdwellinthepast.Donotdreamofthefuture.Concentratethemindofthepresentmoment(Buddha)…CareerAmbition:Helppeopleinphysicalrehabilitation.

Kamu MoritaJunior • Defensive Back • 5-11 • 185

Honolulu, HawaiiKamehameha HS

24

MORITA’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 17 14 31 0 0 2 0 0 02010 9 18 15 33 0 0 1 0 0 0TOTAL 18 35 29 64 0 0 3 0 0 0

2011:Playedineightgamesatstrongsafety…FinishedfifthfortheBoxerswith31tackles…Hadseasonhighseventackles,includingfivesolotackles,atWhitworthon10/22/11…FinishedwithfivetacklesatClaremont-Mudd-Scrippson9/17/11.

2010:Playedinallninegamesandstartedthefinalsevengamesatstrongsafety...Hadaseasonhigh4.5tackles(3solo,3assist)againstPacificLutheranon11/6/10...Hadeffortsof3.5tacklesagainstLewis&Clarkon10/2/10andMenloon11/13/10.

High School: PlayedforDavidStantatKamehamehaHighSchool…2009: MemberofKamehameha’sHawaiistatechampionshipandInterscholasticLeagueofHonolulu(ILH)championshipteam…AlsoparticipatedintrackandfieldwhereheplacedfifthintheHawaiistatechampionshipsinthe110-meterhurdles.Personal: SonofMike&CherylMorita…Businessmajor…HisfatherplayedtwoyearsoffootballatWhittier…ChosePacificbecauseofthevarietyofclassesavailable…FavoriteTVShow:HowIMetYourMother…FavoriteAthlete:TroyPolamalu…FavoriteFoods:Steakandfish.

Nikk NoveroJunior • Offensive Line • 6-3 • 265

Antioch, Calif.Antioch HS

65

2011:Startineightgamesandplayedinallninegamesatleftguard.

2010:Startedallninegamesatleftguard...Sawmostofhisactionatleftguard.

High School: PlayedforRandyAutencioatAntiochHighSchool…WasanAll-BayValleyLeagueselectionandwasnamedtheteam’sBestDefensiveLineman…Sawtimeatleftguard,defensivetackleandnoseguard.

Personal:SonofJerry&LoriNovero…Environmentalbiologymajor…ChosePacificforthebeautifulcampus,thesmallpopulationandthegoodacademics…FavoriteTVShow:BurnNotice…FavoriteBook:Ishmael(DanielQuinn)…FavoriteSportToWatch:Hockey.

Neil OchsFreshman • Offensive Line • 6-1 • 270


61

2011: Didnotplay.

High School: PlayedforAdamGuentheratWilsonvilleHighSchool...FirstTeamAll-NorthwestOregonConferenceselectionatoffensivetackleanddefensiveend...Alsocompetedinvarsitywrestling...Finishedfourthatthe2011Oregonstatechampionshipandwaseighthin2010.

Personal: SonofNeil&DinaOchs…Environmentalstudiesmajor…ChosePacificforthegreatcoachingstaffandthefriendlyenvironment.

PACI

FIC

Foot

ball


2012 ReturnersKevin Peterson

Sophomore • Offensive Line • 6-2 • 245Lake Oswego, Ore.

Lake Oswego HS

72

2011: Startedinallninegamesontheoffensiveline.

High School: PlayedforSteveCouryatLakeOswegoHighSchool...2010:FirstTeamOregonAll-StateandFirstTeamAll-ThreeRiversLeagueatoffensivelineman...2009:HonorableMentionAll-StateandFirstTeamAll-ThreeRiversLeagueatoffensivelineman.

Personal:SonofChris&LynnPeterson…Exercisesciencemajor…ChosePacificforthelocationofthecampusandthechancetobeacontributortoanew,upcomingfootballprogram...FavoriteTVShow:GameOfThrones...FavoriteBook:Eragon(ChristopherPaolini)...FavoriteClassInSchool:Recess...CareerAmbition:Physicaltherapist.

Cameron PumphreyJunior • Wide Receiver • 5-11 • 175

Quinault, Wash.Lake Quinault HS

88

PUMPHREY’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 8 13 155 11.9 0 27 19.4TOTAL 8 13 155 11.9 9 27 19.4

Tackles G UA A Total TFL Yds PD FF FR Blkd2010 5 1 0 1 0 0 0 0 0 0TOTAL 5 1 0 1 0 0 0 0 0 0

2011:Playedineightgamesatwidereceiver…MadelonestartoftheseasonagainstLinfieldon10/15/11,finishingwithaseason-high60yardsandfourreceptionswithaseasonlong27-yardpassplay…Finishedwith36yardsonthreereceptionsagainstPugetSoundon10/29/11.

2010: Playedinfivegamesatwidereceiver...EarnedcreditforatackleagainstLewis&ClarkonOct.2.

High School: PlayedforRonHolnessatLakeQuinaltHighSchool…2009: FirstTeamWashingtonAll-StateandFirstTeamAll-PacificSouthLeagueatcornerback…FirstTeamAll-PacificSouthLeagueattightend…Finishedwith500receivingyardswith10touchdownsasatightendandhad125tackles,20forloss,witheightinterceptionsatcornerback…2008:Finishedwith350receivingyards,fivetouchdowns,100tacklesandthreeinterceptions…Alsoplayedvarsitybasketballandbaseball…Wasnamedthebasketballteam’sMostValuablePlayerasajuniorandseniorandwasanall-conferenceselectioninbothsports.

Personal: SonofKen&JanicePumphrey…Environmentalstudiesmajor…ChosePacificbecausehelikedthecampusandthepeopleandtohelpstartthenewfootballprogram…FavoriteTVShow:TheYoung&TheRestless…FavoriteBook:50ShadesOfGrey(E.L.James).

Gabe RamirezSophomore • Defensive Back • 5-8 • 175

Lodi, Calif.Tokay HS

22

2011:Sawactioninthreegamesatdefensiveback…RegisteredsolotacklesagainstLewis&Clarkon10/1/11andatWillametteon10/8/11.

High School: PlayedforLouisFranklinatTokayHighSchool...2010:All-SanJoaquinSectionTCALselectionatdefensiveback...Finishedwith59tacklesandfivefumblerecoveriesinsevengamesbeforeseasonendedwithinjury...SelectedtotheLionsAll-StarGame...2009:All-SanJoaquinSectionTCALselectionat

RAMIREZ’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 3 2 0 2 1 33 0 0 0 0TOTAL 3 2 0 2 1 33 0 0 0 0

Charlie Reed-DustinSophomore • Tight End • 6-2 • 210

Portland, Ore.Madison HS

82

2011: SawonegameofactionattightendagainstWillametteon10/8/11.

High School: PlayedforAdamSkylesatMadisonHighSchool...WasaAll-PortlandInterscholasticLeague(PIL)selectionatdefensiveend...Wasalsonamedhonorablementionall-leagueatquarterback....Alsoparticipatedinvarsitywrestling,lacrosseandtrackandfield..Wasatwo-timePILchampionat215poundsandfinishedthirdattheOregonstatechampionships.

Personal: SonofCharlesDustinandKatherineReed…Majorisundecided.

Nick ReynoldsJunior • Linebacker • 5-10 • 230

Chimacum, Wash.Chimacum HS

50

2011:Sawactioninsevengamesatlinebacker…FinishedwithseasonhightwotacklesatWhitworthon10/22/11.

2010: Playedinsixgamesatlinebacker.

High School: PlayedforShawnMeachematChimacumHighSchool…2009:SecondTeamAll-NisquallyLeagueandFirstTeamAll-Peninsulaatdefensiveendandlinebacker…HonorableMentionAll-NisquallyLeagueatlefttackle…Finishedwith42tackles,fivesacksandfivefumbles…2008:Finishedwith71tacklesandthreesacks…2007:Finishedwith12tacklesinfivegames…AlsocompetedinvarsitytrackandfieldwherehewasaWashingtonstatemeetparticipantinthediscus.

Personal: SonofLonnie&ChristineReynolds…Sociologymajor…ChosePacificbecauseofit’sexcellenceinphysicaltherapyandfortheopportunitytoplaycollegesports…FavoriteTVShow:Psych…FavoriteClassInSchool:Criminology…FavoriteQuote:Thedifferencebetweenasuccessfulpersonandothersinnotlackofstrength,notalackofknowledge,butratherinalackofwill(VinceLombardi)…CareerAmbition:Criminaljustice.

defensiveback...Finishedwith71tacklesandfourfumblerecoveries...Finishedwith456yardsreceivingonoffense.

Personal:SonofArt&PattyGomez&GabeRamirez…Biologymajor…ChosePacificbecauseoftheopportunitytoreceiveanexcellenteducationfromareputableschoolwhileparticipatinginthefootballprogram…FavoriteTVShows:Sanford&SonandTheLeague…FavoriteBook:TheLordoftheFlies(WilliamGolding)...FavoriteClassInSchool:Calculus...FavoriteQuote:Nothingworthhavingcomeseasy(MichaelHolst)...CareerAmbition:Physician’sassistantororthopedicnurse.

REYNOLDS’ PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 3 0 3 3 0 0 0 0 0 0TOTAL 3 0 3 3 0 0 0 0 0 0

GOBO

XERS

.COM


2012 ReturnersSteel Rocha

Junior • Running Back • 5-4 • 170Modesto, Calif.

Central Catholic HS

39

ROCHA’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 6 0 0 0.0 0 0 0.02010 5 2 6 3.0 0 5 1.2TOTAL 11 2 6 3.0 0 5 0.5

Chris SantiagoSophomore • Linebacker • 6-0 • 215

Waipahu, HawaiiSt. Louis HS

13

SANTIAGO’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 9 18 12 30 2.5 12 1 1 1 02010 3 7 4 11 1.0 3 0 0 0 0TOTAL 12 25 16 41 3.5 15 1 1 1 0

2011:Playedinsixgamesatrunningback.

2010: Playedinfivegamesatrunningback...MadefirstappearanceagainstClaremont-Mudd-Scrippson9/18/10...HadonereceptionforfiveyardsagainstWillametteon10/9/10.

HighSchool:PlayedforRogerCanepaatCentralCatholicHighSchoolinModesto,Calif….2009:All-WesternAthleticConference(WAC)selectionatrunningback…Finishedwith542yardsrushingandseventouchdowns…Alsoplayedatoutsidelinebackerandhad59tackles,includingeightforlossand3.5sacks…2008:HelpedleadCentralCatholictoWACchampionshipandthesectionalchampionshipgame…Finishedwith333rushingyardsand41tackles…2007:HelpedleadCentralCatholictoWACchampionship…Finishedwith867rushingyards,10touchdownsand49tackles…Alsocompetedinwrestlingwherehewasathree-timeAll-WACselectionandtwo-timesectionalchampion.

Personal: SonofLeroy&KelliRocha…Businessadministrationmajorandeconomicsminor…ChosePacificfortheopportunitytoplayfootball…FavoriteTVShow:Chopped…FavoriteBook:TheAlchemist(PauloCoehlo)…FavoriteClassInSchool:History…FavoriteQuote:Youmiss100percentoftheshotsyoudon’ttake(WayneGretzky)…CareerAmbition:Tobeascratchgolferbythetimehe’s28.

Chase RogersSophomore • Defensive Back • 5-9 • 175

Lahaina, HawaiiLahainaluna HS

34

2011:Playedineightgamesatdefensiveback…Hadseasonhighfourtackles,allsoloefforts,atWillametteon10/8/11…Finishedwiththreegameswithtwotackles,mostrecentlyatWhitworthon10/22/11.

High School:PlayedforGarrettTihadaatLahianalunaHighSchool...WasaFirstTeamAll-MauiInterscholasticLeague(MIL)selectionasadefensiveutilityplayer...AlsoplayedvarsitysoccerandwasanHonorableMentionAll-MILselectionasadefender.

Personal: SonofJeff&JanRogers…Businessmajor…Hisbrother,Blaze,playsfootballforWillamette...ChosePacificbecauseitwasareallyniceschoolthathadtheacademics&athleticshewaslookingfor…FavoriteMovie:StepBrothers...CareerAmbition:Firefighter.

ROGERS’ PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 8 7 4 11 0 0 0 0 0 0TOTAL 8 7 4 11 0 0 0 0 0 0

Caleb RoherSophomore • Wide Receiver • 6-0 • 190

Gresham, Ore.Sam Barlow HS

21

2011: Playedineightgamesatwidereceiver…Alsospentsignificanttimeonspecialteamswiththekickreturnunit…Finishedwithseasonhigh123yardsreceivingonthreecatcheswithtwotouchdownsinBoxers’winoverPugetSoundon10/29/11…Scoredonpassplaysof44and67yards…Onkickreturn,hadaseasonhighof68yardsonthreereturns,includingaseason-best27-yardreturn,atWhitworthon10/22/11.

High School: PlayedforTerrySummerfieldatSamBarlowHighSchool...2010:FirstTeamAll-Mt.HoodConferenceselectionatbothwidereceiverandsafety...NationalFootballFoundation&CollegeHallofFameScholar-Athleteawardrecipient...Finishedwith663yardsreceivingand345yardsrushingwith12touchdowns...2009:FirstTeamAll-Mt.HoodConferenceatwidereceiverandsecondteamatsafety...2008:HonorableMentionAll-Mt.HoodConferenceselectionatslotreceiverandcornerback...Alsoplayedvarsitybasketballandtrackandfield...WasaSecondTeamAll-Mt.HoodConferenceselectioninbasketball.

Personal:SonofJack&ElaineRoher…Historymajorandcoachingminor…ChosePacificbecausehewantedtohelpbuildasuccessfulfootballprogramandtofurtherhiseducationatanoutstandinginstitution…FavoriteTVShow:ESPNFirstTake…FavoriteBook:Pistol(MarkKriegel)…FavoriteClassInSchool:History...FavoriteQuote:I’mawinner.I’mgoingtowin(DenzelWashington)…CareerAmbition:Historyteacherandcoach.

ROHER’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 8 9 188 20.9 2 67 23.5TOTAL 8 9 188 20.9 2 67 23.5


Returns KO Returns Punt Returns No. Yds. Avg. Long No. Yds. Avg. Long 2011 20 363 18.1 27 0 0 0 0TOTAL 20 363 18.1 27 0 0

2011:Startedallninegamesatdefensiveback…FinishedsixthfortheBoxerswithhis30tackles…Finishedseasonwithcareerhighseventackles,includingahalftackleforloss,atPacificLutheranon11/5/11…OpenedseasonwithsixtacklesagainstSimonFraseron9/3/11.

2010: Startedthefirstthreegamesoftheseasonatdefensivebackbeforeseasonwasendedbyinjury...Earnedcreditfortacklesinallthreegames,ledby4.5tackles(4solo,1assist)againstLewis&Clarkon10/2/10...Hadthreesolotackles,includingoneforloss,againstPugetSoundon9/4/10.

High School: PlayedforJohnHaoatSt.LouisHighSchool…Playedthreeseasonsatdefensiveback…Alsocompetedinvarsitybaseballandtrackandfield.

Personal: SonofKuulei&RustySantiago…Businessmajor…Hisbrother,Sheldon,playedbaseballatCentralWashingtonfrom2008to2009…ChosePacificbecauseitisagreatacademicschool…FavoriteTVShow:FamilyGuy…FavoriteClassInSchool:Allofthem…FavoriteQuote:Everydayisanotherdaytogetbetter…CareerAmbition:Entrepreneur.

PACI

FIC

Foot

ball


2012 ReturnersBrandon Sattelmeier

Sophomore • Offensive Lineman • 6-6 • 290Temecula, Calif.

Temecula Valley HS

73

2011:Playedinthefirstsixgamesoftheseasonontheoffensiveline.

High School: PlayedforPaulMcGowenatTemeculaValleyHighSchool...Four-yearScholar-AthleteAwardwinner...Coach’sAwardwinnerin2009.

Personal:SonofMarcySattelemeier…Biologymajor…ChosePacificbecausehelookedforwardtobuildingthefootballprogramandforthepre-medicinemajor...FavoriteTVShow:FamilyGuy...FavoriteBook:TheInheritanceTrilogy(ChristopherPaolini)...FavoriteClassInSchool:Biology...FavoriteQuote:Lazinesswillcauseyoupain...CareerAmbition:Anesthesiologist.

Taylor SchadSophomore • Offensive Lineman • 6-6 • 245

Aumsville, Ore.Cascade HS

86

2011:Playedintwogamesontheoffensiveline.

High School:PlayedforKarlEliotatCascadeHighSchool...2010:HonorableMentionAll-OregonWestConferenceselectionattackle...Alsocompetedinvarsitytrackandfieldintheshotputanddiscus.

Personal: SonofDarren&JenniferSchad…Physicsmajor…ChosePacificfortheopportunitytoplayamajorroleinbuildingthefootballprogramandforthegreatcampusatmosphere...FavoriteTVShow:BreakingBad...FavoriteBook:NoCountryForOldMen(CormacMcCarthy)...FavoriteClassInSchool:A.P.Calculus...FavoriteQuote:Somepeoplewantittohappen.Somewishitwouldhappen.Othersmakeithappen(MichaelJordan)...CareerAmbition:Engineer.

Gunther SchultzeJunior • Running Back • 5-10 • 205

Bellflower, Calif.St. John Bosco HS

26

SCHULTZE’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 9 12 138 11.5 0 45 15.32010 8 13 111 8.5 0 28 13.9TOTAL 17 25 249 9.9 0 45 14.6

Rushing G Att. Gain Loss Net Avg. TD Long Avg/G2011 9 54 156 32 258 2.3 1 18 13.82010 8 42 172 17 155 3.7 0 24 19.4TOTALS 17 96 328 49 413 4.3 1 24 24.2


Brandon SelveyJunior • Wide Receiver • 6-0 • 190

Ventura, Calif.Buena HS

80

SELVEY’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 9 2 43 21.5 0 39 4.82010 7 5 43 8.6 0 19 6.1TOTAL 16 7 86 12.2 0 39 5.3

Tackles G UA A Total TFL Yds PD FF FR Blkd2010 8 1 3 4 0 0 0 0 0 0TOTAL 8 1 3 4 0 0 0 0 0 0

2011: Playedinallninegamesandstartedsixatrunningback…Hadseasonhighsof63yardsreceivingand29yardspassingagainstLinfieldon10/15/11…ScoredonlytouchdownoftheseasonagainstSimonFraseron9/3/11…Hadonekickreturnfor60yardsagainstLewis&Clarkon10/1/11.

2010:Playedineightgamesatrunningback...Alsosawregulardutyonspecialteamsatkickreturn...FinishedsecondforBoxerstorushingwith155yards(3.7yardspercarryaverage)...Hadseasonhighof78all-purposeyardsagainstPugetSoundon10/30/10,rushingfor22yardsandcatchingfiveballsfor55yards,includingaseasonlong28-yardreception...Hasseasonbestof42yardsrushingagainstPugetSoundon9/4/10...Rackedup50yardonkickreturnagainstWillametteon10/9/10.

High School: PlayedforKikiMendozaatSt.JohnBoscoHighSchool…2009: Namedtheteam’sMostImprovedDefensiveBack…Finishedwith17tackles,fourforloss,andtwoforcedfumblesasacornerback…2008:Playedsixgamesatrunningback…Finishedwith208yardsrushingandtwotouchdownsasarunningback…Alsocompetedinvarsitytrackandfield.

Personal: SonofSteveSchultze&GinaDimas…Psychologyandexercisesciencemajor…SisterRandelplayedfouryearsofvolleyballatWillamette…ChosePacificforthegreateducationandtheopportunitytoplayfootball…FavoriteTVShow:Workaholics…FavoriteClassInSchool:Psychology…FavoriteQuote:Ifyoucanbelieveit,themindcanachieveit…CareerAmbition:ToworkfortheF.B.I.

2011:Sawactioninninegamesatwidereceiver…Hadseasonlong39-yardcatchagainstSimonFraseron9/3/11.

2010: Playedinsevengamesatwidereceiver...Hadseasonhighof20yardsatMenloon11/13/10...Finishedwith19yardsreceivingagainstPugetSoundon9/4/10.

High School: PlayedforCoachesBarrensonandFarraratBuenaHighSchool…Playedfourseasonsatwidereceiver…EarnedScholarAthleteAwardin2007.

Personal:SonofChris&LindaSelvey…Exercisesciencemajorandbusinessminor…ChosePacifictoplayfootballandtomoveintoacareerinphysicaltherapy...FavoriteTVShow:SouthPark...FavoriteBook:1984(GeorgeOrwell)...FavoriteQuote:Ifyoudon’tremember,itdidn’thappen...CareerAmbition:Physicaltherapist.

GOBO

XERS

.COM


2012 ReturnersSeth Siddle-MitchellJunior • Quarterback • 6-0 • 200

Lodi, Calif.Tokay HS

14

SIDDLE-MITCHELL’S PACIFIC CAREER STATISTICSPassing G Att. Cmp Int Yds TD Lg Pct. Avg/G Effic2011 4 2 0 0 0 0 0 0 0 -200.02010 1 2 0 0 0 0 0 0 0 0TOTAL 5 4 0 0 0 0 0 0 0 -200.0

2011:PlayedinfourgamesfortheBoxersatquarterback.

2010: PlayedinonegameatquarterbackagainstLinfieldon10/16/10.

High School:PlayedforLouisFranklinatTokayHighSchool…2009:SecondTeamAll-Tri-CountyAthleticLeague(TCAL)atquarterback…WasnamedLodi’sOffensiveBackoftheYear…Finishedwith722passingyardand630rushingyardswith12touchdowns…Alsoplayedvarsitybasketballandbaseball.

Personal: SonofWilliamMitchell&KathrynSiddle…Physicsandmathmajorandcomputerscienceminor…Hiscousin,KimChadwickKoditek,isthecampuswellnesscoordinatoratPacific…ChosePacificbecauseofitsacademicreputationandthechancetoplayfootball…FavoriteTVShow:Scrubs…FavoriteBook:TheHarryPotterseries(J.K.Rowling)…FavoriteAthlete:JohnElway…FavoriteQuote:Donotworryaboutyourdifficultiesinmathematics.Iassureyouthatminearestillgreater(AlbertEinstein)…CareerAmbition:Inventor.

Mike SmithJunior • Defensive Lineman • 6-3 • 275

Tumwater, Wash.Tumwater HS

76

SMITH’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 3 0 5 5 0.0 0 0 0 0 02010 9 8 10 18 1.5 1 1 1 0 0TOTAL 12 8 15 23 1.5 1 1 1 0 0

2011:Appearedinthreegamesasdefensiveback…MadehisfirstcareerstartagainstSimonFraseron9/3/11…FinishedwithtwotackleseachagainstMenloon9/10/11andClaremont-Mudd-Scrippson9/17/11.

2010:Startedallninegamesatdefensivelineman...Notchedseasonhighthreetackles,allsolo,againstPugetSoundon9/3/10...Alsohadathreetackleperformance(2solo,2assist)againstPacificLutheranon10/30/10...CameupwithaforcedfumbleagainstClaremont-Mudd-Scrippson9/18/10.

High School:PlayedforSidOttonatTumwaterHighSchool…2009:HonorableMentionAll-EvergreenConferenceselectionatdefensiveline…Finishedwith34tackles,includingfourforloss,twosacksandtwofumblerecoveries…2008:Finishedwith36tackles,includingfiveforloss.Personal: SonofJim&BeckySmith…Psychologymajor…ChosePacificforthesmallschoolenvironmentandthepeople…FavoriteTVShow:CriminalMinds...FavoriteBook:TheHarryPotterseries(J.K.Rowling)…FavoriteClassInSchool:Psychology…FavoriteQuote:Youhavetowantitasbadasyouwanttobreathe(EricThomas)…CareerAmbition:Schoolcounselorandfootballcoach.

Alen SukljeSophomore • Linebacker • 6-0 • 195

Portland, Ore.Beaverton HS

37

SUKLJE’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2010 8 6 15 21 0.5 4 0 0 0 0TOTAL 8 6 15 21 0.5 4 0 0 0 0


2011: Didnotplayduetoinjury.

2010: Playedineightgamesatlinebacker...Finishedwithseasonhigh3.5tacklesagainstWillametteon10/9/10...HadthreetacklesagainstLewis&Clarkon10/2/10...EarnedcreditforasackagainstPugetSoundon10/30/10.

Tennis: IsamemberofthePacificmen’stennisteam...2012:Didnotplayduetoinjury…2011:Finishedwitha6-4recordinsinglesandan8-10recordindoubleswithPatrickKinghorn.

High School: PlayedforBobBoyeratBeavertonHighSchool…ThirdTeamAll-MetroLeaguein2009atmiddlelinebacker…Wasnamedtheteam’sMostInspirationalPlayerin2009andreceivedtheschool’sGeorgeBoyerAwardin2008…Hadninetacklesforlossandthreesacksatmiddlelinebackerin2010…Alsocompetedinvarsitytennisandswimming…WasaOregonhighschoolstatequarterfinalistinsinglesinboth2008and2010andearnedSecondTeamAll-MetroLeaguehonorsin2009and2010…WastheBeavers’tennisMostValuablePlayerallfouryearsheplayed.

Personal: SonofZarko&MiraSuklje…Exercisesciencemajor…ChosePacificbecausehefelthecouldthrivewiththeopportunitiesPacificofferedhim…FavoriteTVShow:SecretMillionaire…FavoriteBook:The4HourBody(TimFerriss)…FavoriteClassInSchool:Sportsethics…FavoriteQuote:Delaygratification,achievegreatness…CareerAmbition:Personaltrainerandstrength&conditioningcoach.

Brian TaylorJunior • Tight End • 6-2 • 205

Lewiston, IdahoLewiston HS

18

TAYLOR’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 9 15 141 9.4 3 24 15.72010 9 8 117 14.6 2 29 13.0TOTAL 18 23 258 11.2 5 29 14.3

2011:Startedallninegamesattightend…Finishedwithseasonhigh40yardsonthreereceptionswithatouchdowninwinoverPugetSoundon10/29/11…ScoredfinaltouchdownincomebackattemptinlosstoPacificLutheran11/5/11…Hadseasonlong29-yardreceptionatWhitworthon10/22/11.

2010: Startedallninegamesattightend...Finishedwithseasonhigh45yardsagainstPugetSoundon10/30/10,whichincludedalongplayof22yards...Cameupwith29-yardreceptionagainstPugetSoundon9/4/10.

High School:PlayedforEmmettDoughertyatLewistonHighSchool…HonorableMentionAll-InlandEmpireLeaguein2008and2009attightendandlinebacker…Alsoplayedvarsitybasketball.

Personal:SonofDavid&DianeTaylor…Exercisesciencemajor…ChosePacificfortheexercisescienceprogramandthefootballprogram…FavoriteTVShow:SwampPeople…FavoriteBook:TheHarryPotterseries(J.K.Rowling)…CareerAmbition:Tocoachfootball.

PACI

FIC

Foot

ball


2012 ReturnersWill Ulrich

Sophomore • Offensive Lineman • 6-1 • 260Lake Elsinore, Calif.

Elsinore HS

63

2011:Playedinthreegamesontheoffensiveline.

High School: PlayedforTonyPeraltaatElsinoreHighSchool...All-Valleyselectionatdefensiveline...MemberofElsinore’s2010CIFstatechampionshipteam...Finishedwith42tacklesandsixsacks...Alsoparticipatedinvarsitywrestlingandtrackandfield...FinishedsecondattheCIFChampionshipsinwrestlingatheavyweight...Wasanall-leagueselectionintrackintheshotput.

Personal: SonofJohn&AnnUlrich…Physicsmajorandmathematicsminor...ChosePacificbecauseoftheacademicprograms...FavoriteTVShow:Fringe...FavoriteBook:PhysicsoftheImpossible(MichioKaku)…FavoriteClassInSchool:Physics...FavoriteQuote:Withoutrisktherecanbenoreward…CareerAmbition:Politician.

Aaron VictorinoJunior • Offensive Lineman • 6-1 • 280

Lihue, HawaiiKauai HS

57

2011:Startedallninegamesasanoffensivetackle.

2010:StartedallninegamesfortheBoxersasoffensivetackle.

High School: PlayedforDerekBorreroatKauaiHighSchool…WasaKauaiInterscholasticFederationAll-Starin2010atoutsidelinebacker…Earnedtheteam’sIronmanAwardin2010andearnedAcademicAthleteawardin2009inbothfootballandtrackandfield…Alsocompetedintrackandfield,throwingtheshotputanddiscus.

Personal: SonofRonald&RuenaVictorino…Businessadministrationmajorandeconomicsminor…ChosePacificbecauseitwasaschoolhecouldexcelatbothacademicallyandathleticallyandbecauseofthefootballcoachingstaff’sphilosophy…FavoriteTVShow:FridayNightLights…FavoriteBook:TheBible…FavoriteClassInSchool:History…FavoriteQuote:Wearewhatwerepeatedlydo.Excellencethenisnotanact,butahabit(Aristotle)…CareerAmbition:Accountant.

Moses Villareal-GomezSophomore • Kicker • 5-11 • 165

Stockton, Calif.St. Mary’s HS

1

2011:HonorableMentionAll-NorthwestConferenceasaplacekicker…FinishedfourthintheNWCandwassecondfortheBoxersinscoringwith35points…FinishedsecondintheNWCinfieldgoalsmade(6)andfieldgoalsattempted(10)…FinishedfifthinNWCinbothPATkicksmade(17)andlongfieldgoal(38yards)…DidnotmissfieldgoalorPATattemptinfinalfivegamesoftheseason…Went2for2onfieldgoalsagainstLinfieldon10/15/11andatWhitworthon10/22/11…AccountedforPacific’sonlyscoringinbothgames…Went6for6inPATattemptsagainstPugetSoundon10/29/11.

High School: PlayedforCoachFranksatSt.Mary’sHighSchool...2010: FirstTeamAll-TicalLeagueandall-areaselectionatkicker...NationalFootballFoundation&CollegeHallofFameScholar-AthleteAwardrecipient...Converted58of61extrapointattemptsandwent7of10infieldgoals...2009: SecondTeamAll-TicalLeagueselection...converted70of75pointafterattemptsandthreefieldgoals...Alsoplayedvarsitysoccerwherehewasathree-timeFirstTeamAll-TicalLeagueselection.

Personal: SonofHector&MariaVillareal…BiologymajorandSpanishminor…ChosePacificfortheacademicsandforthechancetoplaysports…FavoriteTVShow:Entourage…FavoriteBook:Night(ElieWeisel)…FavoriteClassInSchool:Spanish…FavoriteQuote:Impossibleisnothing(Adidasslogan)...CareerAmbition:Physicaltherapist.

VILLAREAL-GOMEZ’S PACIFIC CAREER STATISTICSKicking FG Pct. 1-19 20-29 30-39 40-49 50-99 Lg Blk2011 6-10 60.0 0-0 3-3 3-4 0-3 0-0 38 2TOTAL 6-10 60.0 0-0 3-3 3-4 0-3 0-0 38 2

Landon WeimarSophomore • Linebacker • 6-1 • 215

Glide, Ore.Glide HS

44

2011:Playedinfourgamesatlinebacker…RegisteredasolotackleagainstWillametteon10/8/11andanassistedtackleagainstLinfieldon10/15/11.

High School: PlayedforJeffFreemanatGlideHighSchool...2010: FirstTeamAll-SunsetLeagueandHonorableMention3AAll-Stateselectionatlinebacker...Teamcaptain...SecondTeamAll-SunsetLeagueatquarterback...Had10tacklesforloss...Threwfor1,370yardsandrushedfor469yardsandhad20touchdowns...2009:SecondTeamAll-SunsetLeagueatquarterbackandwasanhonorablementionselectionatlinebacker...Threwfor1,600yardswith23touchdowns...Alsoparticipatedinvarsitybasketballandtrackandfield...WastheSunsetLeagueThroweroftheMeetasaseniorandwentontofinishthirdattheOregonstatechampionshipsinthejavelin.

Personal:SonofThomas&HeidiWeimar…Exercisesciencemajor…ChosePacificforthegreatmedicalprograms,theperfectsize,greatteachersandcoachesandthechancetoplayfootball…FavoriteTVShow:Scrubs…FavoriteClassInSchool:Anatomyandphysiology…FavoriteQuote:Practicedoesn’tmakeperfect,perfectpracticemakesperfect(VinceLombardi)...CareerAmbition:Toworkinthemedicalfieldandsavelives.

WEIMAR’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 4 1 1 2 0 0 0 0 0 0TOTAL 4 1 1 2 0 0 0 0 0 0

Alex WillefordSophomore • Linebacker • 6-1 • 210

Keizer, Ore.McNary HS

45

2011:SawloneactionoftheseasonatlinebackeragainstMenloon9/10/11.

High School: PlayedforRickWardatMcNaryHighSchool...2010:SecondTeamAll-CentralValleyConferenceselectionatdefensiveline...LedtheCelticsintacklesandsacks...FirstTeamAll-CVCatoffensiveline...Alsoparticipatedinvarsitytrackandfield.

Personal: SonofJamesWilleford&BarbaraMajors…Majorisundecided…ChosePacificfortheacademicandfootballatmospherethathesawonhisvisits…FavoriteTVShow:Tosh.0…FavoriteBook:ReminiscencesOfAStockOperator(EdwinLefevre)…FavoriteClassInSchool:Ethics…FavoriteQuote:Whenitisobviousthatthegoalscannotbereached,don’tadjustthegoals,adjusttheactionsteps(Confucious).

GOBO

XERS

.COM


2012 ReturnersZach Willits

Junior • Linebacker • 5-9 • 195Medford, Ore.

North Medford HS

53

Caleb WistockJunior • Defensive Lineman • 6-2 • 215

Stayton, Ore.Stayton HS

94

WISTOCK’S PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 8 2 5 7 0.5 2 0 0 0 02010 7 7 7 14 3.0 14 0 1 0 0TOTAL 15 9 12 21 3.5 16 0 1 0 0

Cameron YipJunior • Wide Receiver • 5-9 • 175

Waihe’e, HawaiiKamehameha-Maui HS

31

YIP’S PACIFIC CAREER STATISTICSReceiving G No Yds Avg TD Lg Avg/G2011 8 8 94 11.7 0 43 11.72010 9 11 114 10.4 0 38 12.7TOTAL 17 19 208 10.9 0 43 12.2

Rushing G Att. Gain Loss Net Avg. TD Long Avg/G2011 9 1 0 8 -8 -8.0 0 0 -0.82010 9 1 0 7 -7 -7.0 0 0 -0.8TOTAL 18 2 0 15 -15 -7.5 0 0 -0.8

Tackles G UA A Total TFL Yds PD FF FR Blkd2011 9 1 1 2 0 0 0 0 0 02010 9 3 0 3 0 0 0 0 0 0TOTAL 18 4 1 5 0 0 0 0 0 0

2011:Playedinfivegamesatlinebacker…MadefirstcareerstartagainstMenloon9/10/11…FinishedwithoneassistedtackleagainstLinfieldon10/15/11.

2010:Playedtwogamesatlinebacker.

High School: PlayedforJeffOlsonatNorthMedfordHighSchool…2009:All-SouthwestOregonConferenceselectionatlinebacker…Finishedwith12tacklesforloss,threesacksandthreefumbles…Alsocompetedinvarsitywrestlingwherehewasafour-timedistrictplacer.

Personal: SonofGaryWillits&MindyKinnan-Willits…Biologymajor…ChosePacificfortheoptometryprogram…FavoriteTVShow:GameOfThrones…FavoriteBook:SeasonofLife(KarlMarx)...FavoriteClassInSchool:Psychology…FavoriteQuote:Neversettleformediocrity…CareerAmbition:Optometrist.

WILLITS’ PACIFIC CAREER STATISTICSTackles G UA A Total TFL Yds PD FF FR Blkd2011 5 0 1 1 0 0 0 0 0 02010 2 0 0 0 0 0 0 0 0 0TOTAL 7 0 1 1 0 0 0 0 0 0

2011: Playedineightgamesatlinebacker…Puttogetherseasonhighfourtackles,includingahalftackleforloss,againstLewis&Clarkon10/1/11.

2010: Playedineightgamesatlinebacker...Hadaseasonhighthreetackles,includingoneforloss,againstLinfieldon10/16/10...Had2.5tackles,atackleforlossandaforcedfumbleagainstPacificLutheranon11/6/10.

High School: PlayedforGregNolanatStaytonHighSchool…2009:FirstTeamAll-CapitalConferenceselectionatbothoffensiveguardanddefensivelineman…Wasnamedtheleague’sLinemanoftheYearandwasselectedasanalternateforthe2010East/WestShrineGame…WasateamcaptainandwasnamedStayton’sMostValuableLineman…2008: HonorableMentionAll-CapitalConferenceatoffensiveguard…Alsocompetedinvarsitywrestlingandbaseball…WastwicenamedHonorableMentionAll-CapitalLeagueinwrestling.

Personal: SonofCharles&LorraineWistock…Businessmajor…ChosePacificforthegreateducationandtobepartofthenewfootballprogram…FavoriteTVShow:TheUnit…FavoriteBook:ComingBackStronger(DrewBrees)…FavoriteClassInSchool:History…FavoriteQuote:Thereisatimetotakecouncilofyourfeels,andthereisatimetoneverlistentoanyfear(GeorgeS.Patton)…CareerAmbition:U.S.Armyinfantryofficerandbusinessowner.

2011:Playedineightgamesatwidereceiver…Finishedwithfivecatchesfor57yards,includingalongcatchof43yards,againstLewis&Clarkon10/1/11…Had37yardsonthreecatchesagainstSimonFraseron9/3/11.

2010: Playedinallninegamesatwidereceiver...Hadseasonbest38yardsagainstClaremont-Mudd-Scrippson9/18/10...Caughttwoballsfor35yardsagainstPugetSoundon10/30/10.

High School: PlayedforLeoDelatoriatKamehamehaMauiHighSchool…2009:FirstTeamAll-MauiInterscholasticLeague(MIL)atwidereceiver…2008:HonorableMentionAll-MILatwidereceiver…Alsocompetedinvarsitybasketballandtrackandfield.

Personal: SonofGaryYip&EdrainBlake-Yip…Exercisesciencemajorandbusinessminor…ChosePacifictogreatagreateducation,becauseitwasawayfromhomeandtoplaysports…FavoriteTVShow:Sportscenter...FavoriteBook:TheBible...FavoriteClassInSchool:P.E....FavoriteQuote:Winnersneverquit,quittersneverwin(VinceLombardi)…CareerAmbition:Strength&conditioningexpert.

PACI

FIC

Foot

ball


2012 NewcomersGreg Alip

Freshman • Running Back • 5-7 • 210Kealakekua, Hawaii

Waipahu HS

34

High School: PlayedforEricKeolaatWaipahuHighSchool.Personal: SonofCalvin&EvanellKeaunui…Exercisesciencemajor…ChosePacificbecauseofthesmallclasssizes…FavoriteMusicians:BobMarleyandTheGreen…Hobbies:Playingukulele.

Heron AzevedoFreshman • Wide Receiver • 5-9 • 175

Rio de Janiero, BrazilDiablo Valley JC/Colegio Anglo-Americano

89

Diablo Valley JC:PlayedtwoseasonsatthejuniorcollegeinPleasantHill,Calif.,underMikeDarr…Playedatwidereceiverandonspecialteams.

High School:AttendedColegioAnglo-AmericanoinRiodeJaneiro,Brazil.

Personal: SonofHermés&GleyseAzevedo...ExercisesciencemajorMarriedtoPamelaChosePacificforthegreatopportunitytohelpayoungfootballprogramgrowwhilealsohavingagreateducationFavoriteTVShow:FridayNightLightsFavoriteBook:PlayingForPizza(JohnGrisham)FavoriteQuote:LifeisabitterstrugglethatdepressedtheweakandonlyexaltsthestrongCareerAmbition:TohelpdevelopfootballinBrazil.

Keli’i BaladaFreshman • Offensive Lineman • 5-10 • 285

Portland, Ore.Westview HS

54

High School: PlayedforGregFisheratWestviewHighSchool…WasanAll-MetroLeagueselectionasanoffensiveanddefensivelineman.Personal: SonofRocky&SandiBalada…Exercisesciencemajor…HisfatherplayedfootballatPacificintheearly1970s…Hisuncle,AnroldMorgado,Jr.,playedfootballatMichiganandhiscousin,IsaacParker,playsfootballatWillamette…ChosePacificfortheacademicprogramsandthefootballprogramandbecauseofhisfather’salumniconnection…FavoriteTVShow:FridayNightLights…FavoriteClassInSchool:Marketing…FavoriteQuote:Bethefirsttogive.Givethemost.Andwhenyouhavenothinglefttogive,givesomemore…CareerAmbition:Physicaltherapist.

Bronson BarrettoFreshman • Running Back • 5-8 • 190

Mililani, HawaiiKamehameha HS

20

High School:PlayedforDavidStantattheKamehamehaSchool…2011: FirstTeamAll-InterscholasticLeagueofHonoluluandHawaiiAll-Stateselectionatrunningback…Finishedwith584yardson116carries…Alsoparticipatedinvarsitywrestlingandtrackandfield.

Personal:SonofPhil&MarleneBarretto…Philosophymajor…ChosePacificfortheoutstandingacademicofferedandthechancetoplayfootball…FavoriteTVShow:Workaholics…FavoriteBook:SixQuestionsofSocrates(ChristopherPhillips)…FavoriteClassInSchool:English…FavoriteQuote:Ourdeepestfearisnotthatweareinadequate.Ourdeepestfearisthatwearepowerfulbeyondmeasure(MarianneWilliamson)…CareerAmbition:Lawyer.

Ryan BeckFreshman • Linebacker • 6-1 • 190

Scottsdale, Ariz.Chapparal HS

39

High School: PlayedforCharlieRagleatChaparralHighSchool…2011:Finishedwith50tackles,twosacks,onefumbleforcedandonerecoveredin11gamesatinsidelinebacker...Alsoplayedvarsitybasketball.Personal: SonofPertBeck…Exercisesciencemajor…Hisuncle,GregMarshall,playedfootballatOregonStateandintheCanadianFootballLeague.HehascoachedintheCFLsince1991…ChosePacificbecausehewantsthechallengeofbeingpartofabuildingprogramandforthephysicaltherapyprogram…FavoriteTVShow:Friends…FavoriteBook:toKillAMockingbird(HarperLee)…FavoriteClassesInSchool:Humanphysiologyandanatomy…FavoriteQuote:Whathurtsmore,thepainofhardworkorthepainofregret?...CareerAmbition:Physicaltherapist.

Nick BieberFreshman • Fullback • 5-11 • 205

Gresham, Ore.Sam Barlow HS

90

High School: PlayedforTerrySummerfieldatSamBarlowHighSchool…2011: All-Mt.HoodLeagueselectionatbothrunningbackandlinebacker…Onoffense,rushedfor220yardsandfivetouchdownswhilemakingfourcatchesfor195yards…Ondefense,Had22tackles,includingfiveforlossandonesackwhilerecoveringthreefumblerecoveriesandtwointerceptions…2010:All-Mt.HoodLeagueselectionatrunningback…Rushedfor225yardsand11touchdownson50carries…Ondefense,had20tackles,twosacks,twoforcedfumblesandtwofumblerecoveriesasalinebacker…Alsocompetedinvarsitybasketballandtrackandfield.Personal:SonofMike&LoriBieber…Businessmajorandpsychologyminor…ChosePacificbecausehelikedtheenergyofthecoachesandfortheopportunitytoplayfootball…FavoriteTVShow:Workaholics…FavoriteClassInSchool:History…FavoriteQuote:Championsaren’tmadeingyms.Championsaremadefromsomethingthathavedeepinsidethem:adream,adesire,avision(MuhammadAli)…CareerAmbition:Policeofficer.

Nick CapuzziFreshman • Linebacker • 5-11 • 190

Temecula, Calif.Temecula Valley HS

81

High School: PlayedatTemeculaValleyHighSchool…2011: SecondTeamAll-SouthwesternLeague…Wasnamedtheteam’sLinebackeroftheYear…Finishedwith60tackles,including19forloss,twosacksandfourfumblesforced…2010: Finishedwith59tackles,including17forloss,twosacksandfourforcedfumbles…2009:Finished48tackles,includingnineforloss,withthreesacksandthreeforcedfumbles…Alsoparticipatedinvarsitytrackandfield.Personal: SonofJim&ShannonCapuzzi…Environmentalsciencemajorandbusinessminor…HisgrandfatherplayedfortheGreenBayPackers…ChosePacificbecauseitwasthebestthingforhisfuture…FavoriteTVShow:Workaholics…FavoriteBook:TheHarryPotterseries(J.K.Rowling)…FavoriteClassInSchool:Science…FavoriteQuote:It’sallornothing…CareerAmbition:Environmentalscientist.

GOBO

XERS

.COM


2012 NewcomersDavid Carr

Freshman • Wide Receiver • 6-2 • 195Gaston, Ore.

Gaston HS

92

High School: PlayedforReeveWoodwardatGastonHighSchool…2011:FirstTeamAll-NorthwestLeagueand2AAll-Stateselectionatbothquarterbackanddefensiveback…2010:FirstTeamAll-NorthwestLeagueatbothquarterbackanddefensiveback…2AAll-Stateselectionatdefensiveback…Alsoparticipatedinvarsitybasketballandtrackandfield…WasanAll-NorthwestLeagueselectionatguard.

Personal: SonofDavid&JulieMcEwen…Biologymajor…ChosePacificbecauseitwasclosetohome…FavoriteTVShow:TwoAndAHalfMen…FavoriteBook:AtlasShrugged(AynRynd)…FavoriteClassInSchool:Lunch…CareerAmbition:Physicaltherapist.

Austin CherryFreshman • Linebacker • 5-11 • 215

Bay City, Ore.Neah-Kah-Nie HS

25

High School:PlayedforScottRossatNeah-Kah-NieHighSchool…2011:All-NorthwestLeague(NWL)selectionatrunningback…Carriedfor808yardsand13touchdowns…WasnamedtheNWLDefensivePlayeroftheYearandWasaSecondTeamOregon2AAll-Stateselectionatlinebacker…Finishedwith187tackles…2010:NamedtheNWLDefensivePlayeroftheYearasalinebackerandaFirstTeamAll-NWCatrunningback...Alsoparticipatedinvarsitywrestling,trackandfieldandbaseball…PlacedthirdattheOregon2AWrestlingStateChampionshipsin2010,2011and2012….Placedseventhin2Astatemeetinjavelinin2011andfifthin2012.

Personal:SonofLester&AngieCherry…Majorisundecided…ChosePacificbecauseitwasanall-aroundperfectfitforhim,allowinghimtoplayfootballnearhishometown…FavoriteTVShow:SportsCenter…FavoriteBook:Ender’sGame(OrsonScottCard)…FavoriteClassesInSchool:MathandP.E….FavoriteQuote:Deathsmilesatusall.Allthatamancandoissmileback.

Jarom ChingFreshman • Linebacker • 5-10 • 225

Kapolei, HawaiiKamehameha HS

58

High School: PlayedforDavidStantattheKamehamehaSchools…2011:Finishedwith16tackles,onesackandonefumbleinninegamesatlinebacker…2010: Finishedwithninetacklesinfourgamesatlinebacker…Alsoplayedvarsitybasketballandvolleyball.

Personal:SonofKamae&DeniseChing…Pre-pharmacymajor…HismotherplayedsoftballatBYUHawaii…ChosePacificfortheacademicopportunitiesandforthefootballprogram…FavoriteTVShow:HowIMetYourMother…FavoriteClassInSchool:Guitar…FavoriteAthletes:DerrickRockandRayLewis…CareerAmbition:Pharmacy.

Tim ClaussenFreshman • Offensive Lineman • 6-4 • 220

Yamhill, Ore.Yamhill-Carlton HS

68

High School:PlayedforRicStahlatYamhill-CarltonHighSchool…2010: All-CowapaLeagueselectionasanoffensivelineman…Alsocompetedinvarsitybasketballandtrackandfield…Finishedeighthinthediscusatthe2012Oregon3Astatechampionshipinthediscus…Wasastatemeetqualifierintheshotputin2011.

Personal: SonofTomClaussen&KimWright…Majorisundecided…ChosePacificforthequalityofschoolandthequalityofpeople…FavoriteTVShow:House…FavoriteClassInSchool:English…FavoriteAthletes:AaronRodgersandLaMarcusAldridge…CareerAmbition:Sportstrainerormeteorologist.

Nick DatrayFreshman • Quarterback • 6-3 • 200

Atwater, Calif.Buhach Colony HS

9

High School: PlayedatBuhachColonyHighSchool.

Personal: SonofDarren&HollyDatray…Exercisesciencemajor…ChosePacificforthegreatacademicsandsportsprograms.

Jon DoberFreshman • Running Back • 5-6 • 170


11

High School:PlayedforDwightJensenatForestGroveHighSchool…2011:HonorableMentionAll-PacificConferenceselectionatrunningback…2010: HonorableMentionAll-PacificConferenceatrunningback.

Personal: SonofMollyDober…Exercisesciencemajor…FavoriteMovies:JamesBondmovies.

Miles DurantFreshman • Defensive Lineman • 6-0 • 225

Larkspur, Calif.Redwood HS

95

High School:PlayedforJohnHershatRedwoodHighSchool…Wasanall-leagueselectionontheoffensiveline…Alsoplayedvarsitybasketballandbaseball.

Personal: SonofMike&JeanDurant…Exercisesciencemajor…HisfatherplayedtwoseasonsoffootballatKansasState…ChosePacificforthefootballprogramandfortheexercisesciencemajor…FavoriteTVShow:Workaholics…FavoriteBook:ALongWayGone(IshmaelBeth)…FavoriteClassInSchool:Physiology…CareerAmbition:Trainer.

PACI

FIC

Foot

ball


2012 NewcomersHayden England

Freshman • Defensive Back • 5-10 • 185Creswell, Ore.

Creswell HS

32

High School:PlayedforPaulGoldspinkatCreswellHighSchool…2011:SecondTeamOregon3AAll-StateandFirstTeamAll-PacWestLeagueattightend…AlsoFirstTeamAll-PacWestLeagueatdefensivebackandHonorableMentionAll-PacWestLeagueatpunter…Onoffense,finishedwith500receivingyardand200rushingyards,scoting12touchdowns(includingtwoonpuntreturns)….Had11interceptionsandaveraged40yardsperpunt…2010:Finishedwith200receivingyardsand100rushingyardswithtwotouchdowns…Ondefense,finishedwithfourinterceptions…2009:LedPacWestLeaguewithseveninterceptions…Alsocompetedinvarsitybasketballandtrackandfield…Wasastatetournamentparticipantinbothsports.

Personal: SonofEric&SharonEngland…Computerscienceandbusinessmajor…IsmarriedtowifeBrittney…ChosePacificbecauseithadabeautifulcampusandasenseoffamilyandforthechancetoplayfootball…FavoriteTVShows:ModernMarvelsandMythbusters…FavoriteBook:TheVoyagesofDr.Doolittle(HughLofting)…FavoriteAthlete:DeanthonyThomas…FavoriteQuote:Forwardwarriorsandfearnotpainnordeath.

Nate FarrellFreshman • Wide Receiver • 5-8 • 157

Warrenton, Ore.Warrenton HS

88

High School:PlayedforJohnMattillaatWarrentonHighSchool…Alsoparticipatedinvarsitybasketballandtrackandfield.

Personal: SonofJonFerrellandTonyaBarker…Majorisundecided…ChosePacificbecauseitwasagreatschool…FavoriteTVShow:FamilyGuy…FavoriteBook:TheHobbit(J.R.R.Tolkien)…FavoriteClassInSchool:Economics…FavoriteQuote:Anythingcanhappen(DougCalvert)…CareerAmbition:

Sam GesickiFreshman • Wide Receiver • 6-1 • 190

Tracyton, Wash.Olympic HS

36

High School: PlayedatOlympicHighSchool…Alsocompetedintrackandfield.

Personal: SonofThomas&JulieGesicki…Exercisesciencemajor…ChosePacificbecauseofthefamilyatmosphereandthechancetobepartofanewfootballprogram...FavoriteTVShow:FamilyGuy…FavoriteClassInSchool:Sportsmedicine…FavoriteAthlete:MarcusTrufant…CareerAmbition:Physicaltherapist.

Tyler GilmoreFreshman • Punter • 6-3 • 175

Newberg, Ore.Newberg HS

86

High School:PlayedforT.J.TomlinatNewbergHighSchool…2011:HonorableMention6AAll-StatebyTheOregonianandFirstTeamAll-StatebytheNorthwestEliteIndexaswellasFirstTeamAll-PacificConferenceasapunter…Averaged39.6yardsperpunt…Alsosawtimeinprepcareeratquarterbackandcornerback…Alsocompetedinvarsitybaseballandtrackandfield.

Personal: SonofBrian&BeckyGilmore…Exercisesciencemajorandpsychologyminor…HisfatherplayedsocceratGeorgeFoxfrom1984to1985…Hisgrandfather,Robert,playedfootballatArmyfrom1961to1963…ChosePacificforthecoachingstaff,thefootballprogram,thefieldsofstudyandtheirexcellence...FavoriteTVShow:TheOffice…FavoriteBook:CrazyLove(FrancisChan)…FavoriteClassInSchool:Health…FavoriteQuote:Ifirmlybelievethatanyman’sfinesthour,thegreatestfulfillmentofallthatheholdsdear,isthemomentwhenhehasworkedhisheartoutinagoodcauseandliesexhaustedonthefieldofbattle–victorious.(VinceLombardi)…CareerAmbition:Athletictrainerwithspecialtiesinsportspsychologyandnutrition.

Caleb GottschalkSopohomore • Wide Receiver • 6-0 • 205

El Dorado Hills, Calif.Vista del Lago HS

23

High School: PlayedforJoeCattolicoatVistadelLagoHighSchool…2011:WasnamedSierraValleyConference’s(SVC)MostValuablePlayeratwidereceiver…MemberofSVCchampionshipteam…Atwidereceiver,finishedwith967yardswith11touchdowns…Brokeschoolrecordsinreceiving,totalyardsandtouchdowns…Alsohad95tacklesandthreesacksasastrongsafety…Atkicker,scored27extrapointsandhadsixfieldgoals…2010:FirstTeamAll-SVCatstrongsafety…MemberofVistadelLago’sSVCchampionshipteam…Finishedwith81tackles,twosacks,twoforcedfumblesandonefumblerecovery…Alsokicked19extrapoints…2009:MemberofVistadelLago’sSVCchampionshipteam…Asalinebacker,ledteamintackles,fumblerecoveriesandinterceptions…Alsokicked38extrapointsandfourfieldgoals…2008:MemberofVistadelLago’sSVCchampionshipteam…Ledteamintackles…Alsokicked32extrapointsandthreefieldgoals…Alsoplayedvarsityvolleyball,wherehewasanall-leagueselection.

Personal:SonofGreg&CrystalGottschalk…Majorisundecided…HisfatherplayedfootballatCalStateNorthridge…BrotherCharlieplayedsocceratSimpson(Calif.),brotherChrisplayedbaseballatUCDavisandsisterJessicaplayedsocceratHolyNames…Hiscousin,DarrenGottschalk,playedcollegiatelyatCalLutheranandplayedfortheNewOrleansSaints…ChosePacificfortheopportunitytoplaywithanewfootballprogram...FavoriteTVShow:TheColbertReport…FavoriteClassInSchool:Math…FavoriteAthlete:JoeMontana…FavoriteFood:Anythinghismomcooks.

Zack GreenbaumFreshman • Defensive Back • 5-8 • 195

Waikoloa, HawaiiHawaii Prep Academy

28

High School: PlayedforCharlieHallandJordanHaysieatHawaiiPreparatoryAcademy…Alsoplayedvarsitybasketballandvolleyball.Personal: SonofJudyGreenbaum…Businessmajor…ChosePacificbecauseitwasagreatschool…FavoriteTVShow:TheOffice…FavoriteAthleteToWatch:AdrianPeterson…FavoriteFood:Sushi.

GOBO

XERS

.COM


2012 NewcomersCarson Hannibal

Freshman • Linebacker • 6-0 • 215Salem, Ore.Sprague HS

64

High School:PlayedforRobinHillatSpragueHighSchoolasafullbackandlinebacker…Teamcaptain…Alsoplayedvarsityfootballandbasketball.

Personal: SonofEric&CarolHannibal…Biologymajorwithchemistryandmathematicsminors…ChosePacificbecauseitwasclosetohomewithagreatbiologyprogramandthechancetoplayvarsitysports...FavoriteTVShow:StarTrek…FavoriteBook:Cat’sCradle(KurtVonnegut)…FavoriteAthlete:DerekJeter…CareerAmbition:Physician.

Josh HannumFreshman • Defensive Lineman • 6-0 • 220

Kailua, HawaiiIolani School

85

High School: PlayedforWendallLookattheIolaniSchool…2011: Atdefensiveend,finishedwith12tackles,threesacks,oneforcedfumbleandonefumblerecovery…2010:Playedin11gamesatdefensiveendwiththreetackles…2009:Threwforfourtouchdownsasaquarterback…2008:Threwforeighttouchdowns…Alsoplayedvarsitybasketball…EddieK.HamadaAwardwinner.

Personal: SonofBill&BarbaraHannum…Businessmajor…ChosePacificforthegreatatmosphere,educationandfootballprogram...FavoriteMovie:ProjectX…FavoriteMovie:BlueSkinoftheSea(GrahamSalisbury)…FavoriteClassInSchool:History…CareerAmbition:Tobeasuccessfulbusinessmanthatisinvolvedinsports.

Lee HolscherFreshman • Defensive Back • 5-8 • 180


33

High School: PlayedforDwightJensenatForestGroveHighSchool…Alsoplayedvarsitybaseball…Wasatwo-timeFirstTeamAll-PacificConferenceinbaseballasautilityplayer.

Personal:SonofRich&ShannonHolscher…Specialeducationmajor…ChosePacificfortheeducationprogramandforthechancetoplayfootballandbaseball…FavoriteTVMovies:TheBatmantrilogy…FavoriteClassInSchool:P.E.…FavoriteAthlete:TimTebow…CareerAmbition:Specialeducationfacilitator.

Travis JamesFreshman • Defensive Lineman • 5-8 • 235

Modesto, Calif.Escalon HS

59

High School:PlayedforCoachLoureiroatEscalonHighSchool…2011:Played13gamesatnoseguardasEscalonfinishedrunner-upintheirsectionalchampionship…Finishedwith60tackles,threesacksandfourfumblesforced…2010: MemberofEscalon’sCIFDivisionIIIstatechampionshipteam…Finishedwith60tackleswithtwosacksandthreeforcedfumbles…2009:Finishedwith40tacklesandtwosacksin10games…2008: Finishedwith20tacklesandonesackinninegames…AlsocompetedinvarsitywrestlingwherewasanAll-TransValleyLeagueselectionandstatemeetqualifierat220pounds.

Personal:SonofDarrel&AlinaJames…Historymajor…HisfatherplayedfootballatPacificfrom1981-1984andhismotherplayedbasketballatPacificin1980-81…FavoriteTVShow:SouthPark…FavoriteBook:TheHarryPotterseries(J.K.Rowling)…FavoriteClassInSchool:History…FavoriteAthleteToWatch:PatrickWillis…CareerAmbition:Fireman.

Kevin JoFreshman • Defensive Lineman • 6-0 • 215

Concord, Calif.Clayton Valley HS

93

High School:PlayedforHercPardiatClaytonValleyHighSchool…2010:Receivedtheteam’sOutstandingLinemanAwardandScholar-AthleteAward…SelectedasaNationalFootballFoundation&CollegeHallofFameScholar-Athleteawardrecipient…HonorableMentionAll-DiabloValleyAthleticLeagueselectiononboththeoffensiveanddefensiveline…Finishedseasonwith93tacklesandsixsacksalongwithaninterceptionandablockedpunt…2008:Earnedtheteam’sOutstandingLinemanAward.

Personal:SonofChang&MoonJo…Computersciencemajor…ChosePacificforthebeautifulcampusandtheopportunitytoplayfootball…FavoriteTVShow:BreakingBad…FavoriteFood:Filetmignon…Hobbies:Bodybuilding.

Trey KodamaFreshman • Linebacker • 5-8 • 165

Pearl City, HawaiiKamehameha HS

20

High School:PlayedforDavidStantatKamehamehaHighSchool…2011:HonorableMentionAll-InterscholasticLeagueofHonolulu(ILH)selectionatlinebacker…Finishedwith60tacklesandoneforcedfumblein10games…AlsoplayedvarsitybaseballwherehewasanHonorableMentionAll-ILHselectionintheoutfield.

Personal:SonofGregg&Be-JayKodama…Businessmajor…ChosePacificbecausehelovedtheatmosphereandthenewfootballprogram…FavoriteTVShow:Sportscenter…FavoriteClassInSchool:Math…FavoriteQuote:IcandoallthingsthroughChristwhostrengthensme(Phillipians4:13)…CareerAmbition:Entrepreneur.

PACI

FIC

Foot

ball


2012 NewcomersZach Krause

Sophomore • Defensive Lineman • 6-2 • 225Clatskanie, Ore.

Clatskanie HS

90

High School: PlayedforTimStrongatClatskanieHighSchool…2010:FirstTeamAll-Lewis&ClarkLeagueandHonorableMention3AAll-Stateselectionatlinebacker…2009:FirstTeamAll-Lewis&ClarkLeagueandHonorableMentionOregon3AAll-Stateselectionatlinebacker…Two-yearteamcaptain…Alsoparticipatedinvarsitybasketballandtrackandfield.

Personal: SonofRhondaSmith…Elementaryeducationmajor…ChosePacificbecauseithasagreateducationprogramandhecouldplayfootballhere…FavoriteTVShow:BigBangTheory…FavoriteBook:QuietStrength(TonyDungy)…FavoriteClassInSchool:History….FavoriteQuote:IfIdonotwakeupinpaineverydaythensomethingiswrong(CoachSkirvin)…CareerAmbition:Teacher.

David LaryFreshman • Defensive Back • 5-8 • 165

Lake Los Angeles, Calif.Littlerock HS

31

High School:PlayedforRobertWattsandJamesVondraatLittleRockHighSchool…2011:HonorableMentionAll-GoldenLeagueselectionondefense…Finishedwith56tacklesatfreesafetyandcornerback…2010:Finishedseasonwith49tacklesandtwoforcedfumblesinninegamesaftfreesafetyandcornerback…Alsohadtwotouchdownsasawidereceiver…2009:Finishedwith39tackles,oneforcedfumbleandthreefumblerecoveriesin10gamesatfreesafety…Alsoparticipatedinvarsitybasketballandswimming.

Personal: SonofJohn&LauraLary…Mathematicsmajorwithexercisescienceminor…ChosePacificforthegoodacademicprogramandthechancetobepartofayoung,uprisingfootballprogram…FavoriteTVShow:Ridiculousness…FavoriteBook:OneFish,TwoFish,RedFish,BlueFish(Dr.Seuss)…FavoriteClassInSchool:Ceramics…FavoriteQuote:Hardworkbeatstalentbecausetalentdoesn’tworkhard…CareerAmbition:Mathteacherandfootballcoach.

Taylor MackFreshman • Offensive Lineman • 6-1 • 275

Bonney Lake, Wash.Bonney Lake HS

53

High School: PlayedforChadBarretatBonneyLakeHighSchool…WasanAll-SouthPugetSoundLeagueselectionatdefensivelineandwasnamedtheteam’sdefensivelinemanoftheyear…Alsoparticipatedinvarsitybaseballandtrackandfield,wherehewasadistrictmeetqualifierinthethrowingevents.

Personal: SonofBill&JaneMack…Exercisesciencemajor…ChosePacificfortheamazingcampus,thesmalltownfeel,thefootballprogramandthetop-notchcoachingstaff…FavoriteTVShow:TheOffice…FavoriteClassInSchool:Math…FavoriteFoods:Phoandsushi…FavoriteQuote:Dominationtakesdedication…CareerAmbition:Sportsmedicinedoctor.

Shahin MarzbandFreshman • Wide Receiver • 5-11 • 168

Hayward, Calif.Moreau Catholic HS

87

High School: PlayedforAndrewCoachatMoreauCatholicHighSchool…Wasanhonorablementionall-leagueselectionatwidereceiver…Alsoparticipatedinvarsitybasketball,tennisandtrackandfield.

Personal: SonofValrieMarzband…Pre-medicalmajorandbiomedicalsciencesminor…FavoriteTVShow:BurnNotice…FavoriteClassInSchool:Math…FavoriteQuote:Adversitycausessomementobreakandotherstobreakrecords…CareerAmbition:Orthopedicsurgeon.

Cesar MasonFreshman • Linebacker • 5-11 • 230

Kapolei, HawaiiKapolei HS

67

High School:PlayedforDarrenHernandezatKapoleiHighSchool…2011:Receivedtheteam’sDefensiveIronman,TeamPlayerandScholar-Athleteawards…Finishedwith58tackles,16forloss,eightsacksandtwoforcedfumbles…Ledtheteamintacklesforloss…Alsosawactionatpunter…2010:finishedwith14tackles,includingsevenforloss,threesacks,twocausedfumblesandtwofumblerecoveries…2009: Finishedwith40tackles,including10forloss,sixsacks,twoforcedfumblesandthreefumblerecoveries…Onoffense,rushedfor89yardsonfivecarries…2008: Had10tackles,includingsixforloss,twosacksandfourforcedfumbles…Alsocompetedinvarsitywrestling.

Personal: SonofWilliam&TanyaMason…Physicsmajor…ChosePacificfortheeducationalprogramsandforthelocation…FavoriteTVShow:Naruto…FavoriteBook:ChristopherPikebooks…FavoriteClassInSchool:Woodshop…FavoriteQuote:Hardworkbeatstalentwhentalentdoesn’tworkhard…CareerAmbition:Structuralengineer.

Michael MejiaFreshman • Tight End • 6-2 • 190

Fresno, Calif.San Joaquin Memorial HS

91

High School: PlayedforAnthonyGostonatSanJoaquinMemorialHighSchool…2011:FirstTeamAll-CountyMetroAthleticConferenceselection…Namedteamcaptainandthesquad’sIronManOfTheYear…Atlinebacker,finishedwith50tacklesandtwoforcedfumbles…Attightend,caughtfor200yardsandtwotouchdowns.

Personal: SonofPaulandTheresaMejia…Physicsmajor…ChosePacificforthesmalltownfeelandthechancetohelpbuildafootballprogram…FavoriteTVShow:NitroCircus…FavoriteBooks:DanBrownbooks…FavoriteClassInSchool:Science…FavoriteQuote:Thereisoffpositiononthegeniusswitch(DavidLetterman)…CareerAmbition:Mechanicalengineer.

GOBO

XERS

.COM


2012 NewcomersJoey Michael

Freshman • Defensive Back • 6-3 • 220Dryden, Wash.Cashmere HS

6

High School: PlayedforPhilZukowskiatCashmereHighSchool…2011:FirstTeamAll-CaribouTrailLeagueselectionatbothwidereceiveranddefensiveend…Selectedtoplayin1AAll-StateGame…Finishedwith235yardson12receptionsandrushedfor686yards,scoring15touchdowns...Ondefense,finishedwith28tackles,14sacksandtwofumblerecoveries…2010: SecondTeamAll-CaribouTrailLeagueatrunningback…Finished700rushingyardson73carriesand247receivingyardswith13touchdowns…Defensively,finishedwithseventackles,threesacksandthreeinterceptions…2009: HonorableMentionAll-CaribouTrailLeagueatsafety…Alsoparticipatedinvarsitytrackandfield…WasleaguechampionandfinishedfourthattheWashington1AStateChampionshipinthe110-meterhurdles…Alsowondistricttitleandplacedeighthatstateinthe300-meterhurdlesaswellasrunningalegonCashmere’sstatechampion400-meterrelayteam.

Personal: SonofEd&ConnieMichael…Exercisesciencemajor…HisfatherplayedbaseballatBigBendCC…UncleBillEdwardsonplayedbasketballatWarnerPacificandwasaninviteetoPortlandTrailBlazers’trainingcamp…HiscousinBillyEdwardsoncurrentlyplaysbasketballatWarnerPacific…ChosePacificfortheopportunitytohelpbuildthenewprogramandbecauseofthecommunitysupportforthefootballteam…FavoriteTVShow:BigBangTheory…FavoriteBook:LoneSurvivor(MarcusLuttrell)…FavoriteClassInSchool:Choir…FavoriteQuote:Togiveanythinglessthanyourbestistosacrificethegift(StevePrefontaine)…CareerAmbition:ToplayintheNFLorbecomeaphysicaltherapist.

Jack MichelsFreshman • Tight End • 6-5 • 240

Kirkland, Wash.Lake Washington HS

81

High School: PlayedforSteveSuppleatLakeWashingtonHighSchool…WasanHonorableMentionAll-KingCoLeagueselectionattightend…Alsocompetedinwrestling…Placedfourthatthe2011Washingtonstatechampionshipsat215poundsandfourthin2012at220pounds…WasnamedLakeWashington’sStudent-AthleteoftheYearin2012.Personal:SonofSteveMichelsandToryHaschak…Majorisundecided…HisfatherplayedbasketballatMaineandhisstepfather,MikeHaschak,wrestledatUCLA…ChoosePacificforthefootballprogramandthegreateducationthatisoffered…FavoriteTVShow:HowIMetYourMother…FavoriteBook:Ender’sGame(OrsonScottCard)…FavoriteClassInSchool:P.E….CareerAmbition:Firefighter.

Josh PaiementFreshman • Wide Receiver • 6-1 • 175

Eugene, Ore.Marist HS

24

Nick O’DonnellFreshman • Defensive Back • 6-4 • 215

Portland, Ore.College of the Siskiyous/Central Catholic HS

27

High School:PlayedforStevePyneatCentralCatholicHighSchool.

Personal:SonofBrian&ToniO’Donnell…Exercisesciencemajorandbiologyminor…ChosePacificbecauseitprovidedthemostdirectpathtoachievinghisgoalsinlife…FavoriteTVShow:FamilyGuy…FavoriteBook:FridayNightLights(H.G.Bissinger)…FavoriteClassInSchool:P.E….FavoriteQuote:It’sneverjustagame…CareerAmbition:Firefighter.

High School:PlayedforformerPacificfootballplayerFrankGeskeatMaristHighSchool…2011:All-MidwesternLeagueselectionasawidereceiver…Finishedwith558yardsreceivingwith12touchdowns.2010:All-MidwesternLeagueselectionasawidereceiver…Finishedwith393yardsandeighttouchdowns…2009: Finishedwith379passingandonetouchdownasaquarterback…Alsoparticipatedinvarsitybasketball,baseballandtrackandfield…WasaFirstTeamAll-MidwesternLeagueselectioninbasketballinboth2011and2012andafirstteamselectioninbaseballin2012.

Personal: SonofRay&SuePaiement…Exercisesciencemajor…HisfatherplayedfootballandbaseballatOregonfrom1974to1978…ChosePacificbecauseitwasagoodfitforhimathletically,academicandsocially…FavoriteTVShow:Franklin&Bash…FavoriteBook:PlayingWithPurpose(MikeYorkey)…FavoriteClassInSchool:Literature…FavoriteQuote:ItisGodwhoarmsmewithstrengthandmakesmywayperfect(Psalms18:32)…CareerAmbition:Acareerincoachingorexercisescience.

Alex PateFreshman • Defensive Lineman • 6-2 • 225

Brookings, Ore.Brookings-Harbor HS

61

High School:PlayedforJoeMorinatBookings-HarborHighSchool…WasaFirstTeamAll-FarWestLeagueselectiononboththeoffensiveanddefensivelines…Alsoplayedvarsitybasketball.

Personal: SonofEric&KarenPate…Pre-physicaltherapymajor…ChosePacificbecauseofthegreatcoachingstaff,thefriendlyenvironmentandthemedically-relatedmajors…FavoriteTVShow:LagunaBeach…FavoriteMovie:NeverBackDown…FavoriteClassInSchool:History…CareerAmbition:Acareerinsportsmedicine.

James PeckhamFreshman • Offensive Lineman • 6-5 • 299

Everett, Wash.Archbishop Murphy HS

66

High School: PlayedforDaveWardatArchbishopMurphyHighSchool…2011:EarnedAll-CascadeConferenceselectionasanoffensivelineman…Alsocompetedinvarsitytrackandfieldandwrestling…Specializedintrackintheshotputanddiscus.

Personal:SonofDaniel&RobinPeckham…Pre-physicaltherapymajor…ChosePacificbecausehelikedthevibeatmospheresurroundingtheschool…FavoriteQuote:Hardworkbeatstalentwhentalentdoesn’tworkhard.

Jaquari PeopleFreshman • Defensive Back • 5-9 • 175

Merced, Calif.Merced HS

17

High School: PlayedatMercedHighSchool.

Personal: SonofVickiPeople…Biologymajor…ChosePacificforthegreatopportunitiesthatPacificpresentedforhimeducationally.

PACI

FIC

Foot

ball


2012 NewcomersJulian Perea-Schaefer

Freshman • Wide Receiver • 5-11 • 170Phoenix, Ariz.

Horizon HS

8

High School:PlayedforSteveCaseyatHorizonHighSchool…2011: Secondteamall-regionselectionasawidereceiver…Alsoparticipatedinvarsitytrackandfield.

Personal: SonofDouglasSchaeferandMarthaPerea…Majorisundecided…ChosePacificbecauseoftheattitudeofthecoachingstaffandthediversityofboththeteamandtheUniversity…FavoriteTVShow:FamilyGuy…FavoriteMovie:Ray…FavoriteClassInSchool:Math…FavoriteQuote:Falldownseventimes,getupeight(DwayneWade)…CareerAmbition:Dentistry.

Jack PerezFreshman • Linebacker • 6-1 • 235

Petaluma, Calif.Petaluma HS

42

High School: PlayedforRickKristatPetalumaHighSchool…2011:FirstTeamAll-SonomaCountyLeagueandAll-EmpireRegionatlinebacker…Wasnamedtheteam’smostvaluableplayer…Finishedwith115tackles,includingsevenforloss,5.5sacks,twoforcedfumblesandtwointerceptions…2010:Finishedwith60tackles,includingtwoforloss,twosacksandoneforcedfumble…2009:Finishedwith75tackles,includingfourforloss,andthreesacks…Alsoplayedvarsitybasketball.

Personal:SonofJames&MaryLizPerez…Psychologymajor…Hisbrother,James,playedfootballandbaseballatWillamette…Hisuncle,Gary,playedbaseballandsoccerattheUniversityofthePacific…FavoriteTVShow:FamilyGuy…FavoriteBook:Night(ElieWiesel)…FavoriteClassInSchool:History…FavoriteQuote:Heroesareremembered,butlegendsneverdie(BabeRuth)…CareerAmbition:Lawenforcement.

Kamana PimentelFreshman • Running Back • 5-6 • 185

Kaneohe, HawaiiSt. Louis HS

32

High School: PlayedforDarnellArceneauxatSt.LouisHighSchool…2011:SecondTeamHawaiiAll-StateandFirstTeamAll-InterscholasticLeagueofHonolulu(ILH)selectionatrunningback…carriedfor964yardsand11touchdowns…2010: HonorableMentionAll-ILHselectionatrunningback…Finishedwith120yardson11carriesandtwotouchdowns…AlsoplayedvarsitybaseballwherehewasanHonorableMentionAll-ILHselectionintheoutfield.

Personal: SonofWilliam&PatriciaPimentel…Chemistrymajor…Hisbrother,Kiha,playedfootballatStanford…ChosePacificforthepharmacyprogramandPacific’sAdvantageProgram(forstudentswhowanttoenterthemedicalprofession)…FavoriteTVShow:FamilyGuy…FavoriteBook:TheWisdomOfOurFathers(TimRussert)…FavoriteClassInSchool:Chemistry…FavoriteQuote:WithGodallthingsarepossible(Matthew19:26)…CareerAmbition:Pharmacist.

Zak PorcheFreshman • Linebacker • 5-11 • 210

Olympia, Wash.Timberline HS

62

High School:PlayedforNickMullenatTimberlineHighSchool…2011:FirstTeamWashington4AAll-State,firstteamall-areaandSecondTeamAll-NarrowsLeagueselectionatpunter…averaged41.6yardson27punts…WasalsoselectedSecondTeamAll-NarrowsLeagueselectionatlinebacker…Finishedwith113tackles,twosacks,oneforcedfumbleandonefumblerecovered…2010:HonorableMentionAll-NarrowsLeagueasanoffensivelineman…Finishedwith59tacklesandtwofumblerecoveriesasalinebacker…Alsoparticipatedinvarsitytrackandfieldandbaseball…WasamemberofTimberline’sstaterunner-upbaseballteam.

Personal:SonofCharles&RosannaPorche…Mathematicsmajor…ChosePacificbecauseitwasthebestfitforhimintermsofacademicexcellenceandfootball…FavoriteTVShows:NitroCircus,andRobDyrdek’sFantasyFactory…FavoriteBook:TheEragonseries(ChristopherPaolini)…FavoriteClassInSchool:Math…CareerAmbition:Toownhisownautomotivedesigncompanyorcarcompany.

Patrick PowellFreshman • Defensive Lineman • 5-10 • 265

Grants Pass, Ore.Grants Pass HS

97

High School: PlayedforJohnMusseratGrantsPassHighSchool…2011:HonorableMentionAll-SouthwesternConferenceselectionatguard…2010:HonorableMentionAll-SouthwesternConferenceselectionatcenter…Alsoparticipatedinpowerliftingandsettheschool’scombinedliftrecordat1,250pounds.

Personal:SonofJerry&CarolPowell…Chemistrymajorandbiologyminor…ChosePacificbecauseitofferedanexcellentacademicsettingwithsmallclasssizesandtoparticipateinthefootballprogram…FavoriteTVShow:FamilyGuy…FavoriteBook:BraveNewWorld(AldousHuxley)…FavoriteClassInSchool:Science…FavoriteQuote:Ifirmlybelievethatanyman’sfinesthour,thegreatestfulfillmentofallthatheholdsdear,isthatmomentwhenhehasworkedhisheartoutinagoodcauseandliesexhaustedonthefieldofbattle–victorious(VinceLombardi)…CareerAmbition:Pharmacist.

Jacob PowersFreshman • Linebacker • 5-10 • 190

Hillsboro, Ore.Hillsboro HS

63

High School:PlayedforKenIngramatHillsboroHighSchool…2011:HonorableMentionAll-PacificConferenceselectionattightend…Finishedwith118yards…Atlinebacker,finishedwith52tackles,includingsixforloss,twosacksandfourfumblerecoveries…ReceivedtheAirForceOutstandingStudent-AthleteScholarshipandRandyFescheAward…2010: Atlinebacker,had33tackles,includingtwoforlossandsixfumblerecoveries…Alsocompetedinvarsitybaseballandwrestling.

Personal:SonofScott&MichelePowers…HistorymajorandSpanishminor…Hisuncle,BarryGauch,playedbaseballatVirginiaTechandintheChicagoWhiteSoxsystem…ChosePacificforthestaff-to-studentratio,thecampusandfacilities,thefamilyfeelofthefootballteamandthesmalltownatmosphere…FavoriteTVShow:QuickPitch…FavoriteBook:Anthem(AynRand)…FavoriteClassInSchool:ChildServices…FavoriteQuote:Whetheryouthinkyoucanoryouthinkyoucan’t,you’reright(HenryFord)…CareerAmbition:Highschoolhistoryteacherandfootballcoach.

GOBO

XERS

.COM


2012 NewcomersHayden Pyatt

Freshman • Defensive Back • 6-0 • 185Anchorage, Alaska

North Marion HS (Ore.)

11

High School: PlayedforBillCrumleyatNorthMarionHighSchoolinAurora,Ore….2011:SecondTeamAll-Tri-ValleyLeagueselectionatdefensiveback…Finishedseasonwith89tackles,including11forloss,twosacksandoneforcedfumble…2010:SecondTeamAll-Tri-ValleyLeagueatdefensiveback…Finishedwith81tackles,includingnineforloss,threesacksandtwoforcedfumbles…Alsoparticipatedinvarsitytrackandfield.

Personal:SonofKevin&DanaPyatt…Businessmajor…Hiscousin,BariRogers,playedfootballatWesternOregon…ChosePacificfortheacademicprestigeandtheabilitytocontributetoagrowingfootballprogram…FavoriteTVShow:TheOffice…FavoriteBook:TheHobbit(J.R.R.Tolkien)…FavoriteClassInSchool:Economics…FavoriteQuote:Perfectionisnotattainable,butifwechaseperfectionwecancatchexcellence(VinceLombardi)…CareerAmbition:Torunhisownbusiness.

Riley RankinFreshman • Offensive Lineman • 6-2 • 250

Florence, Ore.Siuslaw HS

60

High School: PlayedforTimDodsonatSiuslawHighSchool…2011:HonorableMentionAll-FarWestLeagueselectionatcenter…MemberofSiuslaw’s4Astateplayoffteam…Alsoplayedvarsitybasketballandbaseball…WasaFirstTeamAll-FarWestLeagueselectioninbaseballatfirstbase.

Personal:SonofDaniel&VickiRankin…Politicalscienceandmusicmajor…CountsasacousinCollegeFootballHallofFamememberandformerMondayNightFootballanalystDonMeredith…CousinDavidMeredithplayedfootballatMichigan…ChosePacificforthechancetoearnhisdegreefromaprestigiousuniversityandforthechancetoplayfootballafterhighschool…FavoriteTVShow:Law&Order:SVU…FavoriteTVShow:IntoThinAir(JonKrakauer)…FavoriteClassesInSchool:Socialscienceclasses…FavoriteQuote:Ifyouwantsomethingyou’veneverhad,youaregoingtohavetodosomethingyouhaveneverdone(KeithBuckley)…CareerAmbition:UnitedStatessenatororperformingmusician.

Justin RevillaFreshman • Linebacker • 5-8 • 190

Mililani, HawaiiMililani HS

51

High School:PlayedforRodYorkatMililaniHighSchool…Wasnamedtheteam’sdefensivemostvaluableplayer…AlsoplayedvarsitybaseballandwasanHonorableMentionAll-InterscholasticLeagueofHonoluluselectionatfirstbase.

Personal: SonofRyan&LisaRevilla…Biologymajor…ChosePacificbecauseoftheacademicprogramsandthefootballprogram.

Nicholas SchillaFreshman • Offensive Lineman • 6-0 • 280

Honolulu, HawaiiPunahou HS

51

High School:PlayedforKaleAneatthePunahouSchool…Alsoplayedvarsitybaseball.

Personal: SonofLindaLeeFarm…Businessadministrationmajor…Hisbrother,Fred,playedoneyearoffootballatWillamette…ChosePacificfortheacademicopportunitiesandthefamilyenvironment…FavoriteTVShow:Friends…FavoriteBook:TheHarryPotterseries(J.K.Rowling)…FavoriteClassInSchool:History…FavoriteQuote:Hardworkbeatstalentwhentalentdoesn’tworkhard.

Benjamin SchmidFreshman • Quarterback • 6-1 • 205

Sandpoint, IdahoSandpoint HS

17

High School: PlayedforMikeMitchellatSandpointHighSchool…Wontheteam’soffensivemostvaluableplayeraward.

Personal: SonofBrian&NancySchmid…Majorisundecided…ChosePacificbecauseoftherightbalancebetweenacademicsandathletics…FavoriteBook:GarryPaulsenbooks…FavoriteClassInSchool:Math…FavoriteAthlete:AaronRogers.

Cade SchultzFreshman • Defensive Back • 6-1 • 190

Monrovia, Calif.Monrovia HS

16

High School: PlayedforRyanMaddoxatMonroviaHighSchool…2011:HonorableMentionAll-RioHondoLeagueselectionatlinebacker…All-CIFSouthernSectionselection…Namedtheteam’smostimprovedplayer…Finishedwith86tacklesandninetacklesforloss.

Personal:SonofCurtSchultzandTamiBlair…Mediaartsmajorandbusinessminor…ChosePacificforthelocationandthefootballprogram…FavoriteBook:ScarTissue(AnthonyKeidis)…FavoriteClassInSchool:Science…FavoriteQuote:Failingtoprepareispreparingtofail(JohnWooden).

Nathan SelbyFreshman • Wide Receiver • 5-9 • 175

Hillsboro, Ore.Liberty HS

19

High School: PlayedforEricMahlumatLibertyHighSchool…2011:SecondTeamAll-NorthwestOregonConferenceselectionasafreesafety…Wasalsotheteam’sstartingquarterbackforthreeyears…Alsoparticipatedinvarsitybaseball,wrestlingandtrackandfield…Wasatwo-timestatewrestlingtournamentqualifierandaFirstTeamAll-NWOCselectionat170pounds…Finishedseventhat2010statetrackmeetinthe1,600-meterrelay.

Personal:SonofLee&PollySelby…Historymajor…Hisuncle,JimSelby,playedfootballatKentState…ChosePacificbecauseitwasclosetohomeandforboththeacademicsandathleticsprograms…FavoriteTVShows:SportsCenter,PawnStarsandtheHistoryChannel…FavoriteBook:TheHarryPotterseries(J.K.Rowling)…FavoriteClassInSchool:History…FavoriteQuote:Ifyou’regonnashoot,shoot.Don’ttalk!(TucoRamirezfromTheGood,TheBad&TheUgly)…CareerAmbition:Teacherandcoach.

PACI

FIC

Foot

ball


2012 NewcomersWarner Shaw

Freshman • Quarterback • 6-1 • 190Waimea, Hawaii

Kamehameha-Hawaii HS

12

High School:PlayedforDanLyonsatKamehameha-HawaiiHighSchool…2011: BigIslandInterscholasticFederation(BIIF)OffensivePlayeroftheYearasaquarterback…Passedfor2,134yardsand26touchdowns,completing149of252passes…2010:SecondTeamAll-BIIFselectionatquarterback…Finishedwith1,149yardspassingand13touchdowns,completing85of170passesashehelpedleadKamehamehatotheBIIFchampionship…2009:Finishedwith962yardspassingandninetouchdownswhilecompleting49of103passes…Alsocompetedinvarsitytrackandfield.

Personal: SonofWarren&AmeliaShaw…Exercisesciencemajor…FavoriteClassInSchool:English…FavoriteAthletesToWatch:PeytonmanningandTomBrady…FavoriteQuote:Ifyourvisionisclear,yourchoicesareeasy(WaltDisney)…CareerAmbition:Professionalathleteorphysicaltherapist.

Andrew SimonsFreshman • Defensive Lineman • 6-1 • 205

Oregon City, Ore.Oregon City HS

80

High School:PlayedforKevinStrausseratOregonCityHighSchool…WasanAll-ThreeRiversLeagueselectionatdefensiveend…Alsoparticipatedinvarsitytrackandfieldandlacrosse.

Personal: SonofDmitri&DeannaSimons…Majorisundecided…ChosePacificforthepharmacyprogramandthefootballprogram…FavoriteTVShow:BreakingBad…FavoriteBook:TheSunAlsoRises(ErnestHemingway)…FavoriteClassInSchool:Biology…CareerAmbition:Pharmacist.

Jason SmithFreshman • Wide Receiver • 6-1 • 189

Black Diamond, Wash.Tahoma HS

84

High School: PlayedforTonyDavisatTahomaHighSchool…2011:FirstTeamAll-SPSLLeagueasawidereceiveranddefensiveback…NamedTheSPSL’sSpecialTeamsPlayeroftheYear…SelectedasaNationalFootballFoundationScholar-AthletenomineeandwasnamedtheWashingtonStateFootballCoachesAssociationAll-StateFootballTeam…Brokeschool’sreceptionrecordandledleaguewith883yardsandeighttouchdownson57receptions…Finishedwith46tacklesandtwointerceptionsasacornerback…Had17kickreturnsfor453yardsandatouchdownandninepuntreturnsfor89yards…2010:SecondTeamAll-SPSLLeagueasadefensivebackandHonorableMentionAll-SPSLLeagueatwidereceiver…Had66tacklesondefenseand238yardsandfourtouchdownson14receptionsatwidereceiver…Made22kickreturnsfor643yardsandtwotouchdownsand11puntreturnsfor119yards…2009:Had26tacklesandthreeinterceptionsinsixgamesatcornerback…Alsoplayedvarsitybasketballandbaseball…WasanHonorableMentionAll-SPSLselectionasanoutfielder.

Personal: SonofLarrySmith&DawnYoshimura-Smith…Exercisesciencemajor…HisfatherplayedfootballatPugetSoundfrom1980to1983…ChosePacificfortheacademicprograms…FavoriteTVShow:ModernFamily…FavoriteAthlete:KenGriffey,Jr.,FavoriteFood:Thaifood…CareerAmbition:Physicaltherapist.

Jordan SpencerFreshman • Defensive Line • 5-9 • 238

Seattle, Wash.Ingraham HS

37

High School: PlayedforEliSmithatIngrahamHighSchool…2011:HonorableMentionAll-Metro-SoundLeagueontheoffensiveline…Alsoplayedvarsitysoccerandbasketball.

Personal:SonofMaribethSpencer…Majorisundecided…Hisgodfather,SteveBastian,playedfootballatWillamette…ChosePacificfortheacademicchallengeandthechancetoplayforanewfootballteam…FavoriteTVShow:StargateAtlantis…FavoriteBook:Rainbow6(TomClancy)…FavoriteClassInSchool:Physics…FavoriteQuote:Sizzle,ballsoharduniversity(TerrellSuggs)…CareerAmbition:Lawenforcement.

Tyler StewartFreshman • Defensive Lineman • 6-0 • 210

St. Helens, Ore.St. Helens HS

69

High School: PlayedforJohnEnglandatSt.HelensHighSchool…HonorableMention5AAll-StateandFirstTeamAll-NorthwestOregonLeagueselectionatdefensiveend…HonorableMentionAll-NorthwestOregonLeagueattightend…Finishedwith74tackles,fivesacks,fiveforcedfumblesandtwofumblerecoveries.

Personal:SonofChristopher&CasieBaruffi…Exercisesciencemajor…ChosePacificbecauseitseemedsofamiliarandheknowshecanbesuccessfulhere…FavoriteTVShow:That70sShow…FavoriteBook:Ender’sGame(OrsonScottCard)…FavoriteClassesInSchool:PsychologyandEnglish…CareerAmbition:Physicaltherapist.

Nathan SuyematsuFreshman • Wide Receiver • 6-9 • 160

Tualatin, Ore.Tualatin HS

66

High School: PlayedforRobHastinatTualatinHighSchool…2011:FirstTeamAll-PacificConferenceandHonorableMention6AAll-Stateselectionatkicker…Finished8for8infieldgoals…Alsoplayedvarsitybasketballandbaseball…WasthePacificConferencePlayeroftheYearinbasketballandwasaFirstTeamAll-PacificConferenceandHonorableMentionAll-Stateselectioninbaseballasaninfielder.

Personal:SonofGlen&AliceSuyematsu…Pre-physicaltherapymajorandbusinessminor…ChosePacificforthefootball,baseballandphysicaltherapyprograms…FavoriteTVShow:TwoAndAHalfMen…FavoriteMovie:21JumpStreet…FavoriteAthlete:StevenJackson…CareerAmbition:Physicaltherapist.

GOBO

XERS

.COM


2012 NewcomersShayne Tanabe

Freshman • Defensive Back • 5-8 • 170Mililani, Hawaii

Mililani HS

2

High School: PlayedforRobYorkatMililaniHighSchool…2011:HonorableMentionHawaiiAll-Stateselectionatcornerback…Alsoparticipatedinvarsitytrackandfield.

Personal:SonofWayne&SherriTanabe…Businessmajor…ChosePacificbecauseitwasagreatacademicschoolandtheopportunitytocontinuetoplaysportsatacompetitivelevel.

Jonathon TangalinFreshman • Wide Receiver • 5-8 • 150

Kehaka, HawaiiWaimea HS

35

High School:PlayedatWaimeaHighSchool.

Personal: SonofStephen&MelissaTangalin…Exercisesciencemajorandcomputerscienceminor…ChosePacificbecausehelikedthecoaches…FavoriteTVShow:Sportscenter…FavoriteBook:PlayingforPizza(JohnGrisham)…FavoriteClassInSchool:Weighttraining.

Jacob TorquatoFreshman • Offensive Lineman • 5-11 • 275

Holtville, Calif.Holtville HS

59

High School:PlayedforKeithSmith,Jr.,atHoltvilleHighSchool…2011:FirstTeamAll-ManzanitaLeagueselectionontheoffensiveline…2010: FirstTeamAll-ManzanitaLeagueatoffensivelineman…2009:FirstTeamAll-ManzanitaLeagueonthedefensiveline…Alsoparticipatedinvarsitytrackandfieldandwrestling.

Personal: SonofJoseph&TheresaTorquato…Computersciencemajor…ChosePacificforthecomputerscienceprogramandthebuildingofthefootballprogram…FavoriteBook:1984(GeorgeOrwell)…FavoriteMovie:Blade…FavoriteClassInSchool:Math.

Christopher TorresJunior • Offensive Lineman • 6-1 • 290

San Jose, Calif.West Valley JC/Del Mar HS

52

West Valley College:PlayedtwoseasonsatthejuniorcollegeinSaratoga,Calif.,underJimWinkler…Started17of20gamesatcenterandguard.

High School:PlayedatDelMarHighSchool…2009: FirstTeamAll-WestValleyLeagueatcenter…Wasnamedtheteam’sdefensivemostvaluableplayer…Alsoparticipatedinvarsitytrackandfield.

Personal:SonofAlejandroTorresandCarmenVega…Physicsmajor…ChosePacificbecausehelovedthecultureandthesmalltownatmosphere…FavoriteClassInSchool:Math…FavoriteAthlete:JerryRice…FavoriteQuote:Thetruemeasureofamanishowhetreatssomeonewhocandohimabsolutelynogood(AnnLanders)…CareerAmbition:Mechanicalengineer.

Lamar WilliamsFreshman • Defensive Back • 5-9 • 170

Spanaway, Wash.Bethel HS

21

High School: PlayedforGavinKralikatBethelHighSchool…2011:SecondTeamAll-SouthPugetSoundLeagueatlinebacker…Finishedwith97tackles…2010:Finishedwith76tacklesandthreeinterceptions…Alsoparticipatedinvarsitytrackandfield.

Personal: SonofJames&ThuWilliams…Businessadministrationmajor…FavoriteTVShow:TopGear…FavoriteClassInSchool:Weighttraining…CareerAmbition:Businessownerforrepresentingathletes.

Austin ZimbrickFreshman • Defensive Lineman • 6-1 • 240

St. Helens, Ore.St. Helens HS

71

High School:PlayedforJohnEngelandatSt.HelensHighSchool…2011: HonorableMentionAll-NorthwestOregonConferenceatbothcenteranddefensiveend…Finishedwith64tacklesondefensewithsixsacks,oneforcedfumbleandthreefumblerecoveries…2010:HonorableMentionAll-NorthwestOregonLeagueatcenter…Finishedwith23tacklesatdefensivetackle.

Personal:SonofRobin&EdZimbrick…Exercisesciencemajor…Hisbrother,Kyle,rantrackandfieldatPacific…ChosePacificforthesmallcollegeatmosphereandtheopportunitytocontinueplayingfootball…FavoriteTVShow:TopGearUK…FavoriteBook:Eragon(ChristopherPaolini)…FavoriteClassInSchool:History…CareerAmbition:CoastGuardorphysicaltherapist.

Pronunication GuideLandon AW-Ah-Noh (Aano)Greg AY-Lip (Alip)Kuh-LEE-Kee Buh-LAH-Duh (Keli’i Balada)Eddie Kuh-REE-Oh (Carrillo)Petr DAN-Schev (Danchev)Nick DAY-Trey (Datray)Dominique DON-Uh-HEE (Donaghy)Justin FA-Ah-Gaow (Fa’agau)Shane FOYER-BACH (Feuerbach)Eric GEET-Zinn (G as in Get) (Gietzen)Sam Guh-SEH-Kee (Gesicki)I-Ray Ho-SAY-Uh (Irae Hosea)Kelson Kuh-VY (Kawai)Bobby Luh_DIH-Jiss (Ladiges)Devin Luh-GOR-Ee-Oh (Lagorio)Jack MICHAELS (Michels)P.J. Min-NAY-Uh (Minaya)KAH-Moo (Kamu) MoritaDustin Para-DEES (Paradis)Kuh-MAH-Nuh PEE-Min-Tell (Kamana Pimentel)Zak PORSH (Porche)Steel ROE-Shuh (Rocha)Justin Ruh-VELL-Uh (Revilla)Gunther SHULT-Zee (Schultze)Alen SOOK-Lee-Ay (Suklje)Nathan Su-YOO-Mat-Soo (Suyematsu)Jonathon TANG-Uh-Linn (Tangalin)Moses Villa-REE-Al (Villareal) GomezLandon WY-Marr (Weimar)

PACI

FIC

Foot

ball


Referee’s Signals

Ball ready for play*Untimed down

Start clock

Incomplete forw ard passPenalty declined

No play, no scor eToss option delayed

Illegal touching or30-second timeout First touching (NF)Sideline warningDisregard flag

Uncatchableforw ard pass Substitution infraction

Illegal shift - 2 handsIllegal motion - 1 hand

Loss of down

1 2 3 4 5 6

7

8

9 10 11 12 13 14 15 16

17

18 19 20 21 22

(NF) High School

First down

Ball deadTouchback (move

side to side)Safety

Offside defenseor free kick team

Encroachment (NF)

Official Football Signals

Failure to wearrequired equipment

Illegal helmetcontact

23 24 27

Illegal participation

28

Running intoor roughing kicker

or holder

Illegal fair catch signal (NF)Invalid fair catch

signal (NF)Sideline interference

Illegal battingIllegal kicking

(followed by pointingtoward toe for kicking)

29 30 31 32 33

Roughing passer Intentional grounding

34 35 36

Ineligible downfieldon pass Personal foul

37 38

ClippingBlocking below waist

Illegal block Chop block

Illegal block in the back Holding/obstructing

Illegal use of hands/arms

39 40 41 42 43

Helping runnerInterlocked blocking

44

Tripping

46

Player disqualification

47

National Collegiate Athletic Association

Note: Signal numbers 25 and 26 are for future expansion.

Time-outDiscretionary or injury time-out

(follow by tapping handson chest)

TV/Radio time-out

TouchdownField goal

Point(s) after touchdown

Legal touching of forwardpass or scrimmage kick

Inadvertent whistle(Face Press Box) End of period

False startIllegal formation

Encroachment offense Delay of gameUnsportsmanlike conduct

Noncontact foul

Forward passinterference

Kick-catching interferenceIllegal pass

Illegal forwardhandling

Grasping face mask orhelmet opening

45

www.ncaa.org

2012Opponents


Lewis & Clark’s Fred Wilson Field at Griswold Stadium was the site of Pacific’s first

Northwest Conference game since 1984 on Oct. 2, 2010

PACI

FIC

Foot

ball


2012 OpponentsSIMON FRASER

Location:Burnaby,B.C.,Canada Enrollment: 35,204Nickname:Clan Colors:Red&BlueConference: GreatNorthwest(NCAADivisionII)Stadium:TerryFoxField(Uncovered,FieldTurf )President:AndrewPetterAthletic Director:Dr.MiltonRichardsSports Information Director:BenHodgeSID Phone:604-368-2634 SID Fax:778-782-3425SID E-Mail:[email protected] Website:www.sfu.ca/athleticsFacebook:facebook.com/sfuclan Twitter:@sfuclanHead Coach:DaveJohnson(SimonFraser)Johnson’s Record At Simon Fraser:10-33Johnson’s Record Overall:10-33Assistant Coaches:JasonBeck(OC),DinoGeremia(DC),KevinPhillips(RB),TakAtkins(OL),AdamJohnson(OL/T),MichaelLionetto(FS),EvanMozzochi(WR),LanceStillborn(TE/FB),DonSweet(K),RonTurner(DE),BryanWyllie(DT),SteffKruck(QualityControl),EldrickHill(DB).2011 Record:3-7 GNAC Record:2-6(4th)All-Time Series: SimonFraserleads9-5-0Last Meeting:SimonFraserwon36-28atForestGroveonSept3,2011

2011 SCHEDULE & RESULTS

9/3 at Pacific W 36-289/10 WesternOregon* L35-289/17 atDixieState* L42-79/24 HumboldtState* L35-710/1 atCent.Washington* L37-1710/8 DixieState* W62-56(ot)10/15 atWesternOregon* L34-1010/22 atSouthernOregon L31-2810/29 atHumboldtState* L42-1011/5 Cent.Washington* W35-24

2012 SCHEDULE

8/30 at Pacific 7 p.m.9/8 Cent.Washington* 2p.m.9/15 atHumboldtState* 6p.m.9/22 atWesternOregon* 1p.m.9/29 DixieState* 6p.m.10/6 AzusaPacific* 2p.m.10/13 atCent.Washington* 2p.m.10/20 WesternOregon* 2p.m.10/27 atDixieState* 2p.m.11/3 HumboldtState* 2p.m.11/10 atAzusaPacific* 6p.m.

LAST MEETINGOct. 26, 1991 at Burnaby, B.C.Simon Fraser 10 0 7 19 36 Pacific (Ore.) 7 7 7 7 28 Scoring Summary1st 12:57 SFU Bo Palmer 23 yd run (Soll kick) 03:24 PAC Gunther Schultze 9 yd run (Moses Villareal-Gomez kick) 01:34 SFU Soll 27 yd field goal2nd 11:49 PAC Bryce Kershner 2 yd run (Moses Villareal-Gomez kick),3rd 08:04 PAC Jordan Fukumoto 36 yd pass from T.C. Campbell. (Moses Villareal-Gomez kick) 04:23 SFU Berger 54 yd interception return (Strickland kick), , SFU 17 - PAC 214th 11:12 SFU Bo Palmer 72 yd run (Strickland kick blockd), 2-80 1:03, SFU 23 - PAC 21 07:54 SFU Bowcott 8 yd run (Strickland kick blockd), 3-33 0:57, SFU 29 - PAC 21 02:40 SFU Bowcott 2 yd run (Strickland kick), 7-50 2:42, SFU 36 - PAC 21 00:43 PAC Matt Nyberg,11 yd pass from T.C. Campbell

RECAP: See full game summary on page XX.

Game No. 1Aug. 30, 2012 • 7 p.m.Lincoln Park StadiumForest Grove, Ore.

OCCIDENTAL

Location:LosAngeles,Calif. Enrollment: 2,100Nickname:Tigers Colors:Orange&BlackConference: SouthernCaliforniaIntercollegiate(NCAADivisionIII)Stadium:JackKempStadium(4,000,uncovered,FieldTurf )President:Dr.JonathanVeitchAthletic Director:JaimeHoffmanSports Information Director:MichaelWellsSID Phone:323-259-2724 SID Fax:NoneSID E-Mail:[email protected] Website:www.oxythletics.comFacebook:on.fb.me/SBqu3MTwitter:@OxyAthleticsHead Coach:BillRedellRedell’s Record At Occidental:FirstSeasonRedell’s Record Overall:FirstSeasonAssistant Coaches:EricBergstron(AssociateHC/OC).ErikJohnson(DC/ILB),RobHartenfels(ST/CB),EdwardPark(WR),MattAndersen(OLB),JeffKearing(RB),LanceFauria(RB),KevinMay(S),JustinLuthey(DL),KoreyJanse(K).2011 Record:5-4 SCIAC Record:3-3(3rd)All-Time Series: FirstMeetingLast Meeting:FirstMeeting


9/10 atPugetSound W30-129/17 Menlo L41-1710/1 atWhittier* W31-1710/8 LaVerne* L31-2010/15 atPomona-Pitzer* W42-3510/22 Redlands* L42-2010/29 Chapman W27-1711/5 Claremont-M-S* W35-3111/12 atCalLutheran* L70-20

2012 SCHEDULE

9/8 Pacific 7 p.m.9/15 atMenlo 1p.m.9/29 atRedlands* 7p.m.10/6 Claremont-M-S* 7p.m.10/13 atChapman* 7p.m.10/20 atCalLutheran* 1p.m.10/27 Pomona-Pitzer* 7p.m.11/3 Whittier* 7p.m.11/10 atLaVerne* 1p.m.

LAST MEETINGThis will be the first meeting between Pacific and Occidental.

Game No. 2Sept. 8, 2012 • 7 p.m.Jack Kemp StadiumLos Angeles, Calif.

GOBO

XERS

.COM


2012 OpponentsWILLAMETTE

Location:Salem,Ore. Enrollment: 1,800Nickname:Bearcats Colors:Cardinal&OldGoldConference: Northwest(NCAADivisionIII)Stadium:McCulloughStadium(2,600,covered,FieldTurf )President:StephenE.Thorsett Athletic Director:DavidRigsbySports Information Director:RobertMcKinneySID Phone:503-370-6110 SID Fax:503-370-6379SID E-Mail:[email protected] Website:www.willamette.edu/athleticsFacebook:facebook.com/wubearcatsTwitter:@wubearcatsHead Coach:GlenFowles(Willamette1996)Fowles’ Record At Willamette:FirstSeasonFowles’ Record Overall:FirstSeasonAssistant Coaches:NathanNaggi(DC),BrianSheppard(OC/QB),TonyCassinerio(DB),BrandonCrosby(RB/REC),LukkesGilgan(OLB),JohnHorner(LB),BrandonLemon(DB),MikeyLemon(WR),KennyMiller(OL),ChuckPinkerton(RB),JoshScott(ST/WR),DarrylSmith(DL),TannerSmith(OL/K).BrentTurner(Off.Asst.)2011 Record:4-6 NWC Record:3-3(tie4th)All-Time Series: Willametteleads51-25-5Last Meeting:Willamettewon49-7inSalem,Ore.,onOct.8,2011


9/3 Wis.-StevensPoint L8-69/10 Hardin-Simmons L30-249/17 SouthernOregon W31-910/1 Linfield* L20-1010/8 Pacific* W 49-710/15 atPugetSound* W49-3110/22 atPortlandState L36-1010/29 Whitworth* L25-2411/5 atLewis&Clark* W57-2811/12 PacificLutheran* L13-6

2012 SCHEDULE

9/2 atHardin-Simmons 2p.m.9/14 EastTexasBaptist 7p.m.9/22 Pacific 1:30 p.m.9/29 atSewanee 1p.m.EDT10/6 atWhitworth* 1p.m.10/13 Lewis&Clark* 1:30p.m.10/20 atPacificLutheran*12:30p.m.10/27 atLinfield* 1:30p.m.11/3 at Pacific* 1 p.m.11/10 PugetSound* 4p.m.

LAST MEETINGOct. 8, 2011 at Salem, Ore.Pacific (Ore.) 0 0 7 0 7 Willamette 7 21 7 14 49

Scoring Summary1st 01:37 WU Scott Perlin 4 yd run (Kyle Derby kick)2nd 13:41 WU Jake Knecht 39 yd pass from Brian Widing (Kyle Derby kick) 04:14 WU Jamiere Abney 32 yd pass from Brian Widing (Kyle Derby kick), 01:28 WU Dylan Jones 22 yd run (Kyle Derby kick)3rd 06:35 WU Mason Brown 13 yd run (Kyle Derby kick) 00:14 PAC Taylor, Brian 4 yd pass from Minaya, P.J. (Villareal-Gomez kick)4th 03:38 WU Harmon, Joseph 2 yd run (Tommy Laird kick) 02:32 WU David Lowe 47 yd interception return (Pete Kline kick)


Game No. 3Sept. 22, 2012 • 1:30 p.m.McCullough Stadium, Salem

Game No. 8Nov. 3, 2012 • 1 p.m.Lincoln Park Stadium

WHITWORTH

Location:Spokane,Wash. Enrollment: 2,300Nickname:Pirates Colors:Crimson&BlackConference: Northwest(NCAADivisionIII)Stadium:PineBowl(2,220,uncovered,FieldTurf )President:Dr.BeckTaylor Athletic Director:AaronLeetchSports Information Director:SteveFlegelSID Phone:509-777-3239 SID Fax:509-777-3720SID E-Mail:[email protected] Website:www.whitworth.edu/athleticsFacebook:facebook.com/WhitworthPiratesTwitter:@gobucsHead Coach:JohnTully(AzusaPacific1975)Tully’s Record At Whitworth:89-74/17YearsTully’s Record Overall:120-95/22YearsAssistant Coaches:KirkWestre(DC/LB),JasonTobeck(WR),JerryMcCulligh(OL),IvanGustafson(TE),MatJohnson(RB),JoelClark(QB),AdamAnderson(GA),DavePomante(DL),JayTully(DB),AdamLindley(LB),BrandonMartin(GA).2011 Record:4-6 NWC Record:3-3(tie4th)Returning Letterwinners:37(20offense,17defense)Returning Starters:16(8offense,7defense,1specialists)All-Time Series: Whitworthleads18-2-1Last Meeting:Whitworthwon48-6atSpokane,Wash.,onOct.22,2011


9/3 atChapman L16-149/10 Pomona-Pitzer W34-79/17 Redlands L30-209/24 Menlo L24-1710/8 PacificLutheran* L20-1710/15 atLewis&Clatk* L30-2210/22 Pacific* W48-610/29 atWillamette* W25-24(2ot)11/5 Linfield* L42-3811/12 atPugetSound W40-34

2012 SCHEDULE

9/1 atst.Scholastica 1p.m.CDT9/8 atWhittier 1p.m.9/15 atLaVerne 6p.m.9/22 Chapman 1p.m.9/29 atPacific* 1p.m.10/6 Willamette* 1p.m.10/13 atLinfield* 1:30p.m.10/20 PugetSound* 1p.m.11/3 atPacificLutheran*12:30p.m.11/10 Lewis&Clark* 12:30p.m.

LAST MEETINGOct. 22, 2011 at Spokane, Wash.Pacific (Ore.) 3 0 3 0 6Whitworth 7 12 15 14 48 Scoring Summary1st 10:08 WHTW Thomas, Ronnie 2 yd run (Williams, C. kick) 06:01 PAC Moses Villareal-Gomez 38 yd field goal2nd 10:36 WHTW Thomas, Ronnie 13 yd run (Williams, C. kick failed) 00:22 WHTW DeGooyer, Jake 10 yd pass from Hill, Zac (Williams, C. kick failed)3rd 11:42 WHTW Thomas, Ronnie 46 yd run (Meyer, Wade pass from Ehlo, A.) 09:11 PAC Moses Villareal-Gomez 37 yd field goal 05:03 WHTW Scott, Sean 12 yd run (McNealley, Sean kick)4th 14:52 WHTW Meyer, Wade 51 yd pass from Hill, Zac (McNealley, Sean kick) 06:17 WHTW Scott, Sean 3 yd run (McNealley, Sean kick)


Game No. 4Sept. 29, 2012 • 1 p.m.Lincoln Park StadiumForest Grove

PACI

FIC

Foot

ball


PUGET SOUND

Location:Tacoma,Wash. Enrollment: 2,600Nickname:Loggers Colors:Maroon&WhiteConference: Northwest(NCAADivisionIII)Stadium:PeytonFieldatBakerStadium(4,000,covered,naturalgrass)President:Dr.RonaldThomasAthletic Director:AmyHackettSports Information Director:StevenOlvedaSID Phone:253-879-3874 SID Fax:253-879-3634SID E-Mail: [email protected] Website:www.loggerathletics.comFacebook:facebook.com/psloggersTwitter:@PSLoggersHead Coach:JeffThomas(Redlands2003)Thomas’ Record At Puget Sound:2-16/2YearsThomas’ Record Overall:2-16/1YearsAssistant Coaches:JeffHalstead(OC/WR),BrantMcAdams(DC/LB),ThomasFord(ST/S),BuckyBrenner(Inverts),IraJarmon(CB),JoshBellinger(DL),RickyDaley(RB),PatDonovan(OL),KavinWilliams(TE),MarkConrad(K).2011 Record:0-9 NWC Record:0-6(7th)All-Time Series: Pacificleads15-13-3Last Meeting:Pacificwon44-25atForestGroveonOct.29,2011


9/10 Occidental L30-129/17 Sewanee L34-239/24 atWhittier L66-4810/1 atPacificLutheran* L21-710/8 atLinfield* L73-710/15 Willamette* L49-3110/22 atLewis&Clark* L31-2810/29 at Pacific* L 44-2511/13 Whitworth* L40-34

2012 SCHEDULE

9/1 atSewanee 2p.m.EDT9/8 atChapman 7p.m.9/22 Whittier 1p.m.9/29 Lewis&Clark* 1p.m.10/6 Pacific* 1 p.m.10/20 atWhitworth* 1p.m.10/27 PacificLutheran* 1p.m.11/3 Linfield* 1p.m.11/10 atWillamette* 4p.m.

LAST MEETINGOct. 29, 2011 at Forest GrovePuget Sound 3 8 6 8 25 Pacific (Ore.) 7 14 14 9 44 Scoring Summary1st 04:59 UPS West,Everett 43 yd field goal 01:16 PAC Roher, Caleb 44 yd pass from Campbell, T.C. (Moses Villareal-Gomez kick)2nd 11:46 PAC Kershner, Bryce 3 yd run (Moses Villareal-Gomez kick) 08:28 UPS Kniffin,Adam 15 yd pass from Foley,Braden (Korn, James rush) 00:16 PAC Jordan Fukumoto 27 yd pass from Campbell, T.C. (Villareal-Gomez kick)3rd 09:52 PAC Roher 67 yd pass from Campbell, T.C. (Villareal-Gomez kick) 08:37 PAC Fukumoto 72 yd pass from Campbell, T.C. (Villareal-Gomez kick), 04:38 UPS Kniffin,Adam 3 yd pass from Foley,Braden (Foley,Braden pass intcpt)4th 14:40 PAC Taylor, Brian 17 yd pass from Campbell, T.C. (Villareal-Gomez kick) 09:57 UPS Zuhl,Ross 24 yd pass from Foley,Braden (Rogers,Ryan pass from Korn, James) 04:28 PAC Brinkworth safety


Game No. 5Oct. 6, 2012 • 1 p.m.Baker StadiumTacoma, Wash.

2012 Opponents

PACIFIC LUTHERAN

Location:Tacoma,Wash. Enrollment: 3,349Nickname:Lutes Colors:Gold&BlackConference: Northwest(NCAADivisionIII)Stadium:SparksStadium(4,500,covered,FieldTurf )President:Dr.LorenAnderson Athletic Director:LaurieTurnerSports Information Director:NickDawsonSID Phone:253-535-7356 SID Fax:253-535-7584SID E-Mail:[email protected] Website:www.golutes.comFacebook:None Twitter:@golutesHead Coach:ScottWestering(PacificLutheran1982)Westering’s Record At Pacific Lutheran:40-32/8YearsWesrering’s Record Overall:40-32/8YearsAssistant Coaches:JudKeim(SpecialTeams/RB),CraigMcCord(DC),TrevorRoberts(OC/OL),JimLindberg(Def.),DavidLaSalata(DL).2011 Record:6-3 NWC Record:4-2(tie2nd)All-Time Series: PacificLutheranleads26-8-3Last Meeting:PacificLutheranwon35-24atPuyallup,Wash.,onNov.5,2011


9/10 Hamline W27-09/17 atCalLutheran L28-1710/1 PugetSound* W21-710/8 atWhitworth* W20-1710/15 Menlo W14-610/22 atLinfield* L45-710/29 Lewis&Clark* L34-3211/5 Pacific* W 35-2411/12 atWillamette* W13-6

2012 SCHEDULE

9/8 CalLutheran 12:30p.m.9/15 atRedlands 7p.m.9/29 Linfield* 12:30p.m.10/6 atLewis&Clark* 1p.m.10/13 at Pacific* 1 p.m.10/20 Willamette* 12:30p.m.10/27 atPugetSound* 1p.m.11/3 Whitworth* 12:30p.m.11/10 atMenlo Noon

LAST MEETINGNov. 5, 2011 at Puyallup, Wash.Pacific (Ore.) 0 0 3 21 24Pacific Lutheran 14 14 7 0 35 Scoring Summary1st 13:05 PLU McDiarmid, Alex 41 yd pass from Halverson, Zack (Kaylor, Nick kick) 01:50 PLU Sontra, Lucas 19 yd pass from Halverson, Zack (Kaylor kick)2nd 12:57 PLU Sontra, Lucas 2 yd pass from Halverson, Zack (Kaylor kick) 01:29 PLU Bowen, Tyler 69 yd pass from Halverson, Zack (Kaylor kick)3rd 09:07 PLU Warner, Kyle 32 yd pass from Halverson, Zack (Kaylor kick) 05:12 PAC Moses Villareal-Gomez 28 yd field goal4th 07:19 PAC Nyberg, Matt 3 yd pass from Minaya, P.J. (Villareal-Gomez kick), 02:40 PAC Kershner, Bryce 2 yd pass from Minaya, P.J. (Villareal-Gomez kick) 00:40 PAC Taylor, Brian 7 yd pass from Minaya, P.J. (Villareal-Gomez kick)


Game No. 6Oct. 13, 2012 • 1 p.m.Lincoln Park StadiumForest Grove

GOBO

XERS

.COM


2012 Opponents

LINFIELD

Location:McMinnville,Ore. Enrollment: 2,142Nickname:Wildcats Colors:Purple&CardinalRedConference: Northwest(NCAADivisionIII)Stadium:MaxwellField(3,000,covered,FieldTurf )President:Dr.ThomasHellie Athletic Director:ScottCarnahanSports Information Director:KellyBirdSID Phone:503-883-2439 SID Fax:503-883-2453SID E-Mail:[email protected] Website:www.linfield.edu/sportsFacebook:facebook.com/linfieldsportsTwitter:@linfieldsportsHead Coach:JosephSmith(Linfield1993)Smith’s Record At Linfield:49-13/6YearsSmith’s Record Overall:49-13/6YearsAssistant Coaches:DougHire(Asst.HC/OL),JacksonVaughan(DC/DL),PhilRombach(LB),JimNagel(OC/QB),GregmcAnally(DL),BrandonHazenberg(CB/SpecialTeams),AdRutschman(KR),GabeHaberly,GaryRombach,AaronBoheme,KyleOtineru,AxelCederberg2011 Record:10-1 NWC Record:6-0(1st)Returning Letterwinners:43(21offense,19defense,3specialists)Returning Starters:14(8offense,5defense,1specialit)All-Time Series: Linfieldleads38-82-4Last Meeting:Linfieldwon49-6atForestGroveonOct.15,2011


9/10 CalLutheran W24-149/24 LaVerne W52-310/1 atWillamette* W20-1010/8 PugetSound* W73-710/15 at Pacific* W 49-610/22 PacificLutheran* W45-710/29 atMenlo W23-611/5 atWhitworth* W42-3811/12 Lewis&Clark* W47-1411/19 CalLutheran W30-2711/26 atWesley L49-34

2012 SCHEDULE

9/1 Menlo 12:30p.m.9/8 Hardin-Simmons 1:30p.m.9/15 atCalLutheran 12:30p.m.9/29 atPacificLutheran*12:30p.m.10/13 Whitworth* 1:30p.m.10/20 atLewis&Clark* 1p.m.10/27 Willamette* 1:30p.m.11/3 atPugetSound* 1p.m.11/10 Pacific* 1 p.m.

LAST MEETINGOct. 15, 2011 at Forest GroveLinfield 21 7 7 14 49 Pacific (Ore.) 3 3 0 0 6

Scoring Summary1st 08:37 LIN Jepson, Lucas 14 yd pass from Inns, Mickey (Kay, Josh kick) 02:46 PAC Moses Villareal-Gomez 37 yd field goal 02:32 LIN Forman, Colin 86 yd kickoff return (Kay, Josh kick) 00:48 LIN Fisher, Drew 4 yd blocked punt return (Kay, Josh kick)2nd 09:48 PAC Villareal-Gomez 22 yd field goal 06:40 LIN Saxon, Buddy 4 yd pass from Inns, Mickey (Kay, Josh kick)3rd 14:44 LIN Jepson, Lucas 65 yd pass from Inns, Mickey (Kay, Josh kick), 4th 12:08 LIN Yoder, Josh 4 yd run (Kay, Josh kick) 08:01 LIN Nelson, Colin 24 yd pass from Yarbrough, Matt (Kay, Josh kick)


Game No. 9Nov. 10, 2012 • 1 p.m.Maxwell FieldMcMinnville, Ore.

LEWIS & CLARK

Location:Portland,Ore. Enrollment: 2,031Nickname:Pioneers Colors:Orange&BlackConference: Northwest(NCAADivisionIII)Stadium:FredWilsonFieldatGriswoldStadium(3,069,covered,AstroTurf )President:BarryGlassnerAthletic Director:ClarkYeagerSports Information Director:KristianMartinSID Phone:503-768-7067 SID Fax:503-768-7058SID E-Mail:[email protected] Website:www.lcpioneers.comFacebook:facebook.com/lc.pioneersTwitter:@lcpioneersHead Coach:ChrisSulages(WeberState1995)Sulages’ Record At Lewis & Clark:14-39/7YearsSulages’ Record Overall:14-39/7YearsAssistant Coaches:TimJacobs(DC),PhilMagbanua(OC),RyanLockard(LB),ScottPierce(DB),DaleWidolff(ST/Def.Asst.),KevinTakeno(RB),JesseThompson(WR),RyanFlynn(OL),AaronMowrer(Off.Asst.)2011 Record:7-2 NWC Record:4-2(tie2nd)All-Time Series: Lewis&Clarkleads33-28-4Last Meeting:Lewis&Clarkwon61-35atForestGroveonOct.1,2011


9/10 Claremont-M-S W36-149/17 atPomona-Pitzer W48-399/24 atMacalester W37-2810/1 at Pacific* W 61-3510/15 Whitworth* W30-2210/22 PugetSound* W31-2810/29 atPacificLutheran* W34-3211/5 Willamette* L57-2811/12 atLinfield* L47-14

2012 SCHEDULE

9/8 atClaremont-M-S 7p.m.9/15 Pomona-Pitzer 1p.m.9/22 Macalester 1p.m.9/29 atPugetSound* 1p.m.10/6 PacificLutheran* 1p.m.10/13 atWillamette* 1:30p.m.10/20 Linfield* 1p.m.10/27 Pacific* 1:45 p.m.11/10 atWhitworth* 12:30p.m.

LAST MEETINGOct. 1, 2011 at Forest GroveLewis & Clark 19 14 14 14 61Pacific (Ore.) 9 14 0 12 35

Scoring Summary1st 12:11 L&C Welch,Keith 1 yd run (Monley,Simon kick blockd) 12:11 PAC Mills, Bryan PAT return 06:37 L&C Shirey,Curtis 5 yd run (Monley,Simon kick blockd) 04:44 PAC Fukumoto 10 yd pass from Campbell, T.C. (Villareal-Gomez kick), 02:11 L&C Welch,Keith 48 yd run (Monley,Simon kick)2nd 13:50 L&C Welch,Keith 4 yd run (Monley,Simon kick) 01:22 PAC Fukumoto 27 yd pass from Campbell, T.C. (Villareal-Gomez kick failed) 01:00 L&C Mayes,Joevonte 64 yd pass from Welch,Keith (Monley,Simon kick) 00:19 PAC Fukumoto 2 yd pass from Campbell, T.C. (Kawai, Kelson pass from Campbell, T.C.)3rd 09:16 L&C Frisina,Andrew 28 yd pass from Welch,Keith (Monley kick) 06:44 L&C Mayes,Joevonte 57 yd run (Monley,Simon kick)4th 10:10 L&C Shirey,Curtis 58 yd punt return (Monley,Simon kick) 07:00 PAC Kershner, Bryce 3 yd pass from Minaya, P.J. (Bettencourt rush failed) 04:03 L&C Taft,Bruce 6 yd pass from Dailey,Dustin (Monley,Simon kick) 02:10 PAC Bell, Adam 1 yd run (Minaya, P.J. pass intcpt)

Game No. 7Oct. 27, 2012 • 1:45 p.m.Griswold StadiumPortland, Ore.

PACI

FIC

Foot

ball


Opponent Composite Schedule

Date Simon Fraser Occidental Willamette Whitworth Puget SoundPacific

Lutheran Lewis & Clark Linfield

Sept. 1at PacificAug. 307 p.m.

Byeat Hardin-Simmons

6 p.m. (CDT)

at St. Scholastica

11 a.m.

at Sewanee1 p.m. (EDT)

Bye ByeMenlo

12:30 p.m.

Sept. 8Central

Washington2 p.m.

Pacific7 p.m.

East Texas Baptist7 p.m.

at Whittier1 p.m.

at Chapman7 p.m.

Cal Lutheran12:30 p.m.

at Claremont-Mudd-Scripps

7 p.m.

Hardin-Simmons1:30 p.m.

Sept. 15at Humboldt

State1 p.m.

at Menlo1 p.m.

Byeat La Verne

6 p.m.Open

at Redlands7 p.m.

Pomona-PitzerNoon

at Cal Lutheran

12:30 p.m.

Sept. 22at Western

Oregon1 p.m.

ByePacific1 p.m.

Chapman1 p.m.

Whittier1 p.m.

ByeMacalester

1 p.m.Bye

Sept. 29Dixie State

6 p.m.at Redlands

7 p.m.at Sewanee2 p.m. (EDT)

at Pacific1 p.m.

Lewis & Clark1 p.m.

Linfield12:30 p.m.

at Puget Sound1 p.m.

at Pacific Lutheran

12:30 p.m.

Oct. 6Azusa Pacific

2 p.m.

at Claremont-Mudd-Scripps

7 p.m.

at Whitworth1 p.m.

Willamette1 p.m.

Pacific1 p.m.

at Lewis & Clark1 p.m.

Pacific Lutheran

1 p.m.Bye

Oct. 13at Central

Washington1 p.m.

at Chapman7 p.m.

Lewis & Clark1:30 p.m.

at Linfield1:30 p.m.

Byeat Pacific

1 p.m.at Willamette

1:30 p.m.Whitworth1:30 p.m.

Oct. 20Western Oregon2 p.m.

at Cal Lutheran

1 p.m.

at Pacific Lutheran

12:30 p.m.

Puget Sound1 p.m.

at Whitworth1 p.m.

Willamette12:30 p.m.

Linfield1 p.m.

at Lewis & Clark1 p.m.

Oct. 27at Dixie State

1 p.m.Pomona-Pitzer

7 p.m.at Linfield1:30 p.m.

OpenPacific

Lutheran1 p.m.

at Puget Sound1 p.m.

Pacific1:45 p.m.

Willamette1:30 p.m.

Nov. 3Humboldt

State2 p.m.

Whittier7 p.m.

at Pacific1 p.m.

at Pacific Lutheran

12:30 p.m.

Linfield1 p.m.

Whitworth12:30 p.m.

Byeat Puget Sound1 p.m.

Nov. 10at Azusa Pacific6 p.m.

at La Verne1 p.m.

Puget Sound4 p.m.

Lewis & Clark12:30 p.m

at Willamette4 p.m.

at MenloNoon

at Whitworth12:30 p.m.

Pacific1 p.m.

2011 Season Review


PACI

FIC

Foot

ball


2011 Season Review

Pacific players and fans alike did not wait until the final horn to begin the celebration after the first win of the second chapter of the Pacific football program. The Boxers beat Puget Sound 44-25 on a perfect Homecoming afternoon on Oct. 29, 2011.

At long last, the Boxers get win No. 1Pacific’slongawaitedfirstwincameononeofthebestperformancessincetheprogramreturnedtothefieldin2010Saturday,thrillingahomecom-ingcrowdwitha44-25victoryoverPugetSoundinNorthwestConfer-encefootballactionatLincolnParkStadium.

TheBoxers(1-7,1-4NWC)rackedupanimpressive469yardsofto-taloffensebehindarecordafternoonbyquarterbackT.C.Campbell.Thesophomorecompleted21of27passesforanear-record387yardsandtiedhisownschoolrecordfromlastseasonwithfivetouchdownpasses.

Pacificalsoreceivedapairof100-yardplusreceivingeffortsfromJor-danFukumotoandCalebRoher.Roherhadthreecatchesfor123yardsandtwotouchdowns,whileFukumotohadfivecatchesfor115yardsandapairofscores.TheBoxers’defensealsodidtheirpart,forcingfourPugetSoundturnovers,includingthreeinterceptions.

HeadCoachKeithBuckleypraisedtheBoxers’effort,especiallyinlightofasubparperformancelastweekendatWhitworth.“Forthesekidstoreboundasfreshmenandsophomoresandcomeoutandputthistypeofefforttogetherandstaytogetherasoneteam,forthetoughweekswe’vethroughistremendous,”Buckleysaid“Weunderstandit’sonewin,butit’saspecialwinandit’sonethatthesekidswillbeabletorememberforalong,longtime.”

Thegameprovedtobeanairshowbetweentwoofthetoppassingoffensesinthenation.PacificoutgainedtheLoggersintotaloffense469-381.Pacifichad387yardspassing,whilePugetSoundnetted351yardsintheair.TheBoxersfinishedwithaseason-high82yardsrushingledbyan80-yardeffortfromDavisJacobs.

“It’sthemostamazingfeeling,”CampbellsaidofthemilestonedayfortheBoxers.“We’veworkedsohardtheselasttwoyearstocomeandearnthis.Towinathome,onhomecoming,infrontofourfansmeanssomuchtous.”

Wide receiver Jordan Fukumoto celebrates one of his two touchdowns that helped Pacific earn the win over Puget Sound.

GOBO

XERS

.COM


2011 Season ReviewPugetSound(0-8,0-5NWC)gotontheboardfirst,scoringona

43-yardfieldgoalbyEverettWestwith4:59togointhefirstquarter.TheBoxersdidnotneedmuchtimetoscoreontheirnextdrive,withCamp-bellconnectingona44-yardtouchdownpasstoRoherwith1:16leftintheperiodtotakethe7-3lead.

TheBoxersconvertedaPugetSoundfumbleintoatouchdowntoopenthesecondquarter,withBryceKershnerrunningfromthreeyardsoutfortheonlyrushingscoreoftheday.FoleyansweredrightbackfortheLoggersontheirnextdrive,findingAdamKniffinfora15-yardpass.Afteratwo-pointconversion,theLoggerswerewithin14-11with8:28leftinthehalf.

PacificwouldscorethenextthreetouchdownsonbigplaysastheoffensivelineseemedtogiveCampbellalldaytothrowtheball.Camp-bellcappedthefirsthalfbyfindingFukumotofora27-yardstrikethatallowedtheBoxersa21-11leadathalftime.

AftertheLoggersgavetheballupondownsdeepinPacificterritorytoopenthesecondhalf,CampbellhookedupwithRoherforhissecondtouchdownofthedayasthefreshmanstreakeddownthefieldtocom-pletea67-yardscoringpassatthe9:52mark.CraigBaileyinterceptedFoleyintheendzoneontheLoggers’nextdrive,andCampbellneededjustoneplaytofindFukumotofora72-yardbombthatgavetheBoxersacommanding35-11lead.

PugetSoundtheirfirstsecondhalftouchdownononeoftheirlongestdrivesofthegame,marching59yardson14playsbeforeFoleyfoundKniffinforashortthree-yardrouttomakeita35-17gamewith4:38togointhethird.Thedagger,though,cameontheBoxers’nextdrivewhenCampbellconnectedwithBrianTaylorfora17-yardscoringpassjust20secondsinthefourthquarter.

RossZuhladdedatoolittle,toolatetouchdownatthe10-minutemarkwhenhewasonthereceivingendofa24-yardpassfromFoleytotheendzone.TheBoxersaddedtwomorepointslatewithJoshBrink-worthsackingbackupquarterbackJamesKornforasafety.

Foleycompleted29of51passesforPugetSoundfor332yards,threetouchdownsandoneinterception.Korngaveuptwointerceptionswhilegoing1for6passing.ThiesenChangfinishedwith148yardson10carrieswhileKnifinfinishedwith63yardsandtwotouchdownsoneightcatches.

ChazBajet,TimHastieandBrinkwortheachhadeighttacklestoleadtheBoxers.BothBrinkworthandHastiehadasackandatackleforloss.BryanMillsandChrisSantiagoeachhadthefourthquarterinterceptions.CodyPedro-Sakumafinishedwith12tackles,asackandatackleforlosstoleadtheLoggers.

BOXER BYTES: ThewinisthefirstforaPacificfootballteamsinceNov.10,1990,whentheBoxersbeatOregonTech15-14inForestGrove.Theoriginalprogramwasdiscontinuedfollowingthe1991season.Thevictoryalsosnappeda25-gamelosingstreakfortheBoxersdatingbacktothestartofthe1991campaign(16ofthosecomingwiththenewpro-gram)…ThefivetouchdownpassesforCampbelltiedhisownmarksetlastyearinaNov.13,2010gameatMenlo.RalphNickersonalsosharesintherecord,throwingfivetouchdownpassesagainstCollegeofIdahobackin1973…FrankBuckiewicz,Sr.,a1952AssociatedPressLittleAll-AmericanforPacificandtheBoxers’headcoachfrom1965to1980,washonoredbeforethegameandparticipatedinthecointoss…Attendancewasannouncedat2,782,anearselloutcrowdforLincolnParkStadium.

Freshman receiver Caleb Roher outraced the Loggers to lead Pacific with 123 yards receiving and two touchdowns.

Cornerback Craig Bailey had four pass breakups and one of the Boxers’ three interceptions. His efforts in the game would earn him a spot on D3Football.com’s Team of the Week.

PACI

FIC

Foot

ball


2011 Season Review

FUKUMOTO EARNS FIRST TEAM ALL-NWC HONORS: Inhisfirsttwoseasons,JordanFukumotohasstoodoutasoneofthemostdynamicreceiversintheNorthwestConference.Hewassorecognizedbyleaguecoaches,becomingthefirstAll-NorthwestConferenceFirstTeamselectionfortheBoxerssince1984.FukumotoledatotalofsevenPacificselectionstotheAll-NorthwestConferenceTeam.

FukumotorankedasoneofthemostexcitingoffensiveplayersintheNWCtowatchandbackedhisplayupwithsolidstatistics. HerankedsecondintheNWCwith844receivingyardsandanaverageof93.8yardspergame. HiseightreceivingtouchdownsrankedthirdintheleagueandwerethemostforaPacificplayersince1988. Fukumotofinishedtheseasonranked33rdamongNCAADivisionIIIplayersinreceivingyardspergameandwastiedfor62ndwith5.56receptionspergame.Fukumotofinishedwithfourgameswithover100yardsreceiving,toppedby131yardsagainstClaremont-Mudd-Scripps. Thegameincludedan87-yardtouchdownreceptionthatranksasthesecondlongestinschoolhistory. FukumotopunchedinforthreetouchdownsagainstLewis&ClarkonOct.1andfinishedwith115yardsandtwoscoresintheBoxers’44-25winoverPugetSoundonOct.29.

“JordanprovedweekinandweekoutthatheshouldbeconsideredoneoftheelitereceiversintheNorthwestConference,”Buckleysaid. “Heisacompleteplayerthatworkstobetterhimselfasareceivereveryday,whichbodeswellforhiscontinuedgrowthandproductionoverthenextfewyears.”

Jordan Fukumoto

CAMPBELL GOES DEEP:WhilePacificstillbenefitedfromatwo-quarterbackcombination,T.C.Campbellearnedhiswayintothestartingroleinallninegamesthisseason.Healsocontinuedtothrowhiswayintotherecordbooks,earninghimselfanhonorablementiontotheAll-NWCFootballTeam.

Campbell’sgrowthwasevidentinhissecondyear,settingthestageforsomeoftheBoxers’topgamesoftheseason. CampbellrankedfourthintheNWCwith1,858yardspassingandwasrankedfifthwith130yards,219attemptsand13touchdowns. Hispassefficiencyratingof141.08rankedhim47thamongDivisionIIIquarterbacks.

Campbellpassedforover200yardsinfourgames. Hetiedhisownrecordwithfivetouchdownpassesandhadaseason-high387yardson21of27completionsinthewinoverPugetSoundonOct.29.Heopenedtheyearwitha373-yardeffortagainstSimonFraseronSept.3,whichincludedapairoftouchdownpasses.Hewasalsoonthethrowingendofan87-yardtouchdownpasstoJordanFukumotoagainstClaremont-Mudd-ScrippsonSept.17,whichisthesecondlongestpassplayinschoolhistory.

Ashedidinthe2010season,CampbellsplithistimewithfellowsophomoreP.J.Minaya.Makingappearancesineightgames,Minayafinishedwith671yards,a53.6completionpercentageandapassefficiencyratingof133.20.HisbrightestmomentcameintheseasonfinaleatPacificLutheranonNov.5,whenhecompleted23of34passesfor223yards,threwthreetouchdownsandnearlyledPacificbackfroma35-0halftimedeficittotheLutes.

T.C. Campbell

GOBO

XERS

.COM


2011 Season ReviewFIVE OTHERS EARN HONORABLE MENTION HONORS: InadditiontoCampbell,fiveotherPacificplayerslandedhonorablementionselectionstotheAll-NWCTeam.TightendBrianTaylor,kickerMosesVillareal-Gomez,defensivebackCraigBailey,safetyBryanMillsanddefensivelinemanDevinLagoriowereallselectedtotheteam.

Taylorfinishedtheseasonwith141yardson15receptionsandthreetouchdownswhilestartingallninegames. HehadatouchdownintheBoxers’winoverPugetSoundonOct.29andhadoneofthreetouchdownsinPacific’scomebackattemptagainstPacificLutheranonNov.5.

Afteraroughstarttotheseason,Villareal-Gomezfinishedtheseasonasaconsistentplacekicker. Hefinishedtheyearmaking6of10fieldgoalsandwas17of19inpoint-afterconversions. Villareal-Gomezwent2for2againstbothLinfieldonOct.15andWhitworthonOct.22,whichincludedaseason-long38-yardfieldgoalagainstthePirates. Hewent6for6onPATattemptsagainstPugetSound. HemadeanimpactinPacific’scomebackattemptagainstPacificLutheranonNov.5whenhewassuccessfulintwoofthreeonsidekickattemptsthatkepttheBoxersinthegame.

BaileystartedallninegamesfortheBoxersatcornerbackandwasakeypartoftheteam’spassdefense. Hefinishedwith18tackles,including13solotackles,andledtheconferencewith11passbreakups. Bailey’sseasonwashighlightedbyaninterceptionintheendzoneagainstPugetSoundonOct.29,whichleddirectlytoaPacificscorethatopenedthethirdquarterofthegame,aneffortwhichearnedhimselectiontotheD3Football.comTeamoftheWeek.

MillsledPacificandrankedeighthintheNWCwith62tackles. Healsorankedsixthintheleaguewith6.9tacklespergameand35solotackles. MillscameupwithaPacificseason-high12tacklesagainstWhitworthonOct.22,hadninetacklesatClaremont-Mudd-ScrippsonSept.17andseventacklesandaninterceptionagainstPugetSoundonOct.29. MillsearnedthenationalspotlightagainstLewis&ClarkonOct.1whenhereturnedablockedpoint-afterattempt100yardsforararedefensivetwo-pointconversion. TheplaywasselectedbyESPN’sSportsCenterasit’sTopPlayoftheDay.

LagorioalsoplayedakeyroleinPacific’sdefensiveeffort,comingupwith27tacklesand3.5tacklesforlossasadefensivelineman. HenotchedseasonhighsoffivetacklesagainstLewis&ClarkonOct.1andWhitworthonOct.22. HehadtheblockedkickagainstthePioneersthatledtoMills’nowfamous100-yardtwo-pointconversiononOct.1.

SMALL STEPS TOWARDS THE GOAL: Intheirsecondyearbackonthegridironaftera19-yearabsence,thePacificfootballprogramcontinuedtomakestepstowardtheirgoaltobeacompetitiveteamamongtheirNorthwestConferencebrethren.

Fromthestartoftheyear,itwasobviousthattheBoxershadcomealongwayfromthestartoftheinaugural2010campaign.Openingtheseasonwithtwohomegames,theBoxersputthemselvesinapositiontowinearly.PacificheldhalftimeleadsoverbothSimonFraserandMenlo,butbothgamesendedwithdominantsecondhalfperformancesbythevisitingteam.TheBoxersfelltotheClan36-28andtheOaks23-16,butbothgamesgavePacificaglimpseofwhatcouldbefortheprogram.

TheNorthwestConferencegotofftoaroughstartastheBoxerspairedupwiththeleague’stopthreeteamsinthefirstthreegames.Pacifictooka61-35losstoLewis&Clark,a47-9roadlosstoWillametteandacompetitive49-6defeattoLinfield.TheBoxersexpectedtohaveachancetomakearunatWhitworthontheroadonOct.22,butthePiratesforcedthreeinterceptionsandlimitedtheBoxersto193yardsofoffenseina48-6loss.

Pacific’sfortunesfinallychangedinfrontofanelectrifiedhomecomingcrowdonOct.29asthetablewassetforavictory.TheBoxershelda21-11leadathalftime,buttookoffinthesecondwiththreetouchdowns,threeinterceptionsandasafetytosecuretheirfirstwinoftheseason,beatingtheLoggers44-25.

IntheseasonfinaleonNov.5,theBoxersfoundthemselvesdown35-0toPacificLutheranwithnineminutesleftinthethirdquarter.Pacificdidnotletup,though,scoringthefinal24pointsofthegame.P.J.Minaya,whoplayedtheentiresecondhalf,threwforallthreetouchdownsandMosesVillareal-GomezsuccessfullyconvertedtwoofthreeonsidekickstomaximizetheBoxers’possessiontimelate.Pacificlostthegame35-24.

Bryan Mills

Craig Bailey

Moses Villareal-Gomez

PACI

FIC

Foot

ball


2011 Season ReviewAS SEEN ON SPORTSCENTER:WhilePacificlost61-35toLewis&ClarkonOct.1,thegamewillbeforeverrememberedforanunusualplaythatputtheBoxersinthenationalspotlight.

AfterLewis&Clark’sscoredthefirsttouchdownofthegamefourminutesintothefirstquarter,defensivelinemanDevinLagoriomanagedtoblockthePioneers’pointafterattempt.TheballfellintothehandsofaLewis&Clarkdefender,wholobbedtheballbacktowardsanofficialthinkingthattheplaywasdead.

BryanMills,however,knewitwasn’t.Thesafetypickeduptheballatthegoallineandbolteddownfield,huggingthePacificsidelineanddodgingtourtackleattemptstoendupintheoppositeendzoneandscoreararetwo-pointdefensiveconversion.

TheunusualplaywaschosenbyESPN’sSportsCenterastheshow’sTopPlayoftheDay.TheclipwasalsofeaturedbyallfourPortlandareatelevisionstations,CBSCollegeSports,FOXSports,ESPNSportsNationandtheHuffingtonPost.TheclippostedonthePacificAthleticsYouTubesitepickedupover238,000hitsoverthecourseofthenexttwoweeks.

POTENT PASSING OFFENSE: PacificfinishedtheirsecondseasonasoneofthetoppassingteamsinallofNCAADivisionIIIfootball.TheBoxersfinishedthirdintheNorthwestConferenceand23rdamongDivisionIIIteamswithanaverageof282.3passingyardspergame.Pacific’sfourquarterbackscombinedforapassefficiencyratingof134.63,thirdbestintheNWCand65thamongallDivisionIIIprograms.Individually,T.CCampbellfinishedranked41stamongallDivisionIIIquarterbackswitha141.08passefficiency.HefinishedthirdintheNWCbehindLinfield’sMickeyInnsandLewis&Clark’sKeithWelch.

IN THE NWC STATISTICS: Pacificfinishedtheseasonrankedsixthintotalyardage,averaging332.7yardspergameandfinishedseventhwith19.4pointspergame.TheBoxersrankedsecondinfourthdownconversions,going8for22.

ATTENDANCE CLIMBS: FanscontinuetokeeptheirsupportupforPacificfootball.TheBoxerssawanaverageof2,106fanspergamefortheirfivehomecontests,upfromanaverageof1,963in2010forfourhomegames.PacificfinishedfourthinattendanceamongNorthwestConferenceteams.PugetSoundhadtheleague’sbestattendance(2,628pergameforfourgames),whilePacificLutheranfinishedjustaheadoftheBoxerswithanaverageof2,170pergameforfivecontests.Whenjudgedagainsttotalcapacity,PacificrankedfirstintheNWCand25thamongallNCAADivisionIIIteams.LincolnParkStadiumholds2,800forfootballgames.

2011 By The NumbersSEASON SUMMARYOverall Record: 1-8NWC Record/Finish: 1-5 (6th)Home Record: 1-4 Away Record: 0-4

SEASON HONORSAll-Northwest ConferenceFirst Team Jordan Fukumoto (WR)Honorable Mention Craig Bailey (DB) T.C. Campbell (QB) Bryan Mills (DB) Brian Taylor (TE) Devin Lagorio (DL) Moses Villareal-Gomez (PK)

NWC Offensive Student-Athlete of the WeekT.C. Campbell Sept. 6 & Oct. 30

D3Football.com Team of the Week Craig Bailey Oct. 31

RECORDS TIED/BROKEN IN 2011INDIVIDUAL RECORDSTouchdown Passes, Game5, T.C. Campbell vs. Puget Sound, Oct. 29 (tied with Campbell vs. Menlo, 2010, and Ralph Nickerson vs. College of Idaho, 1972).

Fewest Passes Intercepted, Season2, P.J. Minaya (previous 6, John Brunelle, 1982)

Pass Completion Percentage, Season (Minimum 100 Attempts)59.4, T.C. Campbell (previous 58.8, Frank Buckiewicz, Jr., 1976).

TEAM RECORDSPass Completions, Game32 vs. Pacific Lutheran, Nov. 5 (tied with 32 vs. Linfield, 1976)

Brian Taylor

Devin Lagorio

Landon Aano

GOBO

XERS

.COM


2011 StatisticsTeam StatisticsSCORE BY QUARTERS 1st 2nd 3rd 4th TotalPacific (Ore.) 36 50 40 49 175Opponents 88 90 79 97 354

PACIFIC OPPONENTSSCORING 175 354PointsPerGame 19.4 39.3FIRST DOWNS 160 175Rushing 41 86Passing 100 77Penalty 19 12RUSHING YARDAGE 453 1685Yardsgainedrushing 849 1915Yardslostrushing 396 230RushingAttempts 283 334AveragePerRush 1.6 5.0AveragePerGame 50.3 187.2TDsRushing 4 23PASSING YARDAGE 2541 2027Comp-Att-Int 196-329-13 136-241-5AveragePerPass 7.7 8.4AveragePerCatch 13.0 14.9AveragePerGame 282.3 225.2TDsPassing 18 21TOTAL OFFENSE 2994 3712TotalPlays 612 575AveragePerPlay 4.9 6.5AveragePerGame 332.7 412.4KICK RETURNS:#-Yards 52-974 35-703PUNT RETURNS:#-Yards 10-42 22-245INT RETURNS:#-Yards 5-83 13-240KICK RETURN AVERAGE 18.7 20.1PUNT RETURN AVERAGE 4.2 11.1INT RETURN AVERAGE 16.6 18.5FUMBLES-LOST 11-4 18-9PENALTIES-Yards 57-509 75-717AveragePerGame 56.6 79.7PUNTS-Yards 52-1649 34-1116AveragePerPunt 31.7 32.8Netpuntaverage 26.2 31.0KICKOFFS-Yards 32-1730 61-3448AveragePerKick 54.1 56.5Netkickaverage 46.4 38.9TIME OF POSSESSION/Game 33:11 26:483RD-DOWNConversions 41/137 48/1113rd-DownPct 30% 43%4TH-DOWNConversions 8/22 4/144th-DownPct 36% 29%SACKS BY-Yards 14-75 27-182MISC YARDS -4 0TOUCHDOWNS SCORED 22 50FIELD GOALS-ATTEMPTS 6-10 2-5ON-SIDE KICKS 3-6 0-2RED-ZONE SCORES (20-27)74% (27-35)77%RED-ZONE TOUCHDOWNS (14-27)52% (26-35)74%PAT-ATTEMPTS (17-19)89% (40-46)87%ATTENDANCE 10528 5227Games/AvgPerGame 5/2106 4/1307NeutralSiteGames 0/0

Schedule & ResultsRECORD OVERALL HOME AWAY NEUTRALALL GAMES 1-8-0 1-4-0 0-4-0 0-0-0CONFERENCE 1-5-0 1-2-0 0-3-0 0-0-0NON-CONFERENCE 0-3-0 0-2-0 0-1-0 0-0-0

DATE OPPONENT W/L SCORE ATTEND 9/3/11 SIMON FRASER L 36-28 1,725 9/10/11 MENLO L 23-16 2,1159/17/11 atClaremont-M-S L 28-9 932*10/1/11 LEWIS & CLARK L 61-35 2,149*10/8/11 atWillamette L 49-7 1,250*10/15/11 #5 LINFIELD L 49-6 1,757*10/22/11 atWhitworth L 48-6 1,545*10/29/11 PUGET SOUND W 44-25 2.782*11/5/11 atPacificLutheran L 35-24 1,500

*-NorthwestConferencegamesNationalrankingshownattimeofcontest

Individual StatisticsRUSHING GP Att Gain Loss Net Avg TD Long Avg/GJacobs,Davis 9 102 331 73 258 2.5 0 19 28.7Schultze,Gunther 9 54 156 32 124 2.3 1 18 13.8Kershner,Bryce 9 17 57 4 53 3.1 2 9 5.9Valente,Sean 4 10 45 4 41 4.1 0 17 10.2Minaya,P.J. 8 25 112 85 27 1.1 0 25 3.4Hairabedian,Trey 4 5 21 2 19 3.8 0 13 4.8Inagaki,Jarrin 2 5 17 3 14 2.8 0 10 7.0Rietmann,Tanner 1 1 7 0 7 7.0 0 7 7.0McKinney,Deven 5 1 7 0 7 7.0 0 7 1.4Ladiges,Bobby 2 3 8 3 5 1.7 0 8 2.5Paradis,Dustin 1 1 5 0 5 5.0 0 5 5.0Fukumoto,Jordan 9 2 9 7 2 1.0 0 9 0.2Roher,Caleb 8 3 2 1 1 0.3 0 1 0.1Easley,Alex 1 1 1 0 1 1.0 0 1 1.0Mills,Bryan 9 1 0 0 0 0.0 0 0 0.0Larson,Michael 2 1 0 0 0 0.0 0 0 0.0Bell,Adam 4 4 3 4 -1 -0.2 1 2 -0.2Huff,Torin 2 2 3 4 -1 -0.5 0 3 -0.5Danchev,Petr 6 1 0 1 -1 -1.0 0 0 -0.2Yip,Cameron 8 1 0 8 -8 -8.0 0 0 -1.0TEAM 7 5 0 24 -24 -4.8 0 0 -3.4Campbell,T.C. 9 38 65 141 -76 -2.0 0 20 -8.4Total 9 283 849 396 453 1.6 4 25 50.3Opponents 9 334 1915 230 1685 5.0 23 72 187.2

PASSING G Effic Cmp-Att-Int Pct Yds TD Lng Avg/GCampbell,T.C. 9 141.08 130-219-10 59.4 1858 13 87 206.4Minaya,P.J. 8 133.20 63-99-2 63.6 671 5 53 83.9Huff,Torin 2 50.10 3-8-0 37.5 12 0 14 6.0TEAM 7 0.00 0-2-0 0.0 0 0 0 0.0Siddle-Mitchell 4 -200.00 0-1-1 0.0 0 0 0 0.0Total 9 134.60 196-329-13 59.6 2541 18 87 282.3Opponents 9 151.69 136-241-5 56.4 2027 21 69 225.2

PACI

FIC

Foot

ball


Individual StatisticsRECEIVING G No. Yds Avg TD Long Avg/GFukumoto,Jordan 9 50 844 16.9 8 87 93.8Nyberg,Matt 9 23 202 8.8 2 28 22.4Anthony,Blake 9 20 275 13.8 0 44 30.6Kawai,Kelson 6 17 299 17.6 1 70 49.8Taylor,Brian 9 15 141 9.4 3 24 15.7Pumphrey,Cameron 8 13 155 11.9 0 27 19.4Schultze,Gunther 9 12 138 11.5 0 45 15.3Roher,Caleb 8 9 188 20.9 2 67 23.5Yip,Cameron 8 8 94 11.8 0 43 11.8Jacobs,Davis 9 7 43 6.1 0 16 4.8Lawrence,Jakob 7 4 50 12.5 0 16 7.1Kershner,Bryce 9 4 22 5.5 2 11 2.4Kronen,Jordan 5 3 16 5.3 0 9 3.2Graves,Jordan 4 3 10 3.3 0 10 2.5Selvey,Brandon 9 2 43 21.5 0 39 4.8Ladiges,Bobby 2 1 10 10.0 0 10 5.0Mills,Bryan 9 1 8 8.0 0 8 0.9Hairabedian,Trey 4 1 7 7.0 0 7 1.8Merriam,Kyle 3 1 4 4.0 0 4 1.3Bell,Adam 4 1 -3 -3.0 0 0 -0.8Iosefa,Ruben 4 1 -5 -5.0 0 0 -1.2Total 9 196 2541 13.0 18 87 282.3Opponents 9 136 2027 14.9 21 69 225.2

FIELD GOALS FGM-FGA Pct 01-19 20-29 30-39 40-49 50-99 Lg BlkVillareal-Gomez 6-10 60.0 0-0 3-3 3-4 0-3 0-0 38 2

FG SEQUENCE Pacific (Ore.) OPPONENTSSimonFraser 42,40 (27)Menlo - 31Claremont-M-S (20) -Lewis&Clark 40,37 -Willamette - 38Linfield (37),(22) -Whitworth (38),(37) -PugetSound - (43),44PacificLutheran (28) -

Numbersin(parentheses)indicatefieldgoalwasmade.

PUNTING No. Yds Avg Long TB FC I-20 BlkdKoford,Aaron 48 1599 33.3 52 2 9 13 3TEAM 3 0 0.0 0 0 0 0 0Roher,Caleb 1 50 50.0 50 0 0 1 0Total 52 1649 31.7 52 2 9 14 3Opponents 34 1116 32.8 60 1 10 13 0

KICKOFFS No. Yds Avg TB OB Retn Net YdLnKoford,Aaron 32 1730 54.1 0 0 Total 32 1730 54.1 0 0 703 32.1 37Opponents 61 3448 56.5 5 3 974 38.9 31

|---------------- PATs ----------------|SCORING TD FGs Kick Rush Rcv Pass DXP Saf PtsFukumoto,Jordan 8 0-0 0-0 0-0 0 0-0 0 0 48Villareal-Gomez 0 6-10 17-19 0-0 0 0-0 0 0 35Kershner,Bryce 4 0-0 0-0 0-0 0 0-0 0 0 24Taylor,Brian 3 0-0 0-0 0-0 0 0-0 0 0 18Roher,Caleb 2 0-0 0-0 0-0 0 0-0 0 0 12Nyberg,Matt 2 0-0 0-0 0-0 0 0-0 0 0 12Kawai,Kelson 1 0-0 0-0 0-0 1 0-0 0 0 8Bell,Adam 1 0-0 0-0 0-0 0 0-0 0 0 6Schultze,Gunther 1 0-0 0-0 0-0 0 0-0 0 0 6Brinkworth,Josh 0 0-0 0-0 0-0 0 0-0 0 1 2TEAM 0 0-0 0-0 0-0 0 0-0 0 1 2Mills,Bryan 0 0-0 0-0 0-0 0 0-0 1 0 2Minaya,P.J. 0 0-0 0-0 0-0 0 0-1 0 0 0Campbell,T.C. 0 0-0 0-0 0-0 0 1-1 0 0 0Bettencourt,Sam 0 0-0 0-0 0-1 0 0-0 0 0 0Total 22 6-10 17-19 0-1 1 1-2 1 2 175Opponents 50 2-5 40-46 1-1 2 2-3 0 1 354

INTERCEPTIONS No. Yds Avg TD LongMills,Bryan 1 40 40.0 0 40Bettencourt 1 0 0.0 0 0Hastie,Tim 1 3 3.0 0 3Santiago,Chris 1 12 12.0 0 12Bailey,Craig 1 28 28.0 0 28Total 5 83 16.6 0 40Opponents 13 240 18.5 3 54

PUNT RETURNS No. Yds Avg TD LongHarms,Brandon 10 42 4.2 0 22Total 10 42 4.2 0 22Opponents 22 245 11.1 2 58

KICK RETURNS No. Yds Avg TD LongRoher,Caleb 20 363 18.1 0 27Kawai,Kelson 12 226 18.8 0 36McKinney,Deven 9 179 19.9 0 41Harms,Brandon 2 41 20.5 0 22Graves,Jordan 2 3 1.5 0 11Valente,Sean 2 42 21.0 0 26Schultze,Gunther 2 81 40.5 0 60Donaghy,Dominique 1 13 13.0 0 13May,J.T. 1 11 11.0 0 11Fukumoto,Jordan 1 15 15.0 0 15Total 52 974 18.7 0 60Opponents 35 703 20.1 1 86

2011 Statistics

GOBO

XERS

.COM


2011 StatisticsIndividual StatisticsALL PURPOSE G Rush Rec PR KOR IR Tot Avg/GFukumoto,Jordan 9 2 844 0 15 0 861 95.7Roher,Caleb 8 1 188 0 363 0 552 69.0Kawai,Kelson 6 0 299 0 226 0 525 87.5Schultze,Gunther 9 124 138 0 81 0 343 38.1Jacobs,Davis 9 258 43 0 0 0 301 33.4Anthony,Blake 9 0 275 0 0 0 275 30.6Nyberg,Matt 9 0 202 0 0 0 202 22.4McKinney,Deven 5 7 0 0 179 0 186 37.2Pumphrey,Cameron 8 0 155 0 0 0 155 19.4Taylor,Brian 9 0 141 0 0 0 141 15.7Yip,Cameron 8 -8 94 0 0 0 86 10.8Harms,Brandon 9 0 0 42 41 0 83 9.2Valente,Sean 4 41 0 0 42 0 83 20.8Kershner,Bryce 9 53 22 0 0 0 75 8.3Lawrence,Jakob 7 0 50 0 0 0 50 7.1Mills,Bryan 9 0 8 0 0 40 48 5.3Selvey,Brandon 9 0 43 0 0 0 43 4.8Bailey,Craig 9 0 0 0 0 28 28 3.1Minaya,P.J. 8 27 0 0 0 0 27 3.4Hairabedian,Trey 4 19 7 0 0 0 26 6.5Kronen,Jordan 5 0 16 0 0 0 16 3.2Ladiges,Bobby 2 5 10 0 0 0 15 7.5Inagaki,Jarrin 2 14 0 0 0 0 14 7.0Graves,Jordan 4 0 10 0 3 0 13 3.2Donaghy,Dominique 1 0 0 0 13 0 13 13.0Santiago,Chris 9 0 0 0 0 12 12 1.3May,J.T. 7 0 0 0 11 0 11 1.6Rietmann,Tanner 1 7 0 0 0 0 7 7.0Paradis,Dustin 1 5 0 0 0 0 5 5.0Merriam,Kyle 3 0 4 0 0 0 4 1.3Hastie,Tim 9 0 0 0 0 3 3 0.3Easley,Alex 1 1 0 0 0 0 1 1.0Danchev,Petr 6 -1 0 0 0 0 -1 -0.2Huff,Torin 2 -1 0 0 0 0 -1 -0.5Bell,Adam 4 -1 -3 0 0 0 -4 -1.0Iosefa,Ruben 4 0 -5 0 0 0 -5 -1.2TEAM 7 -24 0 0 0 0 -24 -3.4Campbell,T.C. 9 -76 0 0 0 0 -76 -8.4Total 9 453 2541 42 974 83 4093 454.8Opponents 9 1685 2027 245 703 240 4900 544.4

TOTAL OFFENSE G Plays Rush Pass Total Avg/GCampbell,T.C. 9 257 -76 1858 1782 198.0Minaya,P.J. 8 124 27 671 698 87.2Jacobs,Davis 9 102 258 0 258 28.7Schultze 9 54 124 0 124 13.8Kershner,Bryce 9 17 53 0 53 5.9Valente,Sean 4 10 41 0 41 10.2Hairabedian 4 5 19 0 19 4.8Inagaki,Jarrin 2 5 14 0 14 7.0Huff,Torin 2 10 -1 12 11 5.5McKinney,Deven 5 1 7 0 7 1.4Rietmann 1 1 7 0 7 7.0Paradis,Dustin 1 1 5 0 5 5.0Ladiges,Bobby 2 3 5 0 5 2.5Fukumoto 9 2 2 0 2 0.2Roher,Caleb 8 3 1 0 1 0.1Easley,Alex 1 1 1 0 1 1.0Bell,Adam 4 4 -1 0 -1 -0.2Danchev,Petr 6 1 -1 0 -1 -0.2Yip,Cameron 8 1 -8 0 -8 -1.0TEAM 7 7 -24 0 -24 -3.4Total.......... 9 612 453 2541 2994 332.7Opponents...... 9 575 1685 2027 3712 412.4

PACI

FIC

Foot

ball


2011 StatisticsDefensive Statistics |------------------------Tackles------------------------| SACKS |----------------Pass Def---------------| |-------Fumbles------| Blkd GP-GS Solo Ast Total TFL/Yds No-Yards Int-Yds BrUp QBH Rcv-Yds FF Kick Saf36 Mills,Bryan 9 35 27 62 4.0-6 . 1-40 2 . . 2 . .47 Hastie,Tim 9 27 29 56 6.5-19 1.0-2 1-3 1 . . . 1 .3 Brinkworth 9 26 16 42 3.0-6 1.0-1 . 4 . 1-0 2 . 12 Bajet,Chaz 9 27 7 34 1.0-9 1.0-9 . 3 . . . . .24 Morita,Kamu 8 17 14 31 . . . 2 . . . . .13 Santiago,Chris 9 18 12 30 2.5-12 1.0-5 1-12 1 . 1-0 1 . .52 Lagorio,Devin 9 16 11 27 3.5-9 1.0-6 . 1 . . . 1 .5 Feuerbach 9 16 8 24 2.0-2 . . 1 . . 1 . .49 Aano,Landon 9 11 12 23 6.5-23 3.0-17 . . 1 1-0 1 1 .15 Bailey,Craig 9 13 5 18 . . 1-28 11 . . . . .42 Abiva,Branden 9 5 11 16 4.0-14 1.5-10 . . . . . . .9 Moody,Marc 7 9 7 16 1.5-8 0.5-7 . . 1 . . . .32 Harms,Brandon 9 12 3 15 . . . 1 . . . . .75 C.Johnson 9 8 7 15 2.0-4 0.5-0 . . . . . . .91 Carrillo,Eddie 9 5 8 13 2.5-7 1.5-6 . . . . . . .54 Bangs,Sean 9 6 7 13 1.0-8 1.0-8 . . . 1-0 . . .4 Aiona,Ku 9 9 3 12 . . . . . 1-0 . . .34 Rogers,Chase 8 7 4 11 . . . . . . . . .43 Schmidt,Austin 9 2 8 10 0.5-0 . . . . . . . .51 Dassonville 6 5 4 9 3.0-5 . . . . . . . .8H Hand,Brandon 4 5 4 9 1.5-10 0.5-5 . . . . . . .59 Maningo,Noah 8 3 4 7 0.5-0 0.5-0 . . . . . . .94 Wistock,Caleb 8 2 5 7 0.5-2 . . . . . . . .20 Bettencourt 3 5 1 6 . . 1-0 . . . . . .35 Flory,Gabe 3 2 4 6 0.5-1 . . . . . . . .80 Selvey,Brandon 9 3 3 6 . . . . . . . . .2G DeGuzman 4 5 1 6 1.0-1 . . . . . . . .90 Dennis,Kalen 2 3 3 6 1.0-1 . . . . . . . .76 Smith,Mike 3 . 5 5 . . . . . . . 1 .30 Harris,Andy 5 2 2 4 . . . . . . . . .92 Treadway,Kyle 4 1 2 3 . . . . . . . . .50 Reynolds,Nick 7 . 3 3 . . . . . . . . .2Q Minaya,P.J. 8 3 . 3 1.0-1 . . 1 . . . . .TM TEAM 7 3 . 3 2.0-4 . . . . 1-0 . . 129 Fukumoto 9 3 . 3 . . . . . . . . .26 Schultze 9 1 1 2 . . . . . . . . .3K Meguro,Kelly 3 2 . 2 . . . . . . . . .56 George,Travis 7 . 2 2 . . . . . . . . .2R Ramirez,Gabe 3 2 . 2 1.0-33 . . . . . . . .33 Kershner,Bryce 9 1 1 2 . . . . . . . . .10 Campbell,T.C. 9 2 . 2 . . . . . . . . .31 Yip,Cameron 8 1 1 2 . . . . . . . . .44 Weimar,Landon 4 1 1 2 . . . . . . . . .40 Brown,Austin 4 1 1 2 . . . . . . . . .89 Anthony,Blake 9 1 1 2 . . . . . . . . .8F Fa’agau,Justin 3 1 . 1 . . . . . . . . .46 Eakin,Tate 4 . 1 1 . . . . . . . . .6 Jacobs,Davis 9 . 1 1 . . . . . . . . .25 Alvarez,Austin 4 1 . 1 . . . . . . . . .8 May,J.T. 7 . 1 1 0.5-1 . . . . . . . .48 Cooper,Scotty 8 . 1 1 . . . . . . . . .8H Williams,Kyle 1 . 1 1 . . . . . . . . .96 Murdock,Connor 2 1 . 1 . . . . . . . . .88 Pumphrey 8 . 1 1 . . . . . . . . .70 Dalton,Sean 9 . 1 1 . . . . . . . . .65 Novero,Nikk 9 1 . 1 . . . . . . . . .3C Chun,Daniel 2 1 . 1 . . . . . . . . .28 Kawai,Kelson 6 . 1 1 . . . . . . . . .53 Willits,Zach 5 . 1 1 . . . . . . . . .83 Koford,Aaron 9 1 . 1 . . . . . . . . .37 Danchev,Petr 6 1 . 1 . . . . . . . . .83 Morris,Robert 2 1 . 1 . . . . . . . . .60 Wilson,Spencer 2 1 . 1 1.0-5 . . . . . . . .18 Taylor,Brian 9 . 1 1 . . . . . . . . . Total 9 335 258 593 54-191 14-75 5-83 28 2 6-0 7 4 2 Opponents 9 342 312 654 95.0-406 27-182 13-240 33 1 4-0 7 5 1

GOBO

XERS

.COM


2010 StatisticsIndvidual Game HighsRushes 24 Jacobs,DavisvsSimonFraser(9/3/2011)Yards Rushing 80 Jacobs,DavisvsPugetSound(10/29/11)TD Rushes 1 Schultze,GunthervsSimonFraser(9/3/11) Kershner,BrycevsSimonFraser(9/3/11) Bell,AdamvsLewis&Clark(10/1/11) Kershner,BrycevsPugetSound(10/29/11)Long Rush 25 Minaya,P.J.vsLinfield(10/15/11)Pass Attempts 38 Campbell,T.C.vsSimonFraser(9/3/11)Pass Completions 23 Campbell,T.C.vsSimonFraser(9/3/11) Minaya,P.J.atPacificLutheran(11/5/11)Yards Passing 387 Campbell,T.C.vsPugetSound(10/29/11)TD Passes 5 Campbell,T.C.vsPugetSound(10/29/11)Long Pass 87 Campbell,T.C.atClaremont-M-S(9/17/11)Receptions 8 Fukumoto,JordanatPacificLutheran(11/5/11)Yards Receiving 131 Fukumoto,JordanatClaremont-M-S(9/17/11)TD Receptions 3 Fukumoto,JordanvsLewis&Clark(10/1/11)Long Reception 87 Fukumoto,JordanatClaremont-M-S(9/17/11)Field Goals 2 Villareal-Gomez,MosesvsLinfield(10/15/11) Villareal-Gomez,MosesatWhitworth(10/22/11)Long Field Goal 38 Villareal-Gomez,MosesatWhitworth(10/22/11)Punts 7 Koford,AaronvsMenlo(9/10/11) Koford,AaronatClaremont-M-S(9/17/11)Punting Avg 50.0 Roher,CalebvsLinfield(10/15/11)Long Punt 52 Koford,AaronvsMenlo(9/10/11) Koford,AaronatPacificLutheran(11/5/11)Punts inside 20 5 Koford,AaronvsMenlo(9/10/11)Long Punt Return 22 Harms,BrandonvsSimonFraser(9/3/11)Long Kickoff Return 60 Schultze,GunthervsLewis&Clark(10/1/11)Tackles 12 Mills,BryanatWhitworth(10/22/11)Sacks 1.0 10TimesTackles For Loss 2.5 Hastie,TimvsMenlo(9/10/11)Interceptions 1 Hastie,TimvsSimonFraser(9/3/2011) Bettencourt,SamvsMenlo(9/10/11) Santiago,ChrisvsPugetSound(10/29/11) Bailey,CraigvsPugetSound(10/29/11) Mills,BryanvsPugetSound(10/29/11)

Team Game HighsRushes 42 vsSimonFraser(9/3/11) vsPugetSound(10/29/11)Yards Rushing 124 vsLewis&Clark(10/1/11)Yards Per Rush 4.1 vsLewis&Clark(10/1/11)TD Rushes 2 vsSimonFraser(9/3/11)Pass Attempts 53 atPacificLutheran(11/5/11)Pass Completions 32 atPacificLutheran(11/5/11)Yards Passing 387 vsPugetSound(10/29/11)Yards Per Pass 13.8 vsPugetSound(10/29/11)TD Passes 5 vsPugetSound(10/29/11)Total Plays 80 vsSimonFraser(9/3/11)Total Offense 469 vsPugetSound(10/29/11)Yards Per Play 6.7 vsPugetSound(10/29/11)Points 44 vsPugetSound(10/29/11)Sacks By 6 vsPugetSound(10/29/11)First Downs 24 vsSimonFraser(9/3/11) atPacificLutheran(11/5/11)Penalties 8 vsMenlo(9/10/11) atWillamette(10/08/11) atPacificLutheran(11/5/11)Penalty Yards 80 atPacificLutheran(11/5/11)Turnovers 3 atWillamette(10/08/11) atWhitworth(10/22/11)Interceptions By 3 vsPugetSound(10/29/11)Punts 9 atClaremont-M-S(9/17/11)Punting Avg 38.3 atPacificLutheran(11/5/11)Long Punt 52 vsMenlo(9/10/11) atPacificLutheran(11/5/11)Punts inside 20 5 vsMenlo(9/10/11)Long Punt Return 22 vsSimonFraser(9/3/11)

Opponent Indvidual Game HighsRushes 22 RooneyatClaremont-M-S(9/17/11)Yards Rushing 181 PalmervsSimonFraser(9/3/11)TD Rushes 3 RooneyatClaremont-M-S(9/17/11) Welch,KeithvsLewis&Clark(10/1/11) Thomas,RonnieatWhitworth(10/22/11)Long Rush 72 PalmervsSimonFraser(9/3/11)Pass Attempts 50 Foley,BradenvsPugetSound(10/29/11)Pass Completions 29 Foley,BradenvsPugetSound(10/29/11)Yards Passing 336 Halverson,ZackatPacificLutheran(11/5/11)TD Passes 5 Halverson,ZackatPacificLutheran(11/5/11)Long Pass 69 Halverson,ZackatPacificLutheran(11/5/11)Receptions 10 Chang,ThiesenvsPugetSound(10/29/11)Yards Receiving 142 Chang,ThiesenvsPugetSound(10/29/11)TD Receptions 2 Adan,RobertvsMenlo(9/10/11) Jepson,LucasvsLinfield(10/15/11) Kniffin,AdamvsPugetSound(10/29/11) Sontra,LucasatPacificLutheran(11/5/11)Long Reception 69 Bowen,TyleratPacificLutheran(11/5/11)Field Goals 1 SternauvsSimonFraser(9/3/11) West,EverettvsPugetSound(10/29/11)Long Field Goal 43 West,EverettvsPugetSound(10/29/11)Punts 6 AlexandervsMenlo(9/10/11) SalzmanatClaremont-M-S(9/17/11)Punting Avg 42.0 CorradovsSimonFraser(9/3/2011)Long Punt 60 Ehlo,AustinatWhitworth(10/22/11)Punts inside 20 2 AlexandervsMenlo(9/10/11) SalzmanatClaremont-M-S(9/17/11) Laurence,TuckervsLewis&Clark(10/1/11) Lien,ConoratPacificLutheran(11/5/11)Long Punt Return 58 Shirey,CurtisvsLewis&Clark(10/1/11)Long Kickoff Return 86 Forman,ColinvsLinfield(10/15/11)Tackles 14 MillervsSimonFraser(9/3/11)Sacks 3.0 BenLyonsatWillamette(10/08/11)Tackles For Loss 3.0 CapicciottivsSimonFraser(9/3/11) CroasmunvsSimonFraser(9/3/11) BenLyonsatWillamette(10/08/11)Interceptions 2 Raguindin,K.atWhitworth(10/22/11)

Opponent Team Game HighsRushes 56 atClaremont-M-S(9/17/11)Yards Rushing 313 atWhitworth(10/22/11)Yards Per Rush 7.6 vsSimonFraser(9/3/2011)TD Rushes 5 vsLewis&Clark(10/1/11) atWhitworth(10/22/11)Pass Attempts 56 vsPugetSound(10/29/11)Pass Completions 30 vsPugetSound(10/29/11)Yards Passing 381 vsLinfield(10/15/11)Yards Per Pass 12.4 atPacificLutheran(11/5/11)TD Passes 5 atPacificLutheran(11/5/11)Total Plays 78 vsPugetSound(10/29/11)Total Offense 524 vsLewis&Clark(10/1/11)Yards Per Play 8.5 vsLewis&Clark(10/1/11)Points 61 vsLewis&Clark(10/1/11)Sacks By 6 vsSimonFraser(9/3/2011)First Downs 23 atWillamette(10/08/11) atWhitworth(10/22/11)Penalties 11 vsSimonFraser(9/3/2011)Penalty Yards 114 atWhitworth(10/22/11)Turnovers 4 vsPugetSound(10/29/11)Interceptions By 3 atWillamette(10/08/11) atWhitworth(10/22/11)Punts 6 vsMenlo(9/10/11) atClaremont-M-S(9/17/11)Punting Avg 41.5 atWhitworth(10/22/11)Long Punt 60 atWhitworth(10/22/11)Punts inside 20 2 FiveTimesLong Punt Return 58 vsLewis&Clark(10/1/11)

PACI

FIC

Foot

ball


2011 Game By GameGame No. 1 • Sept. 3, 2011Simon Fraser 36Pacific 28Lincoln Park Stadium, Forest Grove, Ore. • Attendance: 1,725Weather: Sunny, 78 degrees

Score by Quarters 1 2 3 4 ScoreSimon Fraser 10 0 7 19 36 Pacific (Ore.) 7 7 7 7 28 Scoring Summary1st 12:57 SFU Palmer 23 yd run (Soll kick), 6-68 1:49, SFU 7 - PAC 0 03:24 PAC Schultze 9 yd run (Villareal-Gomez kick), 8-58 4:29, SFU 7 - PAC 7 01:34 SFU Soll 27 yd field goal, 4-5 1:36, SFU 10 - PAC 72nd 11:49 PAC Kershner 2 yd run (Villareal-Gomez kick), 10-71 4:38, SFU 10 - PAC 143rd 08:04 PAC Fukumoto 36 yd pass from Campbell. (Villareal-Gomez kick), 2-33 0:47, SFU 10 - PAC 21 04:23 SFU Berger 54 yd interception return (Strickland kick), , SFU 17 - PAC 214th 11:12 SFU Palmer 72 yd run (Strickland kick blockd), 2-80 1:03, SFU 23 - PAC 21 07:54 SFU Bowcott 8 yd run (Strickland kick blockd), 3-33 0:57, SFU 29 - PAC 21 02:40 SFU Bowcott 2 yd run (Strickland kick), 7-50 2:42, SFU 36 - PAC 21 00:43 PAC Nyberg, Matt 11 yd pass from Campbell, T.C. (Villareal-Gomez kick), 9-60 1:57, SFU 36 - PAC 28

SFU PACFIRST DOWNS 14 24RUSHES-YARDS (NET) 34-259 42-40PASSING YDS (NET) 52 343Passes Att-Comp-Int 14-6-1 38-23-1TOTAL OFFENSE PLAYS-YARDS 48-311 80-383Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 1--1 1-22Kickoff Returns-Yards 5-121 6-77Interception Returns-Yards 1-54 1-3Punts (Number-Avg) 5-33.4 4-28.8Fumbles-Lost 3-2 1-0Penalties-Yards 11-83 4-38Possession Time 18:39 41:21Third-Down Conversions 2 of 8 5 of 15Fourth-Down Conversions 0 of 0 2 of 4Red-Zone Scores-Chances 3-3 3-4Sacks By: Number-Yards 6-35 1-9

RUSHING: Simon Fraser-Palmer 15-181; Spagnuolo 4-42; Ephard 7-39; Bowcott 3-13;Wheeler 5-minus 16. Pacific (Ore.)-Jacobs, Davis 24-59; Schultze 7-18;Hairabedian 1-3; Kershner, Bryce 1-2; TEAM 1-minus 2; Campbell, T.C. 8-minus 40.

PASSING: Simon Fraser-Wheeler 6-14-1-52. Pacific (Ore.)-Campbell, T.C.23-38-1-343.

RECEIVING: Simon Fraser-Palmer 3-11; Kawamoto 1-22; Bryant 1-12; Buntjer 1-7.Pacific (Ore.)-Fukumoto 7-117; Nyberg, Matt 3-48; Yip, Cameron 3-37; Jacobs,Davis 2-21; Kawai, Kelson 2-19; Taylor, Brian 2-17; Schultze 2-15; Selvey,Brandon 1-39; Anthony, Blake 1-30.

INTERCEPTIONS: Simon Fraser-Berger 1-54. Pacific (Ore.)-Hastie, Tim 1-3.

FUMBLES: Simon Fraser-Wheeler 2-1; TEAM 1-1. Pacific (Ore.)-Campbell, T.C. 1-0.

Stadium: Lincoln Park Stadium Attendance: 1725Kickoff time: 1:30 pm End of Game: 4:19 pm Total elapsed time: 2:49Officials: Referee: Michael Benzer; Umpire: Daniel Meyer; Linesman: Michael Livings;Line judge: Erick Watson; Back judge: Rob Fuller; Field judge: Rob Hilsenteger;Side judge: John Love;Temperature: 78F Wind: NE 10mph Weather: Sunny

GAME SUMMARYFORESTGROVE–SimonFraserbouncedbackfroman11-pointthirdquarterdeficittocomealivelate,scoring19pointsinthefourthquarterandsnuffingalatePacificrallytocompletea36-28come-from-behindvictoryoverPacificinbothteam’s2011footballseasonopeneratLincolnParkStadium.

TheBoxers(0-1)led14-10athalftimeandbuilttheadvantageto21-10onaJordanFukumoto(So.,Mililani,Hawaii)36-yardtouchdownreceptionearlyinthirdquarter.TheClan(1-0)respondedwithfourunansweredtouchdowns,takingtheleadon72-yardrunbyBoPalmerwith11:12leftinthefourthquarter.GregBowcottscoredthenexttwotouchdownsmadeita36-21leadwhenhestrolledintotheendzoneonatwo-yardrunwith2:40togo.

Pacificcamebackwithaquick1minute,57seconddrive,cuttingthedeficittosevenpointswhenCampbellfoundMattNyberg(Fr.,Valencia,Calif.)11-yardpasswith43secondsleft.TheBoxersrecoveredtheonsidekickontheensuingkickoff,takingoveratmidfield.Campbellworkedquickly,findingFukumotofora23-yardpassplay,whothenlateraledtoNybergforninemoreyardstoputtheballontheClan’s25-yardlinewithtwosecondsleft.

CampbellfoundFukumotointherightcorneroftheendzoneforthefinalplay,butahighpassandsolidcoveragebytheSimonFraserdefensekeptthehigh-flyingreceiverfrommakingthecatch.

HeadCoachKeithBuckleysaidheisimpressedwiththegrowththathisPacificteamhasmadefromtheirstartayearagoandthegrowthsincecampbeganthreeweeksago.“Goingintohalftimewasaleadwasdefinitelyprogress,”hesaid.“WelostsomejuiceinthesecondhalfagainstabiggerandstrongerDivisionIIteam,butweshouldwalkoffthefieldwithconfi-dencethatwehavetakenstepsforward.”

CampbellputtogetheranimpressivepassingefforttobeginhissecondseasonwiththeBoxers,completing23of38passesfor343yardsandtwotouchdowns.

Fukumotomadesevencatchesfor117yardswhileDavisJacobs(So.,Tigard,Ore.)had24carriesfor59yards.TheBoxersfinishedwith383yardsoftotaloffenseanddominatedtimeofpossession,holdingontotheballforover41minutes.

BoPalmerledthepotentSimonFrasergroundattackwith181yardsandtwotouch-downs,whichincludedabreakout72-yardruntobeginthefourthquarterscoringfrenzy.Inall,259oftheClan’s311yardscameontherush.QuarterbackTreyWheelercompleted6of14passesfor52yards.

SimonFraserusedtheirhurry-upoffensetohurryintotheendzoneontheopeningpos-session.TheClanusedjust1minute,55secondstomovedownthefieldtosetupPalmerfora23-yardruntotaketheearly7-0lead.ThePacificdefenseclampeddownfromthere,allowingtheClanjustonemorescoretherestofthehalf,whichcameonanIanSternau27-yardfieldgoalwith1:34leftinthefirst.

AfterablockedfieldgoalkilledPacific’sfirstpossession,CampbellmarchedtheBoxers58yardsonthenextseries.HefoundGuntherSchutze(So.,Bellflower,Calif.)fora9-yardtouchdownpasstomakeita7-7game.CampbellthenfoundBlakeAnthony(Fr.,Valencia,Calif.)fora39-yardstrikeonthenextseries,whichsetupBryceKershner(So.,JordanValley,Ore.)foratwo-yardrunwith11:49leftinthesecondquarter.TheBoxerswouldtakethat14-10leadintohalftime.

“Iwasexcitedwiththeplaythatwehadinthefirstandsecondquarters,”Buckleysaid.“Wehadnearly21minutesofpossession.Wekepttheiroffenseoffthefieldandkeptourof-fenseon.Wekeptpluggingourwaydownthefieldandwedidagoodjobofrunning.”

Aftertradingdrivestoopenthesecondhalf,theBoxersstartedtheirthirdquarterscoringserieswhenLandonAano(So.,EwaBeach,Hawaii)recoveredTreyWheeler’sfumblewith9:02togo.TheBoxersneededjusttwoplaystotakea21-10leadwithCampbellfindingFukumotofora36-yardscoringpasswithjustovereightminutesleftinthequarter.

SimonFraser’sstringoffourunansweredtouchdownsstartedwiththedefense.AdamBergerscoredwhenheinterceptedCampbellandreturnedtheball54yardstocuttheleadto21-17.

Inthefourthquarter,theClanseemedtorunontheBoxersatwill,rushingfor145yardsinthefinal15minutes.PalmergaveSimonFrasertheleadwhenhefoundaholetorun72yardsforthescoreatthe11:12markofthestanza.AfterforcingtheBoxersintoathree-and-out,theClanusedthreeplaystotakethe29-21leadonBowcott’s8-yardrun.AfteranotherPacificthree-and-out,theClanmarchedoff50yardsinsevenplaysasBowcottwaltzedinona2-yardrunfora36-21leafwith2:40remaining.

Pacificwasnotoutoffightdespitethetwo-touchdowndeficit.CampbellquicklymovedtheBoxersdownthefieldandfoundNybergforan11-yardtouchdownpassinthefarleftcorneroftheendzonewith43secondsleft.MosesVillareal-Gomez(Fr.,Stockton,Ore.)successfullycompletedtheonsidekickontheensuingkickoff,whichwasrecoveredbyLagorioatmidfield.

ApairofincompletepassesputtheBoxersinafourthdownsituation,andCampbellcamethroughwhenhefoundFukumotofora23-yardpass.Thereceiverthenmadeahead’supplay,battingthelateralbacktoNybergontheflytomovetheballtoSimonFraser’s25-yardline.Campbellhadtwoplaystotryforthetie,butbothpassescameupincomplete.

ChrisSantiago(Fr.,Waipahu,Hawaii)ledPacificondefense,finishingwithfourtackles.LandonAano(So.,EwaBeach,Hawaii)hadtheBoxers’lonesackwhileTimHastie(So.,Auberry,Calif.)cameupwithathirdquarterinterceptionthateventuallyledtoatouchdown.KyleMillerhadninetacklestoleadSimonFraser.JustinCapicciottihadtwosacksastheClanknockedCampbelldownsixtimesontheday.

GOBO

XERS

.COM


2011 Game By GameGame No. 2 • Sept. 10, 2011Menlo 23Pacific 16Lincoln Park Stadium, Forest Grove, Ore. • Attendance: 2,115Weather: Sunny, 91 degrees

Score by Quarters 1 2 3 4 ScoreMenlo 0 7 9 7 23 Pacific (Ore.) 7 9 0 0 16

Scoring Summary1st 02:59 PAC Fukumoto 25 yd pass from Campbell, T.C. (Villareal-Gomez kick), 4-77 2:00, MC 0 - PAC 72nd 03:01 PAC TEAM safety, , MC 0 - PAC 9 01:34 PAC Kawai, Kelson 34 yd pass from Campbell, T.C. (Villareal-Gomez kick), 3-52 1:14, MC 0 - PAC 16 00:14 MC Yoder, James 2 yd run (Alexander kick), 5-69 0:51, MC 7 - PAC 163rd 04:14 MC Adan, Robert 8 yd pass from Pelasasa (Alexander kick), 15-85 5:57, MC 14 - PAC 16 02:10 MC TEAM safety, , MC 16 - PAC 164th 13:31 MC Adan, Robert 23 yd pass from Pelasasa (Alexander kick), 3-40 1:17, MC 23 - PAC 16

MC PACFIRST DOWNS 16 18RUSHES-YARDS (NET) 29-88 26-41PASSING YDS (NET) 220 310Passes Att-Comp-Int 37-21-1 31-23-0TOTAL OFFENSE PLAYS-YARDS 66-308 57-351Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 3-24 1-8Kickoff Returns-Yards 4-96 4-68Interception Returns-Yards 0-0 1-0Punts (Number-Avg) 6-34.8 7-33.3Fumbles-Lost 0-0 2-2Penalties-Yards 10-89 8-61Possession Time 30:10 29:50Third-Down Conversions 4 of 15 5 of 13Fourth-Down Conversions 0 of 1 0 of 1Red-Zone Scores-Chances 2-3 1-2Sacks By: Number-Yards 2-19 0-0

RUSHING: Menlo-Reynolds 12-50; Pelasasa 8-24; Campas, Kyle 4-13; McCord, Brent1-3; Yoder, James 1-2; TEAM 3-minus 4. Pacific (Ore.)-Jacobs, Davis 12-28;Campbell, T.C. 5-25; Armstrong, Adam 2-2; Schultze 5-2; Minaya, P.J. 2-minus 16.

PASSING: Menlo-Pelasasa 21-37-1-220. Pacific (Ore.)-Campbell, T.C. 18-24-0-275;Minaya, P.J. 5-7-0-35.

RECEIVING: Menlo-Adan, Robert 7-134; Alexander 5-59; Young 3-24; Reynolds 3-1;Boyd, Brandon 2-2; Campas, Kyle 1-0. Pacific (Ore.)-Fukumoto 7-96; Anthony,Blake 4-80; Kawai, Kelson 3-70; Nyberg, Matt 3-29; Graves, Jordan 2-9; Pumphrey1-16; Selvey, Brandon 1-4; Schultze 1-4; Roher, Caleb 1-2.

INTERCEPTIONS: Menlo-None. Pacific (Ore.)-Bettencourt 1-0.

FUMBLES: Menlo-None. Pacific (Ore.)-Jacobs, Davis 1-1; Armstrong, Adam 1-1.

Stadium: Lincoln Park Stadium Attendance: 2115Kickoff time: 7:00 pm End of Game: 10:02 pm Total elapsed time: 3:02Officials: Referee: Kenneth Ray; Umpire: Ronald Schafer; Linesman: Brian Michelson;Line judge: Neil Reinen; Back judge: Michael Baker; Field judge: Brent Baumann;Side judge: Chad Burch;Temperature: 91 degrees Wind: NNW 5 mph Weather: Sunny & hot

GAME SUMMARYFORESTGROVE–Forthesecondstraightweek,PacificsawtheeffortsofawellplayedfirsthalfslipawayonSaturdaynightasMenloscoredthefinal23pointsofthegamefora23-16come-from-behindvictoryovertheBoxersinfootballactionatLincolnParkStadium.

Afterpullingouttoa16-0leadwith1:34leftinthefirsthalf,theBoxers(0-2)foundthemselvesdoneinbyturnoversandpenalties.Pacificfumbledtwiceinthefinal30minutesandhadalleightoftheirpenaltiesinthesecondhalffor61yards.

“Wegobacktothefactthatweareayoungfootballteam,”saidPacificHeadCoachKeithBuckley.“Wehaveledmorethanwehavebeenbehindthisyear,butwehavecomeupontheshortendoftwice.Wearegoingtohavetoworkonveryquicklyisfinishingfootballgamesanddoingthesamethingsattheendofgamesthatwehaveatthebeginningofgames.”

Forthesecondstraightcontest,T.C.Campbell(So.,Kaimuki,Hawaii)pacedtheBoxerswithanotherstronggameatquarterback.Hecompleted18of24passesfor275yardsandapairoftouchdowns.Healsorushedforanet25yards,whichincludedrunsof18and20yardsintheBoxers’finaldriveofthegamethatkeptthegamealive.

JordanFukumoto(So.,Mililani,Hawaii)ledtheBoxersinreceiving,makingsevencatchesfor96yardsandatouchdown.BlakeAnthony(Fr.,Valencia,Calif.)hadfourcatchesfor80yards,includinga44-yardstrikeinthefirstquarter.KelsonKawai(So.,NorthKohala,Hawaii)hadthreecatchesfor70yards.DavisJacobs(So.,Tigard,Ore.)ledtheBoxersinrushingwith28yardson12carries.

MattPelasasaledMenlo’s(2-0)passingattack,completing21of37passesfor220yardsandtwotouchdowns.RobertAdanwasPelasasa’sfavoritetarget,catchingsevenballsfor134yardsandtwotouchdowns.ThomasReynoldsledtheOaksinrushing,carrying12timesfor50yards.

Afterbothteams’openingdrivesendedinpunts,Pacificopenedscoringwithafour-play,77-yarddrivethatwasbuoyedbyCampbell’s44-yardreceptiontoAnthony.Campbellcom-pletedthedrivewitha25-yardscoringstriketoFukumotothatputtheBoxersup7-0.

Thedefensesheldforthebulkofthesecondquarter,withtheBoxersdefensecomingthroughforascorewith3:01leftinthehalf.AfterbeingpinnedbackbypunterAaronKoford(So.,Wilsonville,Ore.)ontheirown5-yard-line,Pelasasawasflaggedforintentionalground-ingwhiletryingtothrowoutofhisownendzone.TheresultingsafetygavetheBoxersthe9-0lead.

ApersonalfoulpenaltyontheensuingfreekickgavePacifictheballatmidfield.Campbellneededonlythreeplaystoconvertatouchdown,thistimefindingKawaifora34-yardpasstogivetheBoxersa16-0leadwith1:34leftinthehalf.

Menloquicklymarcheddownthefield,needingjust58secondstoscoretheirfirsttouch-downinasignofthegame’sshiftingmomentum.Pelasasaconvertedthreepasses,thelongest40yards,beforeJamesYoderpunchedinona2-yardruntonarrowPacific’sleadto16-7athalftime.

TheOaksputtogetherthegame’slongestdrivetoscoretheirthirdquartertouchdown,running15playsover88yardsin5minutes,33seconds.Pelasasafinisheditoffwithan8-yardpasstoAdanthatcuttheleadthe16-14.TheBoxersfumbledthefollowingkickoff,butMenloturnedtheballrightbackoverwhenPelasasawasinterceptedbySamBettencourt(Fr.,Downey,Calif.)atthe1-yardline.

Pacificneverhadachancetomovetheballofftheturnover,astheywerewhistledforholdingintheendzone.Thesafetytiedthecontestupat16-16with2:10togointhethird.Menloputtogetherwhatwouldbethewinningdriveofthegameontheirfirstpossessionofthefourthquarter.TakingoveratthePacific40-yardline,PelasasaagainstwenttotheairtofindAdenopenfora23-yardscorewith13:31left.

ThePacificdefensecameupbigonMenlo’sfinaldriveofthegame,stoppingtheOaksontheirown13-yardlinebeforeseeingkickerKevinKurtzmissa31-yardfieldgoalwith6:08togo.Campbellrespondedbycompletingfivepassesandmaking18-yardand20-yardrushesonthirddownplaystokeeptheBoxersalive.PacifichadthreelooksattheendzoneandjustmissedhittingKawaionfourthdownastheOaks’defenseheldtosealthegame.

Pacificfinishedthenightwith310yardsoftotaloffensewhileMenlofinishedwith308yards.Menloheldthenarrowestofedgesintimeofpossession,controllingtheballfor30minutes,10seconds.

TimHastie(So.,Auberry,Calif.)ledPacificdefensivewith6.5tackles,including2.5tacklesforloss.BryanMills(So.,Imbler,Ore.)hadsixtackles,includingfivesolos.JoeCorreialedMenlowithsixtackles.StevenLopesfinishedwith5.5tacklesandtwotacklesforloss,includingoneofMenlo’stwosacks.

PACI

FIC

Foot

ball


2011 Game By GameGame No. 3 • Sept. 18, 2011Pacific 9Claremont-Mudd-Scripps 28Zinda Field, Claremont, Calif. • Attendance: 932Weather: Sunny, 80 degrees

Score by Quarters 1 2 3 4 ScorePacific (Ore.) 0 3 6 0 9 Claremont-M-S 7 7 7 7 28

Scoring Summary1st 09:59 CMS Rooney 1 yd run (Corcos kick), 1-1 0:09, PAC 0 - CMS 72nd 04:29 PAC Villareal-Gomez 20 yd field goal, 8-50 3:53, PAC 3 - CMS 7 01:09 CMS Rooney 18 yd run (Corcos kick), 7-62 3:14, PAC 3 - CMS 143rd 10:32 PAC Fukumoto 87 yd pass from Campbell, T.C. (Villareal-Gomez kick failed), 1-87 0:13, PAC 9 - CMS 14 04:28 CMS Rooney 17 yd run (Corcos kick), 10-75 5:34, PAC 9 - CMS 214th 01:03 CMS Tognoni 53 yd interception return (Corcos kick), , PAC 9 - CMS 28

PAC CMSFIRST DOWNS 8 19RUSHES-YARDS (NET) 23-29 56-257PASSING YDS (NET) 197 83Passes Att-Comp-Int 29-15-1 13-5-0TOTAL OFFENSE PLAYS-YARDS 52-226 69-340Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 2-13 4-22Kickoff Returns-Yards 5-90 3-27Interception Returns-Yards 0-0 1-53Punts (Number-Avg) 9-25.7 6-27.0Fumbles-Lost 1-0 3-3Penalties-Yards 7-50 5-51Possession Time 24:31 35:29Third-Down Conversions 0 of 12 7 of 16Fourth-Down Conversions 0 of 1 0 of 1Red-Zone Scores-Chances 1-1 3-5Sacks By: Number-Yards 1-9 2-18

RUSHING: Pacific (Ore.)-Jacobs, Davis 10-23; Schultze 7-17; Minaya, P.J. 1-3;Valente, Sean 1-0; Campbell, T.C. 4-minus 14. Claremont-M-S-Rooney 22-118;Wheatley 11-65; Beltz 11-42; Bickler 4-14; Jiwanlal 3-8; Kimmey 3-8; Turkel 1-3;Crawford 1-minus 1.

PASSING: Pacific (Ore.)-Campbell, T.C. 14-26-1-191; Minaya, P.J. 1-3-0-6.Claremont-M-S-Rooney 5-13-0-83.

RECEIVING: Pacific (Ore.)-Fukumoto 4-131; Pumphrey 2-17; Schultze 2-14; Nyberg,Matt 2-9; Jacobs, Davis 2-6; Mills, Bryan 1-8; Kershner, Bryce 1-6; Kawai,Kelson 1-6. Claremont-M-S-Wilson 2-51; Otterholt 2-10; Rizzo 1-22.

INTERCEPTIONS: Pacific (Ore.)-None. Claremont-M-S-Tognoni 1-53.

FUMBLES: Pacific (Ore.)-Campbell, T.C. 1-0. Claremont-M-S-Rooney 1-1; Kimmey1-1; Jiwanlal 1-1.

Stadium: Zinda Field Attendance: 932Kickoff time: 7:00 pm End of Game: 9:37 pm Total elapsed time: 2:37

GAME SUMMARYCLAREMONT,Calif.–DespitealargecontingentofPacificfansandanear-recordsettingtouchdownreceptionbyJordanFukumoto(So.,Mililani,Hawaii),theBoxersfoundthem-selvesoutmatchedbyClaremont-Mudd-ScrippsastheStagsrolledtoa28-9victoryinfootballactionatZindaField.

Fukumotofoundhimselfonthereceivingendofan87-yardtouchdownbombfromT.C.Campbell(So.,Kaimuki,Hawaii),astrikethatranksasthesecondlongestinschoolhistory.ItwastheonlytouchdowntheBoxers(0-3)scoredontheeveningastheywerelimitedto226yardsofoffenseandwent0for13onthirdandfourth-downconversions.

Campbellcompleted14of26passesfor191yardsandthescoreandwasinterceptedonceattheendofthegame.Fukumotopostedatremendousevening,recordingaseasonhigh132yardsreceivingonfourcatches.DavisJacobs(So.,Tigard,Ore.)ledalimitedPacificrushingattack,netting23yardson10carries.PunterAaronKoford(So.,Wilsonville,Ore.)waskeptquitebusy,puntingseventimesforanaverageof33yardsperpunt.

QuarterbackPatrickRooneywasaone-manscoringmachinefortheStags(1-1),complet-ing5of13passesfor83yardswhilealsorushing22timesfor118yardsandthreetouchdowns.Claremontgained257oftheir340yardsoftotaloffenseontheground.TheStagsdominatedtimeofpossession,holdingontotheballfor35minutes,29seconds,andwere7of16onthirddownconversions.

Claremont’sdefensecameupwiththefirstbigplayofthegame,blockingKoford’spuntattheendofPacific’sfirstpossessiontotakecontrolonthePacific1-yardline.RooneyneededjustoneplaytoscorethetouchdownandputtheStagsup7-0justfiveminutesintothecontest.

ThePacificdefensegotabreakoftheirownearlyinthesecondquarterwhenBryanMills(So.,Imbler,Ore.)forcedNateJiwanlaltofumbleatthegoalline.TheBoxersearnedthetouchback,butcouldnotconverttheturnoverintoascore.MosesVillareal-Gomez(Fr.,Stockton,Calif.)putPacificontheboardontheirnextseries,kickinga20-yardfieldgoalwith4:29leftinthehalftomakethescore7-3.

TheStagsmovedquicklytoputonemoretouchdownontheboardinthesecond,going62yardsoverthenext3minutes,21seconds.Rooneyagaintookittotheendzonehimself,scoringonan18-yardrunthatallowedtheStagsa14-3halftimelead.

BothteamstradedpossessionstoopenthethirdquarterbeforeCampbellfoundFukumotoforthe87-yardtouchdownbombtobringtheBoxerswithin14-9atthe10:32mark.Thepass-ingplayranksassecondlongestinPacifichistorybehinda95-yardeffortbyRalphNickersontoJimWillsagainstEasternOregonduringthe1973season.

Claremontansweredrightbackontheirnextdrive,runningtheballonnineofthe10plays.OnceagainitwasRooneydoingthescoringhonors,rushinginfrom17yardsouttogivethehometeama21-9leadwith4:28leftinthethird.

Pacific’sdefenseonceagaingavetheiroffenseachancetogetbackintothegameearlyinthefourthwhenSeanBangs(So.,Portland,Ore.)recoveredaRooneyfumble,butthedrivestalledoutbeforetheBoxerscouldmovetheballintoClaremontterritory.Pacificforcedatotalofthreefumblesonthenight,butcouldonlyconvertthreepointsofftheturnovers.TheStagssealedthegamelatewhenCorbinTognoniinterceptedCampbellandranback53yardsforthegame’sfinalscorewith1:03togo.

MillsledPacificdefensivelywithninetacklestogoalongwithonetackleforlossandtheforcedfumble.ShaneFeuerbach(So.,Rocklin,Calif.)finishedwitheighttackles.MaxWins-bergfinishedwithsixtacklestoleadtheStags.

BOXER BYTES: PacificBoardofTrusteesmemberandKISSleadguitaristTommyThayerwasinattendanceatthegame.Thayerandhiswife,Amber,resideintheLosAngelesarea…ThegamewasPacific’sfirsteverinsouthernCaliforniaandtheirfirstgamesouthoftheBayAreasinceNov1,1948,whenPacificplayedatCalPoly.

GOBO

XERS

.COM


2011 Game By GameGame No. 4 • Oct. 1, 2011Lewis & Clark 61Pacific 35Lincoln Park Stadium, Forest Grove. • Attendance: 2,149Weather: Overcast, showers, 60 degrees

Score by Quarters 1 2 3 4 ScoreLewis & Clark 19 14 14 14 61Pacific (Ore.) 9 14 0 12 35

Scoring Summary1st 12:11 L&C Welch,Keith 1 yd run (Monley,Simon kick blockd), 2-18 0:18, L&C 6 - PAC 0 12:11 PAC Mills, Bryan PAT return, , L&C 6 - PAC 2 06:37 L&C Shirey,Curtis 5 yd run (Monley,Simon kick blockd), 9-99 3:14, L&C 12 - PAC 2 04:44 PAC Fukumoto 10 yd pass from Campbell, T.C. (Villareal-Gomez kick), 4-80 1:53, L&C 12 - PAC 9 02:11 L&C Welch,Keith 48 yd run (Monley,Simon kick), 6-80 2:24, L&C 19 - PAC 92nd 13:50 L&C Welch,Keith 4 yd run (Monley,Simon kick), 5-39 1:25, L&C 26 - PAC 9 01:22 PAC Fukumoto 27 yd pass from Campbell, T.C. (Villareal-Gomez kick failed), 9-86 4:13, L&C 26 - PAC 15 01:00 L&C Mayes,Joevonte 64 yd pass from Welch,Keith (Monley,Simon kick), 1-64 0:15, L&C 33 - PAC 15 00:19 PAC Fukumoto 2 yd pass from Campbell, T.C. (Kawai, Kelson pass from Campbell, T.C.), 4-66 0:36, L&C 33 - PAC 233rd 09:16 L&C Frisina,Andrew 28 yd pass from Welch,Keith (Monley,Simon kick), 5-39 1:25, L&C 40 - PAC 23 06:44 L&C Mayes,Joevonte 57 yd run (Monley,Simon kick), 1-57 0:13, L&C 47 - PAC 234th 10:10 L&C Shirey,Curtis 58 yd punt return (Monley,Simon kick), , L&C 54 - PAC 23 07:00 PAC Kershner, Bryce 3 yd pass from Minaya, P.J. (Bettencourt rush failed), 9-55 3:09, L&C 54 - PAC 29 04:03 L&C Taft,Bruce 6 yd pass from Dailey,Dustin (Monley,Simon kick), 6-40 2:55, L&C 61 - PAC 29 02:10 PAC Bell, Adam 1 yd run (Minaya, P.J. pass intcpt), 5-25 1:39, L&C 61 - PAC 35

L&C PACFIRST DOWNS 21 23RUSHES-YARDS (NET) 38-245 30-124PASSING YDS (NET) 279 328Passes Att-Comp-Int 24-14-0 45-27-1TOTAL OFFENSE PLAYS-YARDS 62-524 75-452Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 3-107 2--7Kickoff Returns-Yards 4-88 7-154Interception Returns-Yards 1-15 0-0Punts (Number-Avg) 3-33.7 4-37.2Fumbles-Lost 0-0 1-1Penalties-Yards 10-113 6-57Possession Time 24:23 35:37Third-Down Conversions 6 of 10 5 of 15Fourth-Down Conversions 0 of 1 3 of 4Red-Zone Scores-Chances 4-5 4-5Sacks By: Number-Yards 1-8 2-13

RUSHING: Lewis & Clark-Welch,Keith 14-106; Mayes,Joevonte 8-89; Shirey,Curtis 5-39; Littlefield,Z. 2-25; Dailey,Dustin 4-5; Frisina,Andrew 2-4; Laurence,Tucker 1-1; Taft,Bruce 1-minus 3; Chew,Chris 1-minus 21. Pacific (Ore.)-Jacobs, Davis 10-50; Valente, Sean 9-41; Minaya, P.J. 4-14; Hairabedian 2-11; Campbell, T.C. 2-3; Schultze 1-2; Inagaki, Jar-rin 1-2; Bell, Adam 1-1.

PASSING: Lewis & Clark-Welch,Keith 13-23-0-273; Dailey,Dustin 1-1-0-6. Pacific (Ore.)-Campbell, T.C. 22-36-1-280; Minaya, P.J. 5-9-0-48.

RECEIVING: Lewis & Clark-Mayes,Joevonte 5-127; Frisina,Andrew 4-88; Evans,Shawn2-30; Carpenter,Kevin 1-21; Taft,Bruce 1-6; Piper,Brandis 1-5; Shirey,Curtis 0-2. Pacific (Ore.)-Nyberg, Matt 6-69; Fukumoto 6-62; Kawai, Kelson 5-115; Yip, Cameron 5-57; Law-rence, Jakob 1-16; Kronen, Jordan 1-6; Taylor, Brian 1-4; Kershner, Bryce 1-3; Jacobs, Davis 1-minus 4.

INTERCEPTIONS: Lewis & Clark-Baltazar,Louis 1-15. Pacific (Ore.)-None.

FUMBLES: Lewis & Clark-None. Pacific (Ore.)-Harms, Brandon 1-1.

Stadium: Lincoln Park Stadium Attendance: 2149Kickoff time: 1:30 pm End of Game: 4:35 pm Total elapsed time: 3:35Officials: Referee: Kirk Mattson; Umpire: Ronald Schafer; Linesman: Paul Wadlow;Line judge: Robert Karseki; Back judge: Mike Williams; Field judge: Rob Quello;Side judge: Joel Murphy;Temperature: 60F Wind: WSW 2 Weather: Overcast

GAME SUMMARYFORESTGROVE–Inagamepunctuatedbyhighscoringandbigplays,includingarare100-yarddefensivetwo-pointconversion,butitwasLewis&Clarkcomingupwiththelion’sshareofthosegame-makersasthePioneersrolledtoa61-35victoryoverPacificinbothteams’NorthwestConferencefootballopeneratLincolnParkStadium.

Thetwoteamscombinedfor14touchdowns,withthePioneersscoringnineofthemtoimproveto4-0overall,1-0NWC.TwoofLewis&Clark’sscorescameonoffensiveplaysof25yardsormoreandonecameona58-yardpuntreturninthefourthquarter.

Thegame,however,willberememberedfortheBoxers’bigdefensiveplayinthefirstquarter.AfterLewis&ClarkquarterbackKeithWelchscoredthefirsttouchdownofthegamewith12:11leftinthefirstquarter,DevinLagorio(So.,Stockton,Calif.)succeededinblockingthePioneers’pointafterattempt.Whilemosteveryonestoodaround,BryanMills(So.,Imbler,Ore.)madeahead’supplay,runningtheballback100yardsforararedefensivetwo-pointconversion.Theplay,andplay-by-playmanMattRichert’scall,wasfeaturedastheTopPlayoftheNightonESPN’sSportscenter.

Pacific(0-4,0-1NWC)finishedwithanimpressiveseason-high452yardsoftotaloffense,whichincluded328yardspassing.TheBoxersdominatedthetimeofpossession,holdingontotheballofover35minutes.Lewis&Clarkwasjustasimpressive,finishingwith524yards,281ofthosecomingintheair.

Bothteamswereheavilypenalized,withL&Ctaking10penaltiesfor113yardsandtheBoxerstakingsixpenaltiesfor57yards.Pacificwasalsobitbyturnovers,givingtheballuptwiceinadditiontolosingtheballonceondowns.

“Wejusthavetocontinuetostopmakingmistakesandkeepaccentuatingwhatwedopositivelytomovetheballdownthefieldandmakeplaysdefensively,”saidPacificHeadCoachKeithBuckley.“Whenyou’reyoungandinexperiencedandwhenyou’retryingtomakeupforinexperienceandlackofsize,mistakeshavetobeminimizedtostayintheballgame.We’llgoback,watchfilm,fixtheproblemsthatweseeandmoveforward.”

T.C.Campbell(So.,Kaimuki,Hawaii)hadanotherimpressivegameatquarterbackforPacific,completing22of36passesfor280yards,threetouchdownsandaninterception.Kel-sonKawai(So.,NorthKohala,Hawaii)finishedwith115yardsreceivingonfivecatches,whileJordanFukumoto(So.,Mililani,Hawaii)caughtallthreeoftheBoxers’touchdownpasses.DavisJacobs(So.,Tigard,Ore.)had10rushesfor50yardstoleadPacificontheground.

Lewis&ClarkquarterbackKeithWelchwasonceagainaone-manwreckingcrew,passingfor273yardsandtwotouchdownswithalsorushingfor106yardsandthreescores.JoevonteMayesledL&Cinreceiving,finishingwith127yardsandatouchdownonfivecatches.

AfterWelch’sopeningtouchdownandMills’nownationally-famousconversion,CurtisShireymadeita12-6L&Cleadwhenhescoredonafive-yardrunwith6:37leftinthefirst.TheBoxersscoredtheirfirsttouchdownontheirnextdrive.Campbellsetupthescorewitha70-yardpassplaytoKawai,andthenfoundFukumotoonthenextplaytobringtheBoxerswithin12-9with4:44leftinthefirst.

ThePioneerstalliedonemoretimeinthefirst,needingonly2minutes,24secondstogo80yards.Welchtookittotheendzonehimself,dashingfora48-yardruntomakeita19-9game.Welchstruckpaydirtagainearlyinthesecondquarter,waltzinginwithafour-yardrunjustaminuteintothestanza.

Bothteamswentscorelessforthenext11minutesbeforeaflurryofscoringcappedtheendofthehalf.CampbellmarchedtheBoxers86yardsandfoundFukumotofora27-yardtouchdownpasswith1:22togotocomewithin26-15.MayesneededonlyoneplaytotakethescorebackwhenWelchfoundhimfora64-yardstriketoputthePioneersbackup33-15.Campbellrespondedwithafour-play,66-yarddriveoverthenext36seconds,whichendedwithatwo-yardpasstoFukumotothatbroughttheBoxerswithin33-23atthehalf.

ThePioneerseffectivelyputthegameoutofreachinthethird,keepingtheBoxersoffthescoreboardwhileputtinguptwomoretouchdownsoftheirown.AndrewFrisinamadeita40-23gamewhenhecaughta28-yardpassfromWelch,andMayesextendedtheleadto47-23with6:44leftinthequarterwitha57-yardrun.Shireypunctuatedthingswith10:10leftinthefourthquarterwhenhereturnedapunt57yardsforthetouchdown.

PacificputtheirfirstpointsofthesecondhalfupwithsevenminutesinthefourthwhenBryceKershner(So.,JordanValley,Ore.)caughtathree-yardpassfromP.J.Minaya(So.,Wahiawa,Hawaii).ThePioneersaddedtwomorelatescores,oneofsix-yardpassfromDustinDaileytoBruceTaftwith4:03togo.AdamBell(Fr.,Canby,Ore.)puttheBoxersintheendzoneonemoretimewhenhescoredonaone-yardrunwith2:10left.

JoshBrinkworth(Fr.,ElkGrove,Calif.)ledPacificdefensivelywitheighttackles.Millsfinishedwithsixtackles.LoganKotzianledLewis&Clarkwithninetackles.

PACI

FIC

Foot

ball


2011 Game By GameGame No. 5 • Oct. 8, 2011Pacific 7Willamette 49McCullough Stadium, Salem, Ore. • Attendance: 1,250Weather: Partly Cloudy, 65 degrees

Score by Quarters 1 2 3 4 ScorePacific (Ore.) 0 0 7 0 7 Willamette 7 21 7 14 49

Scoring Summary1st 01:37 WU Scott Perlin 4 yd run (Kyle Derby kick), 4-65 1:44, PAC 0 - WU 72nd 13:41 WU Jake Knecht 39 yd pass from Brian Widing (Kyle Derby kick), 3-55 1:10, PAC 0 - WU 14 04:14 WU Jamiere Abney 32 yd pass from Brian Widing (Kyle Derby kick), 12-80 4:08, PAC 0 - WU 21 01:28 WU Dylan Jones 22 yd run (Kyle Derby kick), 4-39 1:11, PAC 0 - WU 283rd 06:35 WU Mason Brown 13 yd run (Kyle Derby kick), 4-36 1:30, PAC 0 - WU 35 00:14 PAC Taylor, Brian 4 yd pass from Minaya, P.J. (Villareal-Gomez kick), 3-59 1:11, PAC 7 - WU 354th 03:38 WU Harmon, Joseph 2 yd run (Tommy Laird kick), 12-67 4:55, PAC 7 - WU 42 02:32 WU David Lowe 47 yd interception return (Pete Kline kick), , PAC 7 - WU 49

PAC WUFIRST DOWNS 17 23RUSHES-YARDS (NET) 36-57 48-295PASSING YDS (NET) 266 169Passes Att-Comp-Int 36-21-3 21-10-0TOTAL OFFENSE PLAYS-YARDS 72-323 69-464Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 2-0 2-6Kickoff Returns-Yards 7-146 3-48Interception Returns-Yards 0-0 3-47Punts (Number-Avg) 4-30.2 3-33.0Fumbles-Lost 1-0 2-0Penalties-Yards 8-65 6-40Possession Time 31:59 28:01Third-Down Conversions 4 of 16 10 of 15Fourth-Down Conversions 1 of 4 0 of 1Red-Zone Scores-Chances 1-2 3-3Sacks By: Number-Yards 2-2 4-22

RUSHING: Pacific (Ore.)-Schultze 5-21; Kershner, Bryce 3-13; Inagaki, Jarrin 4-12; McKinney, Deven 1-7; Rietmann 1-7; Paradis, Dustin 1-5; Hairabedian 2-5; Minaya, P.J. 6-3; Huff, Torin 1-3; Bell, Adam 1-2; Easley, Alex 1-1; Jacobs, Davis 4-0; Ladiges, Bobby 1-0; Roher, Caleb 1-minus 1; Campbell, T.C. 3-minus 5; Team 1-minus 16. Willamette-Jamiere Abney 5-59; Cole Altuzarra 3-31; Nolan Plummer 5-31; Brian Widing 5-28; Dylan Jones 3-24; Taylor Wyman 6-20; Matt Williams 3-19; Danny Mitchell 2-17; Derek Traeger 2-17; Mason Brown 3-17; Conor Dunn 3-13; Harmon, Joseph 2-7; Scott Perlin 2-6; Josh Dean 1-5; Jake Turner 1-4; Connor Pogue 1-0; TEAM 1-minus 3.

PASSING: Pacific (Ore.)-Minaya, P.J. 13-18-0-167; Campbell, T.C. 6-12-2-84; Huff, Torin 2-6-1-15. Willamette-Brian Widing 7-16-0-134; Jake Jones 2-4-0-17; Danny Mitchell 1-1-0-18.

RECEIVING: Pacific (Ore.)-Fukumoto 4-114; Anthony, Blake 4-64; Taylor, Brian 3-21; Pumphrey 1-15; Lawrence, Jakob 1-14; Kershner, Bryce 1-11; Kronen, Jordan 1-9; Hairabedian 1-7; Schultze 1-5; Merriam, Kyle 1-4; Roher, Caleb 1-2; Graves, Jordan 1-1; Nyberg, Matt 1-minus 1. Willamette-Jake Knecht 3-57; Jamiere Abney 2-45; Jake Turner 2-32; Ryan Johnston 1-18; Derek Traeger 1-15; Taylor Wyman 1-2.

INTERCEPTIONS: Pacific (Ore.)-None. Willamette-David Lowe 1-47; Cody Pastorino1-0; Wendell Galvan 1-0.

FUMBLES: Pacific (Ore.)-Harris, Andy 1-0. Willamette-Connor Pogue 1-0; TEAM 1-0.

Stadium: McCulloch Stadium Attendance: 1250Kickoff time: 1:30 PM End of Game: 4:15 PM Total elapsed time: 2:45Officials: Referee: Scott Kramer; Umpire: James Sillik; Linesman: M. Livingston;Line judge: Ronald Pahle; Back judge: Rob Fuller; Field judge: Mike Patton;Side judge: John Dively;Temperature: 65 F Wind: Light Weather: Partly Cloudy

GAME SUMMARYSALEM,Ore.–Willametteusedtheirimpressiverunninggametorackup464yardsoftotaloffenseandconvertedthreePacificturnoversintoscorestoflytoa49-7victoryinNorthwestConferencefootballactionatMcCulloughStadium.

TheBearcats(2-3,1-1NWC)saw16playersearncreditforrushestocombinefor295yardsontheground,ledbya59-yardperformancebyJamiereAbney.ScottPerlin,DylanJones,MasonBrownandJosephHarmonscoredrushingtouchdownsforWillamette.TheBearcats’defensealsocameupbigwiththreeinterceptions,allofwhichwereconvertedintoscores.

QuarterbackBrianWidingcompleted7of16passesforatotalof134yardsandtwotouchdowns.JakeKnechtandAbneyhadtheBearcats’receivingtouchdowns.

Pacific(0-5,0-2NWC)finishedwith323yardsoftotaloffenseandhadtheballfor32minutesofthegame,butfoundanumberofscoringopportunitiesscuttledbyturnovers.P.J.Minaya(So.,Wahiawa,Hawaii)ledPacific’s266-yardpassingattack,comingoffthebenchtocomplete13of18passesfor167yardsandtheBoxers’onlytouchdown.

JordanFukumoto(So.,Mililani,Hawaii)hadhisfourth100-yardreceivinggameoftheseason,finishingwith114yardsonfourcatches.BlakeAnthony(Fr.,Valencia,Calif.)finishedwith64yards,whichalsocameonfourcatches.GuntherSchultze(So.,Bellflower,Calif.)ledthePacificrushingattackwith21yardsonfivecarries.

Inadditiontotheinterceptions,theBoxersonceagainfoundthemselvesstungbypenal-ties.Pacificcommittedeightpenaltiesfor65yards,includingoneonthefirstplayfromscrimmagewhichnegateda40-yardpassplaythatwouldhaveputtheBoxersattheWillamette10-yardlinetostartthegame.

Bothdefensesheldstrongforthemostofthefirstquarter,withtheBoxersmakingthebig-geststopwhentheysnuffeda10-play,46-yardWillamettedriveatthePacific22-yardlinewithfourminutesleftinthestanza.TheBearcatsconvertedgoodfieldpositionintothegame’sfirstscoretwominuteslater,whenPerlinmadeafour-yardrunintotheendzonetomakeit7-0.

PacificgotthreeplaysintotheirnextdrivebeforeWendellGalvanpickedoffCampbellatmidfield,thefirstoftwosecondquarterBoxers’interceptions.WidingneededthreeplaystofindKnechtfora39-yardtouchdownpassfora14-0leadjustaminutein.TheBoxersmarched64yardsintotheredzoneontheirnextseries,onlytoseeCodyPastorinointerceptCampbellatthegoalline,wipingouttheBoxers’bestscoringopportunityofthefirsthalf.

WidingmarchedWillamettemethodicallydownthefirstfromthere,cappinga12-playdrivewitha32-yardscoringbombtoAbneythatputtheBearcatsahead21-0with4:14leftintheperiod.WillamettetookoverondownsafteraquickPacificfour-and-outandaddedaquickscorewhenJonesran22yardswith1:28left,whichgavetheBearcatsthe28-0halftimelead.

Aftertradingpossessionstobeginthesecondhalf,WillamettescoredtheirfifthtouchdownonthefamewhenBrownrushedinfrom13yardswith6:35leftinthethirdtomakea35-0lead.Minaya,whoplayedtheentirethirdquarter,finallyputPacificontheboardwith14secondsleftinthestanzawhenhefoundBrianTaylor(So.,Lewiston,Idaho)inendzonefora4-yardpass.

Willametteaddedapairofinsurancetouchdownslateinthegame.JosephHarmonscoredona2-yardrunwith3:38leftandDavidLoweaddedsixmorewhenhepickedoffPacificquarterbackSethSiddle-Mitchell(So.,Lodi,Calif.)andreturnedit47yardsforthetouchdown.

BryanMills(So.,Imbler,Ore.)andLandonAano(So.,EwaBeach,Hawaii)eachhadfivetacklestoleadPacificdefensively,withAanoearningcreditforatacvkleforlossandasack.CullenCarrollledWillamettewitheighttackles,including1.5tacklesforloss.

GOBO

XERS

.COM


2011 Game By GameGame No. 6 • Oct. 15, 2011#5 Linfield 49Pacific 6Lincoln Park, Forest Grove • Attendance: 1,756Weather: Partly Cloudy, 62 degrees

Score by Quarters 1 2 3 4 ScoreLinfield 21 7 7 14 49 Pacific (Ore.) 3 3 0 0 6

Scoring Summary1st 08:37 LIN Jepson, Lucas 14 yd pass from Inns, Mickey (Kay, Josh kick), 6-39 1:57, LIN 7 - PAC 0 02:46 PAC Villareal-Gomez 37 yd field goal, 10-55 5:45, LIN 7 - PAC 3 02:32 LIN Forman, Colin 86 yd kickoff return (Kay, Josh kick), , LIN 14 - PAC 3 00:48 LIN Fisher, Drew 4 yd blocked punt return (Kay, Josh kick), , LIN 21 - PAC 32nd 09:48 PAC Villareal-Gomez 22 yd field goal, 11-59 5:54, LIN 21 - PAC 6 06:40 LIN Saxon, Buddy 4 yd pass from Inns, Mickey (Kay, Josh kick), 8-70 3:01, LIN 28 - PAC 63rd 14:44 LIN Jepson, Lucas 65 yd pass from Inns, Mickey (Kay, Josh kick), 1-65 0:11, LIN 35 - PAC 64th 12:08 LIN Yoder, Josh 4 yd run (Kay, Josh kick), 7-88 2:48, LIN 42 - PAC 6 08:01 LIN Nelson, Colin 24 yd pass from Yarbrough, Matt (Kay, Josh kick), 5-48 2:13, LIN 49 - PAC 6

LIN PACFIRST DOWNS 18 14RUSHES-YARDS (NET) 24-96 36--5PASSING YDS (NET) 381 233Passes Att-Comp-Int 33-22-0 37-19-1TOTAL OFFENSE PLAYS-YARDS 57-477 73-228Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 4-68 1-5Kickoff Returns-Yards 3-123 8-141Interception Returns-Yards 1-11 0-0Punts (Number-Avg) 3-33.0 8-31.2Fumbles-Lost 2-0 1-0Penalties-Yards 10-96 3-24Possession Time 21:21 38:39Third-Down Conversions 6 of 11 4 of 19Fourth-Down Conversions 0 of 2 1 of 3Red-Zone Scores-Chances 3-5 2-3Sacks By: Number-Yards 5-46 0-0

RUSHING: Linfield-Hill, Josh 12-69; Nasca, Stephen 4-24; Link, Michael 1-6; Yoder, Josh 1-4; Romick, Jordy 2-2; Bolton, Ben 1-minus 2; Yarbrough, Matt 1-minus 3; Schilling, Aust 2-minus 4. Pacific (Ore.)-Schultze 12-29; Fukumoto 1-9; TEAM 1-minus 2; Ladiges, Bobby 1-minus 2; Huff, Torin 1-minus 4; Jacobs, Davis 8-minus 4; Bell, Adam 2-minus 4; Campbell, T.C. 4-minus 7; Yip, Cameron 1-minus 8; Minaya, P.J. 5-minus 12.

PASSING: Linfield-Inns, Mickey 16-25-0-239; Yoder, Josh 3-3-0-76; Yarbrough, Matt 3-3-0-66; Bolton, Ben 0-2-0-0. Pacific (Ore.)-Campbell, T.C. 12-24-1-129; Minaya, P.J. 6-10-0-107; Huff, Torin 1-3-0-minus 3.

RECEIVING: Linfield-Wiersma, Deidre 5-45; Saxon, Buddy 4-61; Jepson, Lucas 3-91;Chopp, Michael 2-64; Kama, Hoku 2-3; Koczian, Erik 1-32; Peterson, Evan 1-27; Nelson, Colin 1-24; Varnell, Conner 1-15; Nasca, Stephen 1-12; Priester, Jacob 1-7. Pacific (Ore.)-Fukumoto 5-82; Pumphrey 4-60; Schultze 2-63; Taylor, Brian 2-14; Lawrence, Ja-kob 1-8; Anthony, Blake 1-7; Jacobs, Davis 1-5; Kronen, Jordan 1-1; Bell, Adam 1-minus 3; Nyberg, Matt 1-minus 4.

INTERCEPTIONS: Linfield-Fisher, Drew 1-11. Pacific (Ore.)-None.

FUMBLES: Linfield-Nasca, Stephen 1-0; Yarbrough, Matt 1-0. Pacific (Ore.)-Campbell, T.C. 1-0.

Stadium: Lincoln Park Stadium Attendance: 1757Kickoff time: 1:30 pm End of Game: 4:20 pm Total elapsed time: 3:20Officials: Referee: Wayne Dallosto; Umpire: Mike Murff; Linesman: Mike Livingston;Line judge: Dan Stivers; Back judge: Mike Baker; Field judge: Eric Cheatley;Side judge: Chad Burch;Temperature: 62 F Wind: N 4mph Weather: Partly Cloudy

GAME SUMMARYFORESTGROVE–NationallyrankedLinfieldusedbigplaystotakealargeleadandreliedonrocksteadydefensetoknockoffPacific49-6inNorthwestConferencefootballactionatLincolnParkStadium.

TheWildcats(5-0,3-0NWC),rankedNo.5inthelatestD3Football.comTop-25Poll,scoredtwiceonplaysof50yardsormore,oneofwhichcameonan86-yardkickoffreturntobeginthethirdquarter.TheLinfielddefensealsocameupbig,stuntingtwoPacificdrivesthatcameinsidethe5-yardlineandreturningablockedpuntforatouchdown.

LinfieldoutgainedPacificintotaloffense477-238,butPacificcontrolledtheballforover38minutesofthecontest.AllofPacific’spositiveyardagecameintheair.

T.C.Campbell(So.,Kaimuki,Hawaii)completed12of24passesfor129yardstoleadtheBoxers,whileP.J.Minaya(So.,Wahiawa,Hawaii)completed6of10passesfor107yards.JordanFukumoto(So.,Mililani,Hawaii)caughtfiveballsfor82yards.GuntherSchultze(So.,Bellflower,Calif.)caughttwoballsfor63yardsandalsohas12rushesfor29yards.

MickeyInnshadanotherbigdayforLinfieldatquarterback,completing16of25passesfor239yardsandthreetouchdowns.LucasJepsonwashisfavoredtarget,makingthreecatchesfor91yardsandapairoftouchdowns.BuddySaxoncaughtfourballsfor61yardsandascore.JoshHillledtheLinfieldrushinggame,carrying12timesfor69yards.

Withthewin,Linfieldextendedtheirstreakofconsecutivewinningseasonsto56,themostforanyprogramatanylevelofcollegiatefootball.

Pacificheldontotheballof12minutesofthefirstquarter,butitwasLinfielddominat-ingtheactionthankstobigplaysandquickdrives.TheWildcatsneededonly1minute,57secondstocoverttheirfirstdriveintoatouchdownasInnsfoundLucasJepsonfora14-yardstrikeatthe8:37mark.

TheBoxersmilkedtheirnextdrivefornearlysixminutes,whichendedonaMosesVillareal-Gomez’s(Fr.,Stockton,Calif.)37-yardfieldgoalatthe2:46mark.TheWildcats,however,wouldconvertbigplaysintotwomorescoredbeforethefirstquarterended.

ColinFormanreturnedtheensuingkickoff86yardsforatouchdown,andthenKyleWrightblockedAaronKoford’s(So.,Wilsonville,Ore.)puntatthePacific4-yard-line,allowingDrewFishertorunitbackforthescore.Linfieldled21-3afterthefirst15minutes.

Pacificputtogetheranicedrivetobeginthesecondquarter,butcouldnotpunchitintotheendzonethankstoaLinfieldgoallinestand.Villareal-GomezdidputPacificontheboardwitha22-yardfieldgoaltobringtheBoxerswithin21-6with9:48togo.Linfieldclosedfirsthalfscoringontheirnextdrive,withInnsfindingSaxonfora4-yardtouchdownpassatthe6:40mark.

ThePacificdefensepreventedLinfieldfromscoringafifthfirsthalftouchdownwithagoallinestandoftheirown,stoppingtheWildcatsonthe4-yardlinetosecurethe28-6halftimescore.LinfieldoutgainedtheBoxersintotaloffense166-134inthehalfdespitetheBoxersholdingontopossessionforover22minutes.

TheWildcatsneededjustoneplaytogetthatsixthtouchdownontheboard,withInnsfindingJepsonfora65-yardscoringpassonthefirstplayfromscrimmagefora35-6Linfieldadvantage.Bothdefenseslockeddownfortherestofthequarter.TheBoxersweresuccessfulinstoppingtheWildcatsatthe4-yardlinewith8:35togointhethirdtostunta12-play,83-yarddrive.

Linfieldreturnedthefavorearlyinthefourthquarter,withtheWildcatsstoppinga10-play,48-yardplaydriveattheirown2-yardline.TheWildcatscamerightbackdownthefield,movingtheball88yardsin2minutes,48seconds.JoshYoderclosedthedrivewitha4-yardrunforthetouchdownthatgaveLinfielda42-6lead.TheWildcatsaddedonemorewith8:01leftinthefourthwhenJoshYarboroughconnectedwithColinNelsonfora24-yardscoretoclosescoring.

TimHastie(So.,Auberry,Calif.)ledPacificdefensivelywithninetackles,includingoneforloss.BryanMills(So.,Imbler,Ore.)andChazBajet(Fr.,Waipahu,Hawaii)eachhadsixtackles.DrewFisherledLinfieldwith11tackles.

PACI

FIC

Foot

ball


2011 Game By GameGame No. 7 • Oct. 22, 2011Pacific 6Whitworth 48Pine Bowl, Spokane, Wash. • Attendance: 1,545Weather: Cloudy & rain, 55 degrees

Score by Quarters 1 2 3 4 ScorePacific (Ore.) 3 0 3 0 6Whitworth 7 12 15 14 48 Scoring Summary1st 10:08 WHTW Thomas, Ronnie 2 yd run (Williams, C. kick), 10-51 3:27, PAC 0 - WHTW 7 06:01 PAC Villareal-Gomez 38 yd field goal, 8-24 4:00, PAC 3 - WHTW 72nd 10:36 WHTW Thomas, Ronnie 13 yd run (Williams, C. kick failed), 9-90 4:47, PAC 3 - WHTW 13 00:22 WHTW DeGooyer, Jake 10 yd pass from Hill, Zac (Williams, C. kick failed), 7-52 2:56, PAC 3 - WHTW 193rd 11:42 WHTW Thomas, Ronnie 46 yd run (Meyer, Wade pass from Ehlo, Austin), 6-73 3:13, PAC 3 - WHTW 27 09:11 PAC Villareal-Gomez 37 yd field goal, 5-40 2:24, PAC 6 - WHTW 27 05:03 WHTW Scott, Sean 12 yd run (McNealley, Sean kick), 2-50 0:32, PAC 6 - WHTW 344th 14:52 WHTW Meyer, Wade 51 yd pass from Hill, Zac (McNealley, Sean kick), 2-54 0:25, PAC 6 - WHTW 41 06:17 WHTW Scott, Sean 3 yd run (McNealley, Sean kick), 11-64 6:02, PAC 6 - WHTW 48

PAC WHTWFIRST DOWNS 11 23RUSHES-YARDS (NET) 23-42 54-313PASSING YDS (NET) 151 161Passes Att-Comp-Int 32-15-3 16-10-0TOTAL OFFENSE PLAYS-YARDS 55-193 70-474Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 0-0 2-8Kickoff Returns-Yards 5-117 3-39Interception Returns-Yards 0-0 3-56Punts (Number-Avg) 5-32.8 4-41.5Fumbles-Lost 1-0 1-0Penalties-Yards 7-75 8-114Possession Time 25:33 34:27Third-Down Conversions 3 of 15 4 of 12Fourth-Down Conversions 1 of 3 2 of 2Red-Zone Scores-Chances 2-2 5-5Sacks By: Number-Yards 1-5 1-6

RUSHING: Pacific (Ore.)-Jacobs, Davis 8-18; Schultze 8-17; Kershner, Bryce 3-11;Campbell, T.C. 1-3; Minaya, P.J. 2-0; Fukumoto 1-minus 7. Whitworth-Thomas, Ronnie 20-159; Scott, Sean 13-44; McCune, Michael 4-38; Tripoli, DJ 7-27; Hill, Zac 4-26; Todd, Derek 2-10; Charvoz, Daniel 2-7; Case, Ian 1-1; Thomas, Danny 1-1.

PASSING: Pacific (Ore.)-Minaya, P.J. 10-18-1-85; Campbell, T.C. 5-14-2-66.Whitworth-Hill, Zac 10-16-0-161.

RECEIVING: Pacific (Ore.)-Fukumoto 4-44; Anthony, Blake 4-23; Schultze 2-33;Taylor, Brian 2-29; Lawrence, Jakob 1-12; Pumphrey 1-6; Roher, Caleb 1-4.Whitworth-Meyer, Wade 3-63; DeGooyer, Jake 3-27; Ehlo, Austin 2-46; Lind, Devon1-15; Yount, Chad 1-10.

INTERCEPTIONS: Pacific (Ore.)-None. Whitworth-Raguindin, K. 2-16; Miller, Paul1-40.

FUMBLES: Pacific (Ore.)-Roher, Caleb 1-0. Whitworth-Hill, Zac 1-0.

Stadium: Whitworth Pine Bowl Attendance: 1545Kickoff time: 1:05 pm End of Game: 4:00 pm Total elapsed time: 3:00Officials: Referee: Michael Bezner; Umpire: Ronald Shafer; Linesman: Paul Wadlow;Line judge: Ronald Pahle; Back judge: Rob Fuller; Field judge: Rob Hilsenteger;Side judge: Joel Murphy; Scorer: Cole Reynolds;Temperature: 55 Wind: calm Weather: Cloudy, rain

GAME SUMMARYSPOKANE,Wash.–PacificfoundthemselvesstymiedbyanaggressiveWhitworthdefensiveattack,whilethePiratesputtogetheraseason-bestdayfortheirrunninggameastheydis-patchedtheBoxers48-6inNorthwestConferencefootballactionatthePineBowl.

Pacific(0-7,0-4NWC)wasunderpressurefromaconstantlyblitzingWhitworthdefenseallafternoon.ThePirateslimitedtheBoxersto11firstdownsandjusttwoscores,bothonMosesVillareal-Gomez(Fr.,Stockton,Calif.)fieldgoals.Whitworth(2-5,1-2NWC)pickedoffPacificquarterbacksthreetimes,convertingtwoofthoseinterceptionsintotouchdowns.

TheBoxerswerelimitedtoaseasonlow193yardsoftotaloffense,151ofthosecomingintheair.P.J.Minaya(So.,Wahiawa,Hawaii)completed10of18passesfor85yardswithoneinterceptiontoleadPacificatquarterback.StarterT.C.Campbell(So.,Kaimuki,Hawaii)completedjust5of14passesfor66yardsandwaspickedtwice.

JordanFukumoto(So.,Mililani,Hawaii)ledsevenPacificreceiverswith44yardsonfourcatches.GuntherSchultze(So.,Bellflower,Calif.)hadtwocatchesfor33yardsandrushedfor17moreyards.DavisJacobs(So.,Tigard,Ore.)rushedeighttimesfor18yardstoleadsixPacificballcarriers.

ZacHillwentthedistanceforWhitworthatquarterback,completing10of16passesfor161yardsandtwotouchdownsasthePiratesrackedupaseasonhigh464yardsoftotaloffense,whichincludedaseasonbest313yardsrushing.RonnieThomascamealivefor159ofthoserushingyards,includingthreetouchdowns.WadeMeyercaughtthreeballsfor63yardsandatouchdown.

PacificsawtheiropeningdrivestuntedfourplaysinwithWhitworth’sKainoaRaguindininterceptingCampbellatmidfield.ThePiratesconvertedtheturnoverintoascorewhenThomasrushedinfromtwo-yardsouttogoahead7-0justfiveminutesintothegame.

TheBoxersopenedtheirnextdriveinWhitworthterritorywithDevenMcKinney(Fr.,Spanaway,Wash.)runningthekickoffback41yardstothePirates’45-yardline.Whitworth’sdefenseheldtheBoxerstoafieldgoal,withVillareal-Gomezscoringona38-yardfieldgoaltomakeita7-3game.

Whitworthmadeit13-3ontheirfirstpossessionofthesecondquarter.Thomasonceagaindidthehonors,rushinginfrom13yardswith10:36leftinthehalf.ThePirates’defenseheldPacificoneachoftheirnexttwopossessionsbeforeHillfoundJakeDeGooyerfora10-yardtouchdownpasswith22secondstogo,whichgavethehometeama19-3halftimelead.

ThePiratesopenedthesecondhalfinmuchthewaytheyendedthefirst.Thomasdidmostofthedutyinthesix-play,73-yarddrive,whichincludeda46-yardsprintforthescore.AustinEhlothenconnectedonthetwo-pointconversionattemptthatputWhitworthup27-3fourminutesintothequarter.

MinayamarchedtheBoxersdown40yardsinwhatbecametheirfinalscoringdriveofthegame,whichwasbuoyedbyapairof15-yardWhitworthpenalties.Villareal-Gomezconnectedonthe37-yardfieldgoaltobringtheBoxerswithin27-6with9:11leftinthethird.

RaguindingrabbedhissecondinterceptionofthegameonPacific’snextdrive,pickingupMinayainWhitworthterritoryandrunningtheballbacktomidfield.ThePiratesneededtwoplaysmakeita34-6gamewithSeanScottrushinginfrom12yardsoutforthetouchdown.

Whitworthscoredtwomotetouchdownsinthefourthquartertosecuretherout.Meyermadeita41-6gamewhenHillfoundhimfora51-yardscoringstrikeonthefirstplayoftheperiod.Scottfinishedoffscoringwhenherushedinthreeyardstocapan11-play,six-minutedrive.

BryanMills(So.,Imbler,Ore.)finishedwithaPacificseasonhigh12tackles,whichin-cludedahalftackleforloss.TimHastie(So.,Auberry,Calif.)finishedwitheighttackles.PaulMiller,RyanLoutsisandJonathanAllaneachhadsixtacklestoleadthePirates.

GOBO

XERS

.COM


2011 Game By GameGame No. 8 • Oct. 29, 2011Puget Sound 25Pacific 44Lincoln Park Stadium, Forest Grove • Attendance: 2,782Weather: Partly cloudy, 57 degrees

Score by Quarters 1 2 3 4 ScorePuget Sound 3 8 6 8 25 Pacific (Ore.) 7 14 14 9 44 Scoring Summary1st 04:59 UPS West,Everett 43 yd field goal, 5-29 2:42, UPS 3 - PAC 0 01:16 PAC Roher, Caleb 44 yd pass from Campbell, T.C. (Villareal-Gomez kick), 6-66 3:34, UPS 3 - PAC 72nd 11:46 PAC Kershner, Bryce 3 yd run (Villareal-Gomez kick), 8-47 4:04, UPS 3 - PAC 14 08:28 UPS Kniffin,Adam 15 yd pass from Foley,Braden (Korn, James rush), 7-67 3:11, UPS 11 - PAC 14 00:16 PAC Fukumoto 27 yd pass from Campbell, T.C. (Villareal-Gomez kick), 9-73 3:24, UPS 11 - PAC 213rd 09:52 PAC Roher, Caleb 67 yd pass from Campbell, T.C. (Villareal-Gomez kick), 5-79 2:30, UPS 11 - PAC 28 08:37 PAC Fukumoto 72 yd pass from Campbell, T.C. (Villareal-Gomez kick), 1-72 0:13, UPS 11 - PAC 35 04:38 UPS Kniffin,Adam 3 yd pass from Foley,Braden (Foley,Braden pass intcpt), 14-59 3:53, UPS 17 - PAC 354th 14:40 PAC Taylor, Brian 17 yd pass from Campbell, T.C. (Villareal-Gomez kick), 8-71 4:51, UPS 17 - PAC 42 09:57 UPS Zuhl,Ross 24 yd pass from Foley,Braden (Rogers,Ryan pass from Korn, James), 13-80 2:49, UPS 25 - PAC 42 04:28 PAC Brinkworth safety, , UPS 25 - PAC 44

UPS PACFIRST DOWNS 22 21RUSHES-YARDS (NET) 22-30 41-82PASSING YDS (NET) 338 387Passes Att-Comp-Int 56-29-3 27-21-1TOTAL OFFENSE PLAYS-YARDS 78-368 68-469Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 1-1 0-0Kickoff Returns-Yards 7-125 4-58Interception Returns-Yards 1-0 3-80Punts (Number-Avg) 1-37.0 5-25.4Fumbles-Lost 2-1 1-1Penalties-Yards 7-49 6-59Possession Time 23:51 36:09Third-Down Conversions 8 of 17 8 of 16Fourth-Down Conversions 1 of 3 0 of 0Red-Zone Scores-Chances 2-3 2-3Sacks By: Number-Yards 1-13 5-21

RUSHING: Puget Sound-Foley,Braden 9-12; Park,Kupuno 9-12; Adams,Isaiah 2-9;Korn, James 1-minus 1; TEAM 1-minus 2. Pacific (Ore.)-Jacobs, Davis 20-80;Kershner, Bryce 6-22; Schultze 7-19; TEAM 2-minus 4; Campbell, T.C. 6-minus 35.

PASSING: Puget Sound-Foley,Braden 28-50-1-319; Korn, James 1-6-2-19. Pacific(Ore.)-Campbell, T.C. 21-27-1-387.

RECEIVING: Puget Sound-Chang,Thiesen 9-135; Kniffin,Adam 8-63; Zuhl,Ross 5-72;Rogers,Ryan 5-65; Adams,Isaiah 2-3. Pacific (Ore.)-Fukumoto 5-115; Roher, Caleb3-123; Anthony, Blake 3-44; Taylor, Brian 3-40; Pumphrey 3-36; Nyberg, Matt2-10; Jacobs, Davis 1-15; Schultze 1-4.

INTERCEPTIONS: Puget Sound-Erickson,Justin 1-0. Pacific (Ore.)-Mills, Bryan 1-40; Bailey, Craig 1-28; Santiago, Chris 1-12.

FUMBLES: Puget Sound-Park,Kupuno 1-1; Foley,Braden 1-0. Pacific (Ore.)-Campbell,T.C. 1-1.

Stadium: Lincoln Park Stadium Attendance: 2782Kickoff time: 1:30 pm End of Game: 4:30 pm Total elapsed time: 3:00Officials: Referee: Bob Rose; Umpire: James Silk; Linesman: John McLain;Line judge: Matt Dornan; Back judge: Chris Storey; Field judge: Greg Fisher;Side judge: Bob Koreski;Temperature: 57F Wind: SSE 2 Weather: Partly Cloudy

GAME SUMMARYFORESTGROVE–Pacific’slongawaitedfirstwincameononeofthebestperformancessincetheprogramreturnedtothefieldin2010,thrillingahomecomingcrowdwitha44-25victoryoverPugetSoundinNorthwestConferencefootballactionatLincolnParkStadium.

TheBoxers(1-7,1-4NWC)rackedupanimpressive469yardsoftotaloffensebehindarecordafternoonbyquarterbackT.C.Campbell(So.,Kaimuki,Hawaii).Thesophomorecompleted21of27passesforanear-record387yardsandtiedhisownschoolrecordfromlastseasonwithfivetouchdownpasses.

Pacificalsoreceivedapairof100-yardplusreceivingeffortsfromJordanFukumoto(So.,Mililani,Hawaii)andCalebRoher(Fr.,Gresham,Ore.).Roherhadthreecatchesfor123yardsandtwotouchdowns,whileFukumotohadfivecatchesfor115yardsandapairofscores.TheBoxers’defensealsodidtheirpart,forcingfourPugetSoundturnovers,includingthreeinterceptions.

HeadCoachKeithBuckleypraisedtheBoxers’effort,especiallyinlightofasubparperfor-mancelastweekendatWhitworth.“Forthesekidstoreboundasfreshmenandsophomoresandcomeoutandputthistypeofefforttogetherandstaytogetherasoneteam,forthetoughweekswe’vethroughistremendous,”Buckleysaid“Weunderstandit’sonewin,butit’saspecialwinandit’sonethatthesekidswillbeabletorememberforalong,longtime.”

Thegameprovedtobeanairshowbetweentwoofthetoppassingoffensesinthenation.PacificoutgainedtheLoggersintotaloffense469-381.Pacifichad387yardspassing,whilePugetSoundnetted351yardsintheair.TheBoxersfinishedwithaseason-high82yardsrush-ingledbyan80-yardeffortfromDavisJacobs(So.,Tigard,Ore.).

“It’sthemostamazingfeeling,”CampbellsaidofthemilestonedayfortheBoxers.“We’veworkedsohardtheselasttwoyearstocomeandearnthis.Towinathome,onhomecoming,infrontofourfansmeanssomuchtous.”

PugetSound(0-8,0-5NWC)gotontheboardfirst,scoringona43-yardfieldgoalbyEverettWestwith4:59togointhefirstquarter.TheBoxersdidnotneedmuchtimetoscoreontheirnextdrive,withCampbellconnectingona44-yardtouchdownpasstoRoherwith1:16leftintheperiodtotakethe7-3lead.

TheBoxersconvertedaPugetSoundfumbleintoatouchdowntoopenthesecondquarter,withBryceKershner(So.,JordanValley,Ore.)runningfromthreeyardsoutfortheonlyrushingscoreoftheday.FoleyansweredrightbackfortheLoggersontheirnextdrive,findingAdamKniffinfora15-yardpass.Afteratwo-pointconversion,theLoggerswerewithin14-11with8:28leftinthehalf.

PacificwouldscorethenextthreetouchdownsonbigplaysastheoffensivelineseemedtogiveCampbellalldaytothrowtheball.CampbellcappedthefirsthalfbyfindingFukumotofora27-yardstrikethatallowedtheBoxersa21-11leadathalftime.

AftertheLoggersgavetheballupondownsdeepinPacificterritorytoopenthesecondhalf,CampbellhookedupwithRoherforhissecondtouchdownofthedayasthefreshmanstreakeddownthefieldtocompletea67-yardscoringpassatthe9:52mark.CraigBailey(So.,Fairfield,Calif.)interceptedFoleyintheendzoneontheLoggers’nextdrive,andCampbellneededjustoneplaytofindFukumotofora72-yardbombthatgavetheBoxersacommand-ing35-11lead.

PugetSoundtheirfirstsecondhalftouchdownononeoftheirlongestdrivesofthegame,marching59yardson14playsbeforeFoleyfoundKniffinforashortthree-yardrouttomakeita35-17gamewith4:38togointhethird.Thedagger,though,cameontheBoxers’nextdrivewhenCampbellconnectedwithBrianTaylor(So.,Lewiston,Idaho)fora17-yardscoringpassjust20secondsinthefourthquarter.

RossZuhladdedatoolittle,toolatetouchdownatthe10-minutemarkwhenhewasonthereceivingendofa24-yardpassfromFoleytotheendzone.TheBoxersaddedtwomorepointslatewithJoshBrinkworth(Fr.,ElkGrove,Calif.)sackingbackupquarterbackJamesKornforasafety.

Foleycompleted29of51passesforPugetSoundfor332yards,threetouchdownsandoneinterception.Korngaveuptwointerceptionswhilegoing1for6passing.ThiesenChangfinishedwith148yardson10carrieswhileKnifinfinishedwith63yardsandtwotouchdownsoneightcatches.

ChazBajet(Fr.,Waipahu,Hawaii),TimHastie(So.,Auberry,Calif.)andBrinkwortheachhadeighttacklestoleadtheBoxers.BothBrinkworthandHastiehadasackandatackleforloss.BryanMills(So.,Imbler,Ore.)andChrisSantiago(Fr.,Waipahu,Hawaii)eachhadthefourthquarterinterceptions.CodyPedro-Sakumafinishedwith12tackles,asackandatackleforlosstoleadtheLoggers.

BOXER BYTES: Today’swinisthefirstforaPacificfootballteamsinceNov.10,1990,whentheBoxersbeatOregonTech15-14inForestGrove.Theoriginalprogramwasdiscontinuedfollowingthe1991season.Thevictoryalsosnappeda25-gamelosingstreakfortheBoxersdatingbacktothestartofthe1991campaign(16ofthosecomingwiththenewprogram)…ThefivetouchdownpassesforCampbelltiedhisownmarksetlastyearinaNov.13,2010gameatMenlo.RalphNickersonalsosharesintherecord,throwingfivetouchdownpassesagainstCollegeofIdahobackin1973…FrankBuckiewicz,Sr.,a1952AssociatedPressLittleAll-AmericanforPacificandtheBoxers’headcoachfrom1965to1980,washonoredbeforethegameandparticipatedinthecointoss…Attendancewasannouncedat2,782,anearselloutcrowdforLincolnParkStadium.

PACI

FIC

Foot

ball


2011 Game By GameGame No. 9 • Nov. 5, 2011Pacific 24Pacific Lutheran 35Sparks Stadium, Puyallup, Wash. • Attendance: 2,782Weather: Clear & Sunny, Mid 50s

Score by Quarters 1 2 3 4 ScorePacific (Ore.) 0 0 3 21 24Pacific Lutheran 14 14 7 0 35 Scoring Summary1st 13:05 PLU McDiarmid, Alex 41 yd pass from Halverson, Zack (Kaylor, Nick kick), 4-68 1:55, PAC 0 - PLU 7 01:50 PLU Sontra, Lucas 19 yd pass from Halverson, Zack (Kaylor, Nick kick), 8-80 4:27, PAC 0 - PLU 142nd 12:57 PLU Sontra, Lucas 2 yd pass from Halverson, Zack (Kaylor, Nick kick), 5-79 2:08, PAC 0 - PLU 21 01:29 PLU Bowen, Tyler 69 yd pass from Halverson, Zack (Kaylor, Nick kick), 3-83 1:47, PAC 0 - PLU 283rd 09:07 PLU Warner, Kyle 32 yd pass from Halverson, Zack (Kaylor, Nick kick), 4-57 1:41, PAC 0 - PLU 35 05:12 PAC Villareal-Gomez 28 yd field goal, 4-5 1:30, PAC 3 - PLU 354th 07:19 PAC Nyberg, Matt 3 yd pass from Minaya, P.J. (Villareal-Gomez kick), 10-65 4:50, PAC 10 - PLU 35 02:40 PAC Kershner, Bryce 2 yd pass from Minaya, P.J. (Villareal-Gomez kick), 9-85 3:20, PAC 17 - PLU 35 00:40 PAC Taylor, Brian 7 yd pass from Minaya, P.J. (Villareal-Gomez kick), 9-55 1:56, PAC 24 - PLU 35

PAC PLUFIRST DOWNS 24 19RUSHES-YARDS (NET) 25-43 29-102PASSING YDS (NET) 326 336Passes Att-Comp-Int 53-32-2 27-18-0TOTAL OFFENSE PLAYS-YARDS 78-369 56-438Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 1-1 2-11Kickoff Returns-Yards 6-123 4-36Interception Returns-Yards 0-0 2-4Punts (Number-Avg) 6-38.3 3-25.3Fumbles-Lost 1-0 5-3Penalties-Yards 8-80 8-75Possession Time 33:29 26:31Third-Down Conversions 7 of 16 1 of 7Fourth-Down Conversions 0 of 1 1 of 3Red-Zone Scores-Chances 4-5 2-3Sacks By: Number-Yards 1-9 5-15

RUSHING: Pacific (Ore.)-Minaya, P.J. 5-35; Ladiges, Bobby 2-7; Kershner, Bryce4-5; Jacobs, Davis 6-4; Danchev, Petr 1-minus 1; Schultze 2-minus 1; Campbell,T.C. 5-minus 6. Pacific Lutheran-Baldwin, Zack 4-38; Halverson, Zack 5-36;Rosser, Rockey 7-31; Pohren, Cody 2-12; James, Brandon 3-12; Logotala, Va’a 2-8;Madison, Niko 3-4; Ritchey, Dalton 2-minus 11; TEAM 1-minus 28.

PASSING: Pacific (Ore.)-Minaya, P.J. 23-34-1-223; Campbell, T.C. 9-18-1-103;TEAM 0-1-0-0. Pacific Lutheran-Halverson, Zack 18-26-0-336; Russell, Kevin0-1-0-0.

RECEIVING: Pacific (Ore.)-Fukumoto 8-83; Kawai, Kelson 6-89; Nyberg, Matt 5-42;Roher, Caleb 3-57; Anthony, Blake 3-27; Taylor, Brian 2-16; Ladiges, Bobby 1-10;Pumphrey 1-5; Kershner, Bryce 1-2; Schultze 1-0; Iosefa, Ruben 1-minus 5.Pacific Lutheran-Ritchey, Dalton 4-39; Bowen, Tyler 2-88; Orr, Tim 2-53;McDiarmid, Alex 2-53; Warner, Kyle 2-41; Sontra, Lucas 2-21; James, Brandon 2-4;Baldwin, Zack 1-25; Christianson, T 1-12.

INTERCEPTIONS: Pacific (Ore.)-None. Pacific Lutheran-Volland, Jonny 1-4;McFadden, Sean 1-0.

FUMBLES: Pacific (Ore.)-Roher, Caleb 1-0. Pacific Lutheran-TEAM 2-2; Baldwin,Zack 1-0; Ritchey, Dalton 1-1; James, Brandon 1-0.

Stadium: Sparks Stadium Attendance: 1500Kickoff time: 12:30 pm End of Game: 3:30 pm Total elapsed time: 3:00Officials: Referee: Michael Bezner; Umpire: Mike Murff; Linesman: Walter Keatley;Line judge: Matthew Dornan; Back judge: Robert Berg; Field judge: Tod Migchelbrin;Side judge: John Dively; Scorer: Jenny Wohlman;Temperature: mid 50s Wind: none Weather: clear and sunny

GAME SUMMARYPUYALLUP,Wash.–QuarterbackP.J.Minaya(So.,Wahiawa,Hawaii)ledPacificinaspiritedcomebackattemptthatfelljutshortSaturdayafternoonastheBoxersclosedthe2011seasonwitha35-24losstoPacificLutheraninNorthwestConferencefootballactionatSparksStadium.

Afterstrugglingtofindtheiroffensivestrideinthefirsthalf,gainingjust67yardsinthefirst30minutes,theBoxers(1-8,1-5NWC)flourishedbehindMinaya,whocompleted23of34passesfor223yardsandthreetouchdownstothreedifferentreceivers,allinthefourthquarter.

Pacificfinishedthedaywith369yardsoftotaloffense,including326yardspassing,andonceagaindominatedtimeofpossession,holdingontotheballof33:29.

TheBoxerstrailed35-0atthe9:07markofthethirdquarterwhentheBoxerssawtheirfortunesturn.MosesVillareal-Gomez(Fr.,Stockton,Calif.)puttheBoxersontheboardwitha28-yardfieldgoalwith5:12togo.ThePacificdidtheirparttokeeptheLutesscoreless,holdingPLUto56yardsoftotaloffenseinthequarter.

Itwasinthefourththatthingsreallygotgoing.MinayapacedPacificthrougha10-play,65-yarddriveontheirfirstseriesoftheperiod,findingMattNyberg(Fr.,Valencia,Calif.)forthethree-yardtouchdownpasstomakeita35-10gamewith7:19togo.TheBoxerstriedandfailedontheonsidekickfollowingthescore,onlytowatchtheLutesgothree-and-out.

MinayamarchedtheBoxersrightbackdownthefield,closingan85-yarddrivewithan-othershottwo-yardscoringpasstoBryceKershner(So.,JordanValley,Ore.)thatbroughttheBoxerswithin35-17with2:40left.Pacifictriedtheonsidekickagain,andthistimecameupwiththeball.MinayathenneededjustovertwominutestoleadtheBoxers55yards,findingBrianTaylor(So.,Lewiston,Idaho)foraseven-yardtouchdownpasswith40secondsleft.

OnceagaintheBoxersattemptedtheonsidekick,andonceagaintheyweresuccessful.ButtimeprovedtooshortasMinayahadjustonelookattheendzoneagainbeforetimeexpired.

PacificLutheran(5-3,3-2NWC)hadtheirwaywiththeBoxersinthefirsthalf,breakingoffbigplaysfortheirfivetouchdowns.PLUquarterbackZackHalvorsonopenedthingsbycappingashortfour-playdrivewitha41-yardtouchdownpasstoAlexMcDiarmidonthegame’sopeningpossession.Twodriveslater,HalvorsonstruckpaydirtagainbyfindingLucasSontrafora19-yardscoringpassthatgavetheLutesa14-0leadafteronequarter.

AftertheBoxerswentthreeandoutontheirnextseries,theLutesneededjusttwominutestogo79yards.Halvorsoncappedthedrivewithashorttwo-yardreceptiontomakeit21-0.ThegamewentscorelessfromthereuntiltheLutesconvertedPacific’sonlyturnoverofthegame,convertinganinterceptionofT.C.Campbell(So.,Kaimuki,Hawaii)intoa69-yardtouchdownpassfromHalvorsontoTylerBowenwith1:29togo,givingPLUa28-0halftimelead.

PLUscoredtheirfifthandfinaltouchdownontheirfirstpossessionofthesecondhalf,withHalvorsonconnectingwithKyleWarnerfora32-yardreception.

KelsonKawai(So.,NorthKohala,Hawaii),playinginhisfirstgameafterseparatinghisshoulderearlierinOctober,led11Pacificplayerswhoearnedcreditforreceptionswith89yardsonsixcatches.JordanFukumoto(So.,Mililani,Hawaii)finishedwith83yardsoneightcatches.MinayawasPacific’sleadingrusher,gaining35netyardsonfivecarries.

PunterAaronKoford(So.,Wilsonville,Ore.)providedsomedistancefortheBoxers,kick-ingsixtimeforanaverageof38.3yardsperpunt,includingalongkickof52yards.

HalvorsonledPLU’spassingattackwith336yardsandfivetouchdowns,completing18of26passes.Bowenwashistoptarget,makingtwocatchesfor88yardsandatouchdown.TimOrrandMcDiarmidfinishedwith53yardseach.ZackBaldwinledtheLutesinrushingwith38yardsonfourcarries.

Defensively,JoshBrinkworth(Fr.,ElkGrove,Calif.)andChrisSantiago(Fr.,Waipahu,Hawaii)eachfinishedwithseventackles,withBrinkworthearningcreditforatackleforlossandaforcedfumble.MichaelWarsawhadninetacklesandtwotacklesforlosstoleadPacificLutheran.

NorthwestConference


Safety Bryan Mills was one of three Pacific defensive players named to the 2011 All-NWC Football Team.

PACI

FIC

Foot

ball


Northwest Conference

Team NWC Pct. PF PA Overall Pct.Linfield 6-0 1.000 276 82 10-1 .909Lewis & Clark 4-2 .667 198 221 7-2 .778Pacific Lutheran 4-2 .667 128 133 6-3 .667Whitworth 3-3 .500 190 156 4-6 .400Willamette 3-3 .500 195 124 4-6 .400Pacific 1-5 .167 122 267 1-8 .111Puget Sound 0-6 .000 132 258 0-9 .000

Final 2011 StandingsPast NWC Champions2011 Linfield2010 Linfield2009 Linfield2008 Willamette2007 Whitworth2006 Whitworth2005 Linfield2004 Linfield2003 Linfield2002 Linfield2001 Linfield, Pacific Lutheran, Willamette2000 Linfield1999 Willamette1998 Pacific Lutheran1997 Willamette1996 Willamette1985-1996 No Champion Teams competed as part of Columbia Football Assocation1984 Linfield1983 Pacific Lutheran1982 Linfield1981 Pacific Lutheran1980 Linfield1979 Pacific Lutheran1978 Linfield1977 Linfield1976 Linfield1975 Pacific Lutheran, Linfield, Whitworth1974 Linfield1973 Pacific Lutheran1972 Linfield1971 Linfield, Pacific Lutheran, Willamette1970 Linfield1969 Pacific Lutheran, Whitman, Linfield, Lewis & Clark1968 Willamette

1967 Willamette. Lewis & Clark1966 Lewis & Clark1965 Linfield1964 Linfield1963 Lewis & Clark1962 Linfield1961 Linfield1960 Willamette1959 Willamette1958 Willamette1957 Linfield1956 Linfield1955 Lewis & Clark, College of Idaho1954 Willamette, College of Idaho, Lewis & Clark1953 College of Idaho1952 College of Idaho, Pacific1951 Pacific, Lewis & Clark1950 Lewis & Clark1949 Pacific, Lewis & Clark1948 College of Idaho1947 Willamette1946 Willamette1943-45 No Champion - World War II1942 Willamette1941 Willamette1940 Willamette1939 Pacific1938 Willamette, Pacific1937 Willamette1936 Willamette1935 Willamette1934 Willamette1933 Puget Sound1932 Puget Sound1931 Whitman1930 Whitman1929 Willamette1928 Whitman1927 College of Idaho1926 College of Idaho

www.nwcsports.com

About The NWC...IndependentColleges.ThenamewasshortenedbacktoNorthwestConferencein1998.

In1998,allnineconferenceinstitutionsshiftednationalaffiliationfromtheNAIAtotheNCAA.LeavingbehindyearsofsuccessattheNAIAlevel,theconferenceembracedthemoveasonethatwouldfosterequity,sportsmanshipandgenuineconcernforthestudent-athleteinallendeavorsofcompetition.

CollegesanduniversitiesinNCAADivisionIIIplacethehighestpriorityontheoverallqualityoftheeducationexperienceandonthesuccessfulcompletionofallstudents’academicprograms.Theyseektoestablishandmaintainanenvironmentinwhichastudent-athlete’ssportsactivitiesareconductedasanintegralpartofhisorhereducationalexperience.

SincejoiningtheNCAAin1998,fourNorthwestConferenceprogramshavewonDivisionIIInationaltitles.PacificLutheranwonthefootballtitlein1999.Linfieldcapturedthefootballtitlein2004andthesoftballcrownin2007andGeorgeFoxwasthebaseballchampionin2005.

TheNorthwestConferenceisbuildingareputationasoneofthemostcompetitiveNCAADivisionIIIalliancesinthecountry.ThenineprivatecollegesanduniversitiessituatedthroughoutOregonandWashingtonarenationallycompetitiveinabroadspectrumofsports.

TheNWChascontinuallyreinventeditselfthroughoutthepast80years.Formedin1926,theconferenceisoneoftheoldestathleticalliancesinthewesternUnitedStates.

ChartermembersincludedWillamette,Pacific,Whitman,theCollegeofPugetSound(UPS),LinfieldandtheCollegeofIdaho.Lewis&Clarkjoinedin1931.PLUwasaddedin1965andWhitworthbecameamemberin1970.

TheCollegeofIdahodroppedoutin1978.WhitworthlefttheNWCin1984butreturnedin1988.

TheNorthwestConference,whichforyearssponsoredathleticcompetitionexclusivelyformen’ssports,andtheWomen’sConferenceofIndependentCollegesjoinedforcesin1984tobecometheNorthwestConferenceof

NWC in 2011 NCAA Playoffs1st Round: at Linfield 30, Cal Lutheran 272nd Round: at Wesley 49, Linfield 34

GOBO

XERS

.COM


Northwest Conference

FIRST TEAM DEFENSETyler Steele DL LinfieldErik Magnussen DL Pacific LutheranRyan Bourke DL WillametteLouis Baltazar LB Lewis & ClarkKole Kreiger LB LinfieldDominique Forrest LB LinfieldTyler Vlasak LB Puget SoundHarmon Bruno LB WillametteDrew Fisher DB LinfieldTaylor Skore DB LinfieldNate Dixon DB LinfieldJustin Whitman DB Pacific LutheranCody Pastorino DB WillametteJosh Kay PK LinfieldMitchell Rowan PK/P WillametteAustin Ehlo P Whitworth

SECOND TEAM DEFENSEJohn Berokoff DL Lewis & ClarkBen Lyons DL WillametteBrynnan Hyland DL LinfieldTyler Robitaille LB LinfieldRyan Loutsis LB WhitworthScott Carr LB WhitworthDan Curtin LB Lewis & ClarkSteven McDonald LB Pacific LutheranWes Wenzel LB WillametteChris Kelly DB Lewis & ClarkSean McFadden DB Pacific LutheranPaul Miller DB WhitworthDominic David DB WillametteCurtis Shirey KR Lewis & Clark

HONORABLE MENTIONLewis & Clark: Brandis Piper (WR); Kevin Carpenter (WR); Tony Zamora ( OL); Andrew Frisina (WR); Angus Blair (DL)Linfield: Kala’e Parish (DB); Sparky Gonzalez (DL); Deidre Wiersma (WR); Jacob Priester (TE)Pacific (Ore.): Craig Bailey (DB); TC Campbell (QB); Bryan Mills (DB); Brian Taylor (TE); Devin Lagorio (DL); Moses Villareal-Gomez (PK)Pacific Lutheran: Adam Schwander (LB); Taylor Angevine (DB); Alex McDiarmid (WR); T.J. Suek (LB)Puget Sound: Casey Coberly (DL)Whitworth: Bryan Peterson (QB); Brodrick Hirai (DL); Cailen Thomason (DB); Fernando Noriega (DB); Jonathan Allen (DL)Willamette: Mark Meek (DL); Ron Carter (DL); Scott Perlin (RB); Jaden Roselli (LB); Alex Holland (DB); Tyson Giza (DB)

SECOND TEAM OFFENSEZack Halverson QB Pacific LutheranJake Turner RB WillametteJoevonte Mayes RB Lewis & ClarkThiesen Chang WR Puget SoundLucas Jepson WR LinfieldAustin Ehlo WR WhitworthJake DeGooyer WR WhitworthKasey Lambert TE WhitworthAaron Mowrer OL Lewis & ClarkKen Scholz OL Lewis & ClarkRaul Millan OL Lewis & ClarkEmilio Sulpizio OL WhitworthNate Guthrie OL WhitworthZane Wise OL Willamette

Offensive Player of the Year:Keith Welch, Lewis & ClarkDefensive Player of the Year:Drew Fisher, LinfieldSpecial Teams Player of the Year:Mitchell Rowan, WillametteCoach of the Year:Joseph Smith, Linfield

FIRST TEAM OFFENSEKeith Welch QB Lewis & ClarkMickey Inns QB LinfieldJosh Hill RB LinfieldRonnie Thomas RB WhitworthJamiere Abney RB WillametteBuddy Saxon WR LinfieldJordan Fukumoto WR PacificAdam Kniffin WR Puget SoundJake Knecht WR WillametteShawn Evans TE Lewis & ClarkJordan Barnes OL LinfieldHayden Mace OL LinfieldRob Marlow OL Pacific LutheranTaylor Reeder OL WillametteKenny Miller OL Willamette

2011 All-NWC Team

PACI

FIC

Foot

ball


Northwest ConferenceTeam StatisticsTEAM OFFENSIVE STATISTICSSorted By Total Yards Per GameRk Team GP PPG Yd./G Pass Yd./G C-A Rush Yd./G R/G Y/R 1st/G 3rd % 4th % Pen Yd./G Poss.1 Lewis & Clark 9 35.4 452.9 257.4 184-308 195.4 40.8 4.8 23.0 46% 45% 76.2 28:282 Linfield 11 39.9 432.0 291.4 234-380 140.6 37.7 3.7 22.3 45% 46% 66.6 27:503 Puget Sound 9 23.9 374.7 311.3 262-457 63.3 25.0 2.5 19.9 42% 38% 47.2 26:324 Willamette 10 26.6 354.0 133.1 106-185 220.9 46.3 4.8 17.4 33% 35% 55.9 30:265 Whitworth 10 27.5 341.5 194.9 163-280 146.6 39.2 3.7 17.3 38% 45% 59.3 31:376 Pacific (Ore.) 9 19.4 332.7 282.3 196-329 50.3 31.4 1.6 17.8 30% 36% 56.6 33:117 Pacific Lutheran 9 20.7 324.8 228.1 166-285 96.7 30.8 3.1 16.6 35% 39% 43.6 30:14

TEAM DEFENSIVE STATISTICSSorted By Total Yards Allowed Per GameRk Name GP PPG Pts. Yd./G Pass Yd./G Rush Yd./G Tkl./G INT FR Sacks TD1 Linfield 11 16.5 181 319.0 204.3 114.7 41.5 18 8 47 12 Whitworth 10 23.3 233 323.5 187.3 136.2 43.0 13 11 8 13 Pacific Lutheran 9 18.6 167 339.8 223.6 116.2 42.8 10 6 35 04 Willamette 10 20.7 207 367.1 235.7 131.4 38.5 17 9 21 25 Pacific (Ore.) 9 39.3 354 412.4 225.2 187.2 37.2 5 6 14 06 Lewis & Clark 9 33.6 302 425.4 255.6 169.9 41.0 9 10 29 07 Puget Sound 9 43.1 388 443.9 273.9 170.0 45.2 7 7 13 0

Individual StatisticsPASSINGTop 10 Sorted By Passing Yards Per Game (Minimum: Played in 60 Percent Of Team’s Games)Rk Name Team GP Comp Att Pct. Yds, Yds./G Yds./A TD INT Sack Yds.L1 M Inns Linfield 11 213 352 60.5% 2855 259.5 8.1 31 7 21 1662 K Welch Lewis & Clark 9 170 287 59.2% 2181 242.3 7.6 15 4 15 1163 Z Halverson Pacific Lutheran 9 166 279 59.5% 2053 228.1 7.4 17 8 19 1104 T Campbell Pacific (Ore.) 9 130 219 59.4% 1858 206.4 8.5 13 10 16 1035 B Peterson Whitworth 9 122 193 63.2% 1415 157.2 7.3 14 6 38 2426 B Widing Willamette 10 99 172 57.6% 1227 122.7 7.1 10 7 20 1067 P Minaya Pacific (Ore.) 8 63 99 63.6% 671 83.9 6.8 5 2 11 798 T Laurence Lewis & Clark 8 10 15 66.7% 109 13.6 7.3 1 0 1 39 A Ehlo Whitworth 10 2 4 50.0% 89 8.9 22.2 0 1 0 010 J Dean Willamette 10 3 4 75.0% 43 4.3 10.8 0 0 1 7

RUSHINGTop 10 Sorted By Rushing Yards Per Game (Minimum: Played in 60 Percent Of Team’s Games)Rk Name Team GP Rush Yds Yds./G Avg TD Fum Lost1 R Thomas Whitworth 10 174 1042 104.2 6.0 11 2 22 J Hill Linfield 11 194 942 85.6 4.9 9 6 33 K Welch Lewis & Clark 9 157 740 82.2 4.7 15 5 24 J Mayes Lewis & Clark 9 118 626 69.6 5.3 6 2 15 B James Pacific Lutheran 9 123 527 58.6 4.3 3 3 06 J Abney Willamette 10 100 552 55.2 5.5 3 3 27 K Park Puget Sound 9 92 350 38.9 3.8 6 3 18 J Turner Willamette 10 56 329 32.9 5.9 4 1 09 S Nasca Linfield 11 56 346 31.5 6.2 2 3 110 D Jacobs Pacific (Ore.) 9 102 258 28.7 2.5 0 1 1

RECEIVINGTop 10 Sorted By Receiving Yards Per Game (Minimum: Played in 60 Percent Of Team’s Games)Rk Name Team GP Rec Yds Yd./G Avg TD1 A Kniffin Puget Sound 9 95 995 110.6 10.5 122 J Fukumoto Pacific (Ore.) 9 50 844 93.8 16.9 83 T Chang Puget Sound 9 61 719 79.9 11.8 24 J DeGooyer Whitworth 10 58 757 75.7 13.1 35 D Wiersma Linfield 11 54 789 71.7 14.6 56 S Evans Lewis & Clark 9 54 642 71.3 11.9 57 A Frisina Lewis & Clark 9 46 623 69.2 13.5 58 J Knecht Willamette 10 35 679 67.9 19.4 89 L Jepson Linfield 11 35 661 60.1 18.9 910 J Mayes Lewis & Clark 9 39 434 48.2 11.1 2

GOBO

XERS

.COM


Northwest ConferenceIndividual StatisticsKICKINGTop 10 Sorted By PointsRk Name Team GP FGM FGA Pct. XPM XPA Pct. Pts.1 J Kay Linfield 11 15 18 83% 55 56 98% 1002 S Monley Lewis & Clark 7 5 9 56% 30 35 86% 453 K Derby Willamette 9 5 6 83% 29 29 100% 444 M Villareal-Gomez Pacific (Ore.) 9 6 10 60% 17 19 89% 355 N Kaylor Pacific Lutheran 9 5 6 83% 17 20 85% 326 E West Puget Sound 9 2 6 33% 21 24 88% 277 D Goranson Whitworth 6 3 3 100% 13 16 81% 228 S McNealley Whitworth 7 1 1 100% 11 17 65% 149 M Rowan Willamette 10 2 4 50% 1 1 100% 710 J Kopp-Anderson Lewis & Clark 8 - - - 4 5 80% 4

PUNTINGTop 5 Sorted By Punting Average (Minimum: Played in 60 Percent Of Team’s Games & 3.6 Attempts Per Game)Rk Name Team GP Punt Yds Avg In20 FC TB Blk1 A Ehlo Whitworth 10 54 2154 39.9 16 4 3 02 M Rowan Willamette 10 47 1726 36.7 15 16 4 03 T Laurence Lewis & Clark 8 34 1206 35.5 9 3 1 04 C Lien Pacific Lutheran 9 42 1447 34.5 9 14 1 05 A Koford Pacific (Ore.) 9 48 1599 33.3 13 9 2 3

RETURNSTop 10 Ranked By Total YardsRk Name Team KR Yds Avg TD PR Yds Avg TD1 T Souza Puget Sound 40 859 21.5 1 - - - -2 C Thomason Whitworth 31 559 18.0 0 - - - -3 T Giza Willamette 22 503 22.9 0 - - - -4 C Shirey Lewis & Clark 25 440 17.6 0 10 146 14.6 15 C Roher Pacific (Ore.) 20 363 18.2 0 - - - -6 C Forman Linfield 13 312 24.0 1 0 3 - 17 K Kawai Pacific (Ore.) 12 226 18.8 0 - - - -8 N Dixon Linfield 10 203 20.3 0 - - - -9 T Angevine Pacific Lutheran 10 200 20.0 0 - - - -10 J Knecht Willamette 7 134 19.1 0 5 28 5.6 0

SCORINGTop 10 Sorted By PointsRk Name Team Pts Pts./G Rush Rec KR PR INT FUM XPM FGM Saf 2Pt Misc1 J Kay Linfield 100 9.1 - - - - - - 55 15 - - -2 K Welch Lewis & Clark 90 10.0 15 0 - - - - - - - - -3 A Kniffin Puget Sound 72 8.0 - 12 - - - - - - - - -4 R Thomas Whitworth 66 6.6 11 0 0 - - - - - - - -5 J Hill Linfield 63 5.7 9 1 0 - - - - 1 - - -6 A Ehlo Whitworth 56 5.6 - 9 - - - - - - - 1 -7 L Jepson Linfield 54 4.9 - 9 - - - - - - - - -7 J Knecht Willamette 54 5.4 1 8 0 0 - - - - - - -9 J Mayes Lewis & Clark 50 5.6 6 2 - - - - - - - 1 -10 J Fukumoto Pacific (Ore.) 48 5.3 0 8 0 - - - - - - - -10 B Saxon Linfield 48 4.8 - 8 - - - - - - - - -

DEFENSETop 15 Sorted By Total TacklesRk Name Team GP TKL AST TOT Sack Yds TFL Yds FF FR Yds INT Yds Brup Blk Saf1 T Vlasak Puget Sound 9 50 46 96 0.5 5 3.5 12 1 1 0 2 25 1 - -2 D Fisher Linfield 11 45 31 76 1.5 20 10 49 1 - - 5 63 4 - -3 L Baltazar Lewis & Clark 9 39 34 73 8.5 55 21 82 3 1 0 1 15 - 1 14 C Kelly Lewis & Clark 9 34 38 72 - - 2 1 1 - - 1 0 2 - -5 P Miller Whitworth 10 56 15 71 - - 7 21 - - - 2 40 12 - -6 D Curtin Lewis & Clark 8 32 35 67 2 15 4 18 1 1 0 2 0 1 - -6 D Forrest Linfield 10 34 33 67 3 20 10.5 46 1 - - 1 1 - - -8 W Wenzel Willamette 10 23 42 65 3.5 19 4 20 1 1 0 - - 2 - -9 H Bruno Willamette 10 24 39 63 1.5 16 7 26 1 - - - - - - -10 B Mills Pacific (Ore.) 9 35 27 62 - - 4 6 2 - - 1 40 2 - -11 C Petro-Sakuma Puget Sound 9 32 28 60 2.5 23 6.5 42 2 - - 1 0 1 - -11 J Rosselli Willamette 9 27 33 60 1.5 8 3.5 15 2 - - 1 34 5 - -11 A Schwander Pacific Lutheran 9 36 24 60 4 28 9.5 38 1 1 0 - - 3 - -14 F Noriega Whitworth 10 31 28 59 - - 1.5 3 - 1 0 1 6 8 - -15 C Pastorino Willamette 10 37 21 58 - - 3.5 20 - 1 0 2 37 2 1 -

PACI

FIC

Foot

ball


Northwest Conference2011 NWC Football Student-Athletes Of The WeekWeek Offensive Defensive Special TeamsSept. 6 T.C. Campbell, Pacific HarmonBruno,Willamette TysonGiza,WillametteSept. 13 JoevonteMayes,Lewis&Clark DominiqueForrest,Linfield NickKaylor,PacificLutheranSept. 20 JakeKnecht,Willamette WesWenzel,Willamette MitchellRowan,Willamette TylerVlasak,PugetSoundSept. 27 AdamKniffin,PugetSound TylerRobitalle,Linfield TylerSouza,PugetSoundOct. 4 MickeyInns,Linfield HarmonBruno,Willamette MitchellRowan,WillametteOct. 11 MickeyInns,Linfield CailenThompson,Whitworth JoshKay,LinfieldOct. 18 BrianWiding,Willamette DrewFisher,Linfield SimonMonley,Lewis&ClarkOct. 25 KeithWelch,Lewis&Clark NateDixon,Linfield TaylorSkore,LinfieldNov. 1 T.C. Campbell, Pacific RyanLoutsis,Whitworth AustinEhlo,WhitworthNov. 8 MickeyInns,Linfield JadenRosselli,Willamette DrewFisher,LinfieldNov. 15 RonnieThomas,Whitworth DrewFisher,Linfield JoshKay,Linfield

Going Bowling...NWC Teams In Small College Bowl Games & National Championship Contests1941 Fish Bowl LInfield 0, Ft. Stevens 0

1948 Potato Bowl (not affiliated with current game) UC Santa Barbara 48, Willamette 7

1949 Pear Bowl (at Medford, Ore.) Pacific 33, UC Davis 15

1950 Pear Bowl (at Medford, Ore.) Lewis & Clark 61, San Francisco State 7

1951 Pear Bowl (at Medford, Ore.) Pacific 25, UC Davis 7

1953 Refrigerator Bowl (at Evansville, Ind.) Sam Houston St. 14, College of Idaho 7

1961 Camelia Bowl NAIA Chmp. (at Sacramento, Calif.) Pittsburg St. (Kan.) 12, Linfield 7

1965 NAIA Championship Game (at Augusta, Ga.) St. John’s (Minn.) 33, Linfield 0

1980 NAIA II Championship Game (at Tacoma, Wash.) Pacific Lutheran 38, Wilmington 10

1982 NAIA II Championship Game (at McMinnville, Ore.) Linfield 33, William Jewell 15

1983 NAIA II Championship Game (at Tacoma, Wash.) Northwestern (Iowa) 25, Pacific Lutheran 21

1984 NAIA II Championship Game (at McMinnville, Ore.) Linfield 33, Northwestern (Iowa) 22

1985 NAIA II Championship Game (at Tacoma, Wash.) Wis.-La Crosse 24, Pacific Lutheran 7

1986 NAIA II Championship Game (at McMinnville, Ore.) Linfield 17, Baker 0

1987 NAIA II Championship Game (at Tacoma, Wash.) Pacific Lutheran 16, Wis.-Stevens Point 16*

1991 NAIA II Championship Game (at Georgetown, Ky.) Georgetown 28, Pacific Lutheran 20

1992 NAIA II Championship Game (at Portland, Ore.) Findlay 26, Linfield 13

1993 NAIA II Championship Game (at Portland, Ore.) Pacific Lutheran 52, Westminster 20

1994 NAIA II Championship Game (at Portland, Ore.) Westminster 27, Pacific Lutheran 7

1999 Amos Alonzo Stagg Bowl NCAA Div. III Championship (at Salem, Va.) Pacific Lutheran 42, Rowan 13

2004 Amos Alonzo Stagg Bowl NCAA Div. III Championship (at Salem, Va.) Linfield 28, Mary Hardin-Baylor 21

2012 NWC Coaches Poll 2011 RecordsSchool (1st) Pts. All NWC1. Linfield (6) 42 10-1 6-02. Pacific Lutheran 29 6-3 4-23. Whitworth (1) 26 4-6 3-34. Lewis & Clark 19 7-2 4-25. Willamette 17 4-6 3-36. Pacific 15 1-8 1-57. Puget Sound 6 0-9 0-6

(First-place votes in parenthesis. Points awarded on 7-5-4-3-2-1 basis)

LinfieldCollege,rankedNo.5intheD3football.compreseasonpoll,isastrongfavoritetobeNorthwestConferencefootballchampionsin2012,accordingtothepreseasonpollofleaguecoaches.NWCCoachoftheYearJosephSmithledLinfieldtoitsthirdconsecutiveconferencechampionshiplastseason.

TheWildcats,whoadvancedtotheNCAADivisionIIIsecondroundlastyearandfinished10-1,pickedupsixoutofsevenfirstplacevotesandtotaled42pointsinthepoll.LinfieldreturnsfiveFirstTeamAll-NWCselectionsinseniorMickeyInns(QB),seniorJoshHill(RB),seniorTylerSteele(DL),juniorDominiqueForrest(LB),andseniorJoshKay(PK).SteelealsoreceivedthirdteamD3football.comAll-AmericanhonorswhileKaywasafinalistfortheFredMitchellAwardsalutingthenation’stopkicker.

PacificLutheranfinishedbehindthefavoritesinthepollwith29points.TheLutesgraduatedthreeFirstTeamAll-NWCplayers,butSecondTeamAll-NWCDBSeanMcFaddenreturnsforhisjuniorseason.

Whitworthisthirdinthepollwith26pointsandonefirstplacevote.ThePiratesreturneightstartersonoffenseandsevenondefensefrom2011.MuchoftheiroffensiveproductionwillbeonseniorRBRonnieThomas,whoearnedFirstTeamAll-NWChonorslastseason.

Lewis&Clark(19points)justedgedoutWillamette(17points)forfourthplaceinthepoll.ThePioneerswillbecommandedbyChrisSulages,whoearnedD3fooltball.com’s2011WestRegionCoachoftheYearafterleadingtheteamtoitsfirstwinningseasonsince1962.The2011NWCOffensivePlayeroftheYearKeithWelch(QB)returnstodirectthePioneeroffense.

TheBearcatswilllooktoFirstTeamAll-NWChonoreesJakeKnecht(WR)andTaylorReeder(OT)onoffenseandCodyPastorino(S)onthedefensivesideoftheball.WillamettealsowelcomesbackjuniortailbackTerrellMalley,whosatoutlastseasonafterbeingWillamette’sleadingrusherin2010.

Pacific(Ore.)issixthinthepollwith15points.In2011,theBoxersreceivedtheirfirstvictorysincetheprogramwasreinstatedforthe2010season.JuniorWRJordanFukumotowillreturnafterbecomingthefirstAll-NWCFirstTeamselectionfortheBoxerssince1984lastyear.

PugetSoundroundsoutthepollwith7points.TheLoggersreturnWRAdamKniffin,whoreceivedFirstTeamAll-NWChonorsayearagoaswellasFirstTeamPreseasonAll-AmericanhonorsfromD3football.cominAugust.

RecordBook


PACI

FIC

Foot

ball


Individual Records

About The Football Record BookThe records shown in this media guide have been rebuilt using resources available in the Pacific University Sports Information Office. Those resources include past media guides, year-end statistical sheets, accounts from the “Heart of Oak” yearbook, newspaper clippings and old conference releases from both the Northwest Conference and Columbia Football Association media offices. Special thank you to former Pacific football players Mike Barber and John Brunelle for providing statistical reports from their years in the program between 1979 and 1982.

Statistics for the 1979-1991 seasons are compiled from official year-end statistical sheets produced by Pacific University. Statistics for the

1966-1978 season were compiled from Northwest Conference year-end releases. Older statistics have been verified by NWC releases and past Pacific media guides.

The Pacific Sports Information Office is interested in more data that would help us compile a more complete records section, specifically any statistical data. If you have information of corrections to the guide, please contact Sports Information Director Blake Timm at 503-352-2161 or [email protected].

Please note that at least one of the following will be required to verify a records change: stats sheet, newspaper clipping, press release, official University document or NAIA/NCAA official documentation.

RUSHINGRUSHING YARDSGame234 AlNavarrovs.EasternOregon(1989)234 FrankBuckiewicz,Sr., vs.Lewis&Clark(1952)Season1,072 MikeConnor(1984)Career2,143 JayButz(1969,1971-72)

RUSHING ATTEMPTSGame53 AlNavarrovs.Lewis&Clark(1990)Season259 MikeConnor(1984)Career511 JayButz(1969,1971-72)

RUSHING TOUCHDOWNSSeason10 MikeConnor(1984)

AVERAGE YARDS PER CARRYSeason7.6 WayneCarter(1984)

PASSINGPASSING YARDSGame405 T.C.Campbellvs.Menlo(2010)Season2,564 BrentSmith(1987)Career5,643 BrentSmith(1985-87)

PASS ATTEMPTSGame59 BrentSmithvs.Willamette(1987)59 BrentSmithvs.Linfield(1987)Season441 BrentSmith(1987)Career1,010 BrentSmith(1985-87)

PASS COMPLETIONSGame30 FrankBuckiewicz,Jr., vs.Linfield(1976)30 BrentSmithvs.Linfield(1986)Season233 BrentSmith(1987)Career512 BrentSmith(1985-87)

PASSING TOUCHDOWNSGame5 T.C.Campbellvs.PugetSound(2011)5 T.C.Campbellvs.Menlo(2010)5 RalphNickerson vs.CollegeofIdaho(1972)Season22 BrentSmith(1987)Career47 BrentSmith(1985-87)

PASSES HAD INTERCEPTEDSeason27 FrankBuckiewicz,Jr.(1975)

FEWEST PASSES INTERCEPTEDSeason2 P.J.Minaya(2011)

PASS COMPLETION PERCENTAGESeason59.4 T.C.Campbell(2011)

AVERAGE YARDS PER GAMESeason173.3 RalphNickerson(1975)

RECEIVINGPASS RECEPTIONSGame16 ScottBaumgartner vs.Linfield(1986)Season67 CedricWalker(1989)Career116 EricNicolai(1986-87)

RECEIVING YARDSGame227 JimWillis vs.CollegeofIdaho(1972)Season957 BobWendel(1960)Career1,766 EricNicolai(1986-87)

RECEIVING TOUCHDOWNSGame4 EricNicolaivs.Willamette(1986)Season11 EricNicolai(1986)Career21 EricNicolai(1986-87)

YARDS PER RECEPTIONSeason24.4 GaryPotratz(1978)

TOTAL OFFENSETOTAL OFFENSE YARDS(PLAYS-RUSHING YARDS)Game411 RalphNickerson vs.Whitman(1975)Season2,433 BrentSmith(1987)Career5,416 BrentSmith(1985-87)

ALL-PURPOSE YARDS(RUSHING-RECEIVING-RETURNS)Season1,204 CalvinMyles(1979)

SCORINGTOUCHDOWNS SCOREDGame4 EricNicolaivs.Willamette(1986)Season13 FrankBuckiewicz,Sr.,(1952)Career21 BobWendel(1959-61)21 EricNicolai(1986-87)

POINTS SCOREDGame24 EricNicolaivs.Willamette(1986)24 DerekCropp vs.Lewis&Clark(1985)Season90 FrankBuckiewicz,Sr.,(1952)Career189 BobWendel(1959-61)

P.A.T. KICKS MADEGame7 LloydLittle vs.CollegeofIdaho(1972)7 FrankBuckiewicz,Jr., vs.Whitman(1975)Season25 CubShulund(1986)Career44 CubShulund(1986-87)

FIELD GOALS MADESeason10 KevinBuckner(1988)Career14 WillieBrosseau(1976-79)

FIELD GOALS ATTEMPTEDSeason16 CarlosValdivia(1989)

GOBO

XERS

.COM


Individual RecordsFIELD GOAL ACCURACYSeason95.2 KevinBuckner(1988)

PUNTINGPUNTING YARDSSeason2,203 BrentNicolas(1990) 61att.,36.1avg.

PUNT ATTEMPTSSeason64 MikeKenyon(1968)

PUNTING AVERAGESeason39.2 BrentNicolas(1989)

PUNT RETURNSPUNT RETURN AVERAGESeason28.3 RobOsborn(1960)

PUNT RETURN YARDSSeason13.0 DrewValles(1981)

KICKOFF RETURNSKICKOFF RETURN YARDSSeason584 BrooksHoff(1986)

KICKOFF RETURNSSeason28 Miller(1985) BrooksHoff(1986)

KICKOFF RETURN AVERAGESeason46.0 NickGitts(1969)

TACKLESTOTAL TACKLESSeason95 TimSmith(1990)

ASSISTED TACKLESSeason43 TomWeeks(1969)

TACKLES FOR LOSSSeason14 MikeBrandolino(1983)

QUARTERBACK SACKSSeason12 CharltonMoananu(1989)

INTERCEPTIONSTOTAL INTERCEPTIONSGame4 BillBlevinsvs.Willamette(1986)Season11 JohnJubb(1949)Career22 BillBlevins(1986-89)

INTERCEPTION RETURN YARDSSeason86 MikeWilliams(1969)MOST BLOCKED PUNTSGame3 TomWeeks(1968)

Longest PlaysLONGEST PASSING PLAY95 Yds. Ralph Nickerson to Jim Wills vs. Eastern Oregon 197387 Yds. T.C. Campbell to Jordan Fukumoto vs. Claremont-Mudd-Scripps 201179 Yds. P.J. Minaya to Jordan Fukumoto vs. Linfield 201078 Yds. Junior Johnson to Buck Lorts 1970 75 Yds. Junior Johnson to Gary Pope 197172 Yds. Lloyd Little to Ron Stutzman 197071 Yds. Ernie Chinen to Chad Debnam 196970 Yds. T.C. Campbell to Jordan Fukumoto vs. Menlo 201070 Yds. Dan Oswald to Aaron Fentress vs. Whitworth 1990

LONGEST RUSHING PLAY87 Yds. Ralph Nickerson vs. Whitman 197269 Yds. Kevin Robbins vs. W. Oregon 1989

LONGEST KICKOFF RETURN97 Yds. Jerry Millis vs. Willamette 195297 Yds. Tony Warren vs. Whitman 197091 Yds. Bill Mikesell (opponent unknown) 197090 Yds. Robert Miller vs. Eastern Ore. 198590 Yds. Gerald Millis vs. Willamette 1951

LONGEST INTERCEPTION RETURN84 Yds. Karry Cameron vs. Willamette 197965 Yds. Brian Mills at Menlo 201055 Yds. Mike Kenyon vs. Coll. Of Idaho 196746 Yds. Alan Sagon vs. E. Oregon 1989

LONGEST FIELD GOAL48 Yds. Carlos Valdivia vs. Oregon Tech 1989

StreaksCONSECUTIVE VICTORIES7 1949-50 and 1972

UNBEATEN STREAK (Includes Ties)15 1951-53

CONSECUTIVE GAMES UNBEATEN AT HOME16 1948-50

CONSECUTIVE LOSSES30 1979-82

Al Navarro

Ralph Nickerson & Frank Buckiewicz

46 Yds. Carlos Valdivia vs. Simon Fraser 199044 Yds. Willie Brosseau vs. Lewis & Clark 197643 Yds. Carlos Valdivia vs. W. Oregon 199042 Yds. Jon Lee vs. Pacific Lutheran 2010 Jon Lee vs. Claremont M-S 2010

LONGEST FUMBLE RECOVERY RETURN58 Yds. Jim Westerndorf vs. So. Oregon 1972

LONGEST PUNT75 Yds. Brent Nicolas vs. So. Oregon 198967 Yds. Brent Nicolas vs. Oregon Tech 198956 Yds. Brent Nicolas vs. Whitworth 198954 Yds. Brent Nicolas vs. W. Oregon 198953 Yds. Brent Nicolas vs. Whitworth 1990

LONGEST PUNT RETURN87 Yds. Mike Thomas vs. Lewis & Clark 197549 Yds. Mike Carroll vs. S. Oregon 1990

PACI

FIC

Foot

ball


Team RecordsRUSHINGRUSHING YARDSGame409 vs.PacificLutheran(1952)Season1,662 9Games(1971)

RUSHING ATTEMPTSGame73 vs.Lewis&Clark(1971)Season493 9Games(1972)

RUSHING YARDS AVERAGESeason184.6 9Games(1972)

PASSINGPASSING YARDSGame403 vs.CollegeofIdaho(1972)Season2,689 9Games(1987)

PASSING ATTEMPTSGame60 vs.Willamette(1987)Season455 9Games(1987)

PASS COMPLETIONSGame32 vs.PacificLutheran(2011)32 vs.Linfield(1976)Season241 9Games(1987)

PASSES HAD INTERCEPTEDGame8 vs.PacificLutheran(1976)Season34 9Games(1979)

PASSING YARDS PER GAMESeason298.8 9Games(1987)

PASSING COMPLETIONS PER GAMESeason26.7 9Games(1987)

TOTAL OFFENSETOTAL OFFENSE-YARDSGame587 vs.Whitman(1972)Season3,423 9Games(1986)

TOTAL OFFENSE-AVERAGESeason380.3 9Games(1986)

SCORINGTOTAL POINTSQuarter40 vs.GeorgeFox(1923)Game In A Win118 vs.GeorgeFox(1923) Won118-0Game In A Loss42 atMenlo(2010) Lost44-42Season297 10Games(1949) (includesPearBowlgame)

SCORING AVERAGESeason29.7 10Games(1949) (includesPearBowlgame)

INTERCEPTIONSMOST INTERCEPTIONS MADEGame7 vs.Whitman(1962)Season18 8Games(1967)

MISCELLANEOUS TEAMYARDS PENALIZEDGame167 vs.CollegeofIdaho(1965)

MOST PENALTIESGame16 vs.WesternOregon(1986)

LEAST RUSHING YARDS ALLOWEDGame -10 vs.Willamette(1969)-10 vs.Willamette(1982)Season638 9Games(1990)

LEAST PASSING YARDS ALLOWEDGame0 vs.BritishColumbia(1969)Season687 9Games(1990)

LEAST TOTAL YARDS ALLOWEDGame77 vs.Whitman(1972)Season1,794 9Games(1972)

LEAST POINTS ALLOWEDSeason59 8Games(1947)

LEAST FIRST DOWNS ALLOWEDGame4 vs.OregonTech(1948)

Bill Blevins

Jon Elston

GOBO

XERS

.COM


Individual Yearly LeadersRUSHINGYr. Player GP TC Gain Lost Net Avg. TD1966 EsChung 9 136 575 139 436 3.2 71967 JimWeber 9 172 515 4 511 3.0 11968 MarkKane 8 88 322 16 306 3.5 01969 JayButz 9 159 753 34 719 4.5 51970 DickAnderson 6 71 260 4 256 3.6 21971 JayButz 9 189 909 46 863 4.5 51972 JayButz 8 163 603 42 561 3.6 41973 TomBeaver 9 93 — — 357 3.8 41974 StatsMissing1975 JohnBeal 9 106 — — 458 4.3 11976 MikeThomas 9 108 — — 450 4.2 11977 JohnBeal 9 123 — — 525 4.3 31978 RodDimick 8 53 — — 251 4.7 01979 GregBuckiewicz 8 60 330 92 238 3.9 21980 DrewValles 9 198 401 35 366 3.4 11981 DarrellJames 9 66 270 9 261 3.4 11982 ToddElliott 5 67 — — 282 4.4 21983 MikeConnor 8 139 578 14 564 4.1 71984 MikeConnor 9 259 1,117 45 1,072 4.1 101985 JohnOgden 9 138 587 22 565 4.1 31986 JohnOgden 7 100 377 24 353 3.5 11987 SkipDailey 9 103 339 32 307 2.9 21988 AlNavarro 9 181 764 18 746 4.1 91989 AlNavarro 9 214 897 15 882 4.1 51990 AlNavarro 6 146 509 18 491 3.4 41991 JoeSpanish 9 84 254 24 272 3.2 12010 DavisJacobs 9 97 385 76 309 3.2 22011 DavisJacobs 9 102 331 73 258 2.5 0

PASSINGYr. Player GP Att. Comp. Yards Avg. TD1966 LesWong 7 29 12 270 22.5 11967 EsChung 7 71 31 279 9.0 11968 JuniorJohnson 7 90 39 395 10.1 41969 JuniorJohnson 8 107 45 293 6.5 11970 JuniorJohnson 8 139 57 854 14.9 81971 JuniorJohnson 9 143 66 986 14.9 111972 RalphNickerson 9 129 76 1,414 18.6 161973 RalphNickerson* 8 200 89 1,386 15.5 81974 StatsMissing1975 FrankBuckiewicz,Jr. 9 187 74 763 10.3 61976 FrankBuckiewicz,Jr. 7 131 77 966 12.5 51977 KenDahl 9 262 123 1,524 12.3 71978 KenDahl 6 175 90 1,151 12.7 51979 MarioChaves 9 207 80 1,081 13.5 71980 GregBuckiewicz 9 94 50 759 9.8 51981 JohnBrunelle 9 145 55 887 16.1 61982 JohnBrunelle 7 66 30 629 20.9 21983 TimDurkin 9 140 50 693 13.8 31984 RickCarpenter 7 134 53 701 5.2 71985 BrentSmith 9 279 118 1,168 9.9 71986 BrentSmith 9 260 161 1,914 11.8 181987 BrentSmith 9 441 233 2,564 11.0 221988 D.J.Debbs 9 226 123 1,529 12.4 101989 JohnHollie 9 304 133 1.459 11.0 61990 DanOswald 9 287 138 1,696 12.3 111991 DanOswald 9 238 109 1,250 11.5 42010 T.C.Campbell 9 180 104 1,217 11.7 112011 T.C.Campbell 9 219 130 1,858 14.2 13*-LedNorthwestConference

RECEIVINGYr. Player GP Rec. Yards Avg. TD1966 HowardDurand 9 18 205 11.3 11967 ClarenceNathaniel 9 18 176 9.7 11968 EdKameeunui 8 15 148 9.8 01969 ChadDebnam 8 31 260 8.3 11970 BuckLorts 8 19 444 23.3 51971 BuckLorts 9 27 585 21.6 51972 JimWills 9 45 861 19.1 101973 JimWills* 9 39 779 19.9 41974 StatsMissing1975 MikeBarber 8 15 200 25.0 21976 MarkBurt 9 31 545 17.5 41977 MikeBarber* 9 54 688 12.7 41978 CalvinMyles 8 32 603 18.8 21979 CalvinMyles 9 44 638 14.5 71980 RussBlunck 9 38 352 9.3 31981 DrewValles 9 23 526 22.9 11982 ScottPerkins 9 22 357 18.2 31983 KevinSchmidt 9 9 170 18.9 21984 WayneCarter 9 26 491 18.8 81985 DerekCropp 8 17 266 15.6 51986 EricNicolai 9 56 865 15.4 111987 EricNicolai 9 60 901 15.0 101988 CedricWalker 8 39 691 17.7 81989 CedricWalker 9 67 759 11.3 51990 MarkRahlwes 8 42 557 13.3 21991 TroyWalker 9 49 721 14.7 22010 JordanFukumoto 9 30 603 20.1 62011 JordanFukumoto 9 50 844 16.9 8*-ledNorthwestConference

SCORINGYr. Player TD FG PAT Pts.1966 EsChung 8 0 0 481967 ClarenceNathaniel 2 0 0 121968 BuckLorts 2 1 6 211969 JayButz 5 0 0 301970 BuckLorts 5 3 12 511971 BuckLorts 5 4 19 611972 JimWills 10 0 0 601973 TomBeaver 5 0 0 301974 StatsMissing1975 FrankBuckiewicz,Jr. 0 7 0 211976 MarkBurt 6 0 2 381977 JohnBeal 5 0 0 301978 DrewValles 4 0 2 261979 CalvinMyles 7 0 0 421980 RussBlunck 3 0 0 181981 TimOsiadacz 3 0 0 181982 ScottPerkins 3 0 0 181983 MikeConnor 7 0 0 421984 MikeConnor 10 0 0 601985 DerekCropp 5 0 0 301986 EricNicolai 11 0 0 661987 EricNicolai 10 0 0 601988 AlNavarro 9 0 0 541989 CarlosValdivia 0 9 11 381990 AlNavarro 5 0 0 301991 AkihiroKamada 0 6 10 282010 JordanFukumoto 6 0 0 362011 JordanFukumoto 8 0 0 48

PACI

FIC

Foot

ball


Individual Yearly LeadersKICK SCORINGYr. Player FG Pct. PAT Pts.1966 HowardDurand 0 0.0 16 161967 StatsMissing1968 BuckLorts 2 — 6 121969 BuckLorts 1 — 12 151970 BuckLorts 3 — 12 211971 BuckLorts 4 — 19 311972 DonKyle 1 — 18 211973 FrankBuckiewicz,Jr. 2 — 13 191974-1977StatsMissing1978 WillieBrosseau 3 75.0 15 241979 WillieBrosseau 2-3 66.7 9 151980 MikHendrickson 1-3 33.3 6 91981 EdRitt 1-2 50.0 0 31982 ToddSmith 2-4 50.0 6 121983 ToddSmith 6 60.0 12 301984 ToddSmith 5 71.4 10 251985 ToddSmith 1 — 9 121986 CubShulund 4 44.4 25 371987 CubShulund 5 55.5 16 311988 KevinBuckner 10 71.4 20 501989 CarlosValdivia 9 56.3 11 381990 CarlosValdivia 4 50.0 10 221991 AkihiroKamada 6 85.7 10 282010 JonLee 7-8 87.5 14 352011 MosesVillareal-Gomez 6-10 60.0 17 35

PUNTINGYr. Player GP TP Yards Avg. Long1966 BillJones 9 55 1,958 35.6 —1967 MikeKenyon 9 39 1,245 31.9 —1968 MikeKenyon 8 64 2,072 32.4 —1969 MikeKenyon 8 43 1,483 34.5 —1970 SamSpicher 8 46 1.369 29.8 —1971 ChrisCard 9 58 1,893 31.7 —1972 ChrisCard 9 45 1,585 35.2 —1973 ChrisCard 9 47 1,586 33.7 —1974 StatsMissing1975 KenDahl 9 51 1,687 33.1 —1976 KenDahl 9 53 1,813 34.2 —1977 KenDahl 9 55 1,969 35.8 —1978 KenDahl 6 36 1,273 35.1 —1979 DonMcDowell 9 17 549 32.3 491980 GregBuckiewicz 9 42 1,223 29.1 —1981 TimOsiadacz 8 27 832 30.8 421982 CharlieLittle — 18 633 35.2 —1983 StatsMissing1984 ToddSmith 9 55 1,864 33.9 531985 ToddSmith 7 57 1,792 31.4 551986 JimSnowadski 9 44 1,621 36.8 601987 DerekDebbs 9 54 1,966 36.4 511988 Owens 6 33 1,023 31.0 481989 BrentNicolas 9 53 2,076 39.2 751990 BrentNicolas 8 61 2,203 36.1 531991 KurtNelson 9 58 1,862 32.1 502010 SpencerBell 9 41 1,420 34.6 502011 AaronKoford 9 48 1,599 33.3 52

PUNT RETURNSYr. Player GP No. Yards Avg. Long1966 StatsMissing1967 StatsMissing1968 DwightMcBride 6 2 39 19.5 —1969 ChadDebnam 8 5 83 16.6 —1970 RonStutzman 8 2 12 6.0 61971 StatsMissing1972 JimWills 9 12 106 8.8 —1973 JimWills 9 12 121 10.1 —1974 StatsMissing1975 MikeThomas* 9 6 131 21.8 —1976 StatsMissing1977 CalvinMyles 6 8 77 9.6 —1978 CalvinMyles 8 6 39 6.5 —1979 CalvinMyles 9 3 11 3.6 —1980 StacySmith 9 11 67 6.1 —1981 DrewValles 9 4 49 12.2 —1982 JeffKaihawalu — 3 18 6.0 —1983 WayneCarter 9 18 130 7.2 —1984 KevinFeist 9 9 50 5.6 161985 Miller 9 17 157 9.2 —1986 BrooksHoff 9 8 31 3.9 —1987 JeffPlatta 9 5 45 9.0 311988 DavidLorenz 9 8 57 7.1 101989 EricBramwell 8 17 155 9.1 211990 DaveCarroll 8 17 122 7.2 151991 ClaytonColliton 6 13 81 6.2 122010 JaysonFukumoto 9 5 19 3.8 112011 BrandonHarms 9 10 42 4.2 22*-ledNorthwestConference

KICKOFF RETURNSYr. Player GP No. Yards Avg. Long1966 StatsMissing1967 StatsMissing1968 StatsMissing1969 NickGitts 8 5 230 46.0 851970 TonyWarren* 8 6 189 31.5 —1971 StatsMissing1972 TonyWarren 9 11 223 20.3 —1973 JimWills 9 9 190 19.0 —1974 StatsMissing1975 IrvingSoto* 8 7 208 29.7 —1976 MarkBurt 9 7 170 24.3 —1977 CalvinMyles 6 11 241 21.9 —1978 KarryCameron 8 10 157 15.7 —1979 CalvinMyles* 9 24 520 21.6 —1980 RussBlunck 9 6 110 18.3 —1981 LynnSmith 9 20 290 14.5 —1982 JeffKaihawalu — 3 80 26.7 —1983 WayneCarter 9 15 332 22.1 —1984 WayneCarter 9 17 370 21.8 351985 Miller 9 28 500 17.9 —1986 ReedAken 8 8 226 32.2 —1987 SkipDailey 9 15 285 19.0 —1988 MartyKammerzell 9 22 407 18.5 271989 EricBramwell 8 11 238 21.6 651990 JoshWheeler 8 13 179 13.8 251991 RyanWilliams 7 24 425 17.7 252010 KelsonKawai 9 27 552 20.4 782011 CalebRoher 9 20 363 18.1 27*-ledNorthwestConference

GOBO

XERS

.COM


Individual Category LeadersRUSHINGRUSHING YARDSYr. Player Yards1952 FrankBuckiewicz,Sr. 1,0211953-1965 StatsMissing1966 EsChung 4361967 JimWeber 5111968 MarkKane 3061969 JayButz 7191970 DickAnderson 2561971 JayButz 8631972 JayButz 5611973 TomBeaver 3571974 StatsMissing1975 JohnBeal 4581976 MikeThomas 4501977 JohnBeal 5251978 RobDimick 2511979 GregBuckiewicz 2381980 DrewValles 3361981 DarrellJames 2611982 ThurmanRobbson 3021983 MikeConnor 5641984 MikeConnor 1,0721985 JohnOgden 5651986 JohnOgden 3531987 SkipDailey 3071988 AlNavarro 7461989 AlNavarro 8821990 AlNavarro 4911991 JoeSpanish 2722010 DavisJacobs 3092011 DavisJacobs 258

RUSHING ATTEMPTSYr. Player Att.1952 FrankBuckiewicz,Sr.1531953-1957 StatsMissing1958 EdNehring 2121959-1965 StatsMissing1966 EsChung 1361967 JimWeber 1721968 MarkKane 881969 JayButz 1591970 DickAnderson 711971 JayButz 1891972 JayButz 1631973 TomBeaver 931974 StatsMissing1975 JohnBeal 1061976 MikeThomas 1081977 JohnBeal 1231978 NeilStrachan 611979 GregBuckiewicz 601980 GregValles 1081981 JohnBrunelle 1141982 TimDurkin 1391983 MikeConnor 1391984 MikeConnor 2591985 JohnOgden 1381986 JohnOgden 1001987 SkipDailey 1031988 AlNavarro 1811989 AlNavarro 2141990 AlNavarro 1461991 JoeSpanish 842010 DavisJacobs 972011 DavisJacobs 102

RUSHING TOUCHDOWNSYr. Player TD1966 EsChung 71967 JimWeber 11968 BuckLorts 21969 JayButz 51970 DickAnderson 21971 JayButz 5 TonyWarren 51972 RalphNickerson 61973 TomBeaver 4 RalphNickerson 41974 StatsMissing

1975 MikeThomas 21976 DaveTengan 21977 JohnBeal 3 BillGarlington 31978 DrewValles 1 MarioChaves 11979 GregBuckiewicz 21980 GregBuckiewicz 21981 ThurmanRobbson 2 JohnBrunelle 21982 ToddElliott 21983 MikeConnor 71984 MikeConnor 101985 JohnOgden 31986 MikeShores 31987 SkipDailey 21988 AlNavarro 91989 AlNavarro 51990 AlNavarro 4 DanOswald 41991 DanOswald 2 RyanWilliams 22010 DavisJacobs 22011 BryceKershner 2

AVERAGE YARDS PER CARRY(Minimum 10 Attempts)Yr. Player Avg.1966 GlenHiga 3.91967 ClarenceNathaniel 4.01968 MaekKane 3.51969 ChadDebnam 4.71970 NickGitts 3.91971 JayButz 4.51972 NickGitts 4.81973 TomBeaver 3.81974 StatsMissing1975 JohnBeal 4.31976 MikeThomas 4.21977 JohnBeal 4.31978 RobDimick 4.71979 NeilStrachan 4.51980 RupertRobbins 4.91981 TimHolub 3.71982 DarrellJames 4.61983 WayneCarter 5.91984 WayneCarter 7.61985 JohnOgden 4.11986 ReedAken 4.11987 SkipDailey 2.91988 SkipDailey 5.31989 AlNavarro 4.11990 AlNavarro 3.41991 LynnHeath 4.82010 GuntherSchultze 3.72011 SeanValente 4.1

PASSINGPASS ATTEMPTSYr. Player Att.1960 BobLight 2301961-1965 StatsMissing1966 TerryRuff 511967 EsChung 711968 JuniorJohnson 901969 JuniorJohnson 1071970 JuniorJohnson 1391971 JuniorJohnson 1431972 RalphNickerson 1291973 RalphNickerson 2001974 StatsMissing1975 FrankBuckiewicz,Jr. 1871976 FrankBuckiewicz,Jr. 1311977 KenDahl 2621978 KenDahl 1751979 MarioChaves 2071980 GregBuckiewicz 1821981 JohnBrunelle 1451982 JohnBrunelle 661983 TimDurkin 1401984 RickCarpenter 1341985 BrentSmith 2791986 BrentSmith 290

1987 BrentSmith 4411988 D.J.Debbs 2261989 JohnHollie 3041990 DanOswald 2871991 DanOswald 2382010 T.C.Campbell 1802011 T.C.Campbell 219

PASS COMPLETIONSYr. Player Comp.1960 BobLight 1251961-1965 StatsMissing1966 TerryRuff 181967 EsChung 311968 JuniorJohnson 391969 JuniorJohnson 451970 JuniorJohnson 571971 JuniorJohnson 661972 RalphNickerson 761973 RalphNickerson 891974 StatsMissing1975 FrankBuckiewicz,Jr. 741976 FrankBuckiewicz,Jr. 771977 KenDahl 1231978 KenDahl 901979 MarioChaves 801980 GregBuckiewicz 771981 JohnBrunelle 551982 JohnBrunelle 301983 TimDurkin 501984 RickCarpenter 531985 BrentSmith 1181986 BrentSmith 1611987 BrentSmith 2331988 D.J.Debbs 1231989 JohnHollie 1331990 DanOswald 1381991 DanOswald 1092010 T.C.Campbell 1042011 T.C.Campbell 130

PASSING YARDSYr. Player Yds.1966 LesWong 2701967 EsChung 2791968 JuniorJohnson 3951969 JuniorJohnson 2931970 JuniorJohnson 8541971 JuniorJohnson 9861972 RalphNickerson 1,4141973 RalphNickerson 1,3861974 StatsMissing1975 FrankBuckiewicz,Jr. 7631976 FrankBuckiewicz,Jr. 9661977 KenDahl 1.5241978 KenDahl 1,1511979 MarioChaves 1,0811980 GregBuckiewicz 7591981 JohnBrunelle 8871982 JohnBrunelle 6291983 TimDurkin 6931984 RickCarpenter 7011985 BrentSmith 1,1681986 BrentSmith 1,9141987 BrentSmith 2,5641988 D.J.Debbs 1,5291989 JohnHollie 1,4591990 DanOswald 1,6961991 DanOswald 1,2502010 T.C.Campbell 1,2172011 T.C.Campbell 1,858

PASSING TOUCHDOWNSYr. Player TD1966 HowardDurand 2 LarryForsyth 21967 EsChung 11968 JuniorJohnson 41969 JuniorJohnson 1 ErnieChinen 1 JayButz 11970 JuniorJohnson 81971 JuniorJohnson 11

1972 RalphNickerson 161973 RalphNickerson 81974 StatsMissing1975 FrankBuckiewicz,Jr. 61976 FrankBuckiewicz,Jr. 51977 KenDahl 71978 KenDahl 51979 MarioChaves 71980 GregBuckiewicz 51981 JohnBrunelle 61982 TimDurkin 31983 TimDurkin 31984 RickCarpenter 71985 BrentSmith 71986 BrentSmith 181987 BrentSmith 221988 D.J.Debbs 101989 JohnHollie 61990 DanOswald 111991 DanOswald 42010 T.C.Campbell 112011 T.C.Campbell 13

PASSES HAD INTERCEPTEDYr. Player Int.1966 TerryRuff 81967 EsChung 91968 ErnestChinen 81969 JuniorJohnson 101970 JuniorJohnson 141971 JuniorJohnson 71972 RalphNickerson 71973 RalphNickerson 131974 StatsMissing1975 FrankBuckiewicz,Jr. 271976 FrankBuckiewicz,Jr. 161977 KenDahl 191978 KenDahl 191979 MarioChaves 151980 GregBuckiewicz 141981 JohnBrunelle 81982 JohnBrunelle 6 TimDurkin 61983 TimDurkin 121984 RickCarpenter 111985 BrentSmith 151986 BrentSmith 111987 BrentSmith 181988 D.J.Debbs 71989 JohnHollie 141990 DanOswald 91991 DanOswald 72010 T.C.Campbell 92011 T.C.Campbell 10

PASS COMPLETION PCT.(Minimum 100 Attempts)Yr. Player Pct.1966 LesWong 41.4*1967 EsChung 43.6*1968 JuniorJohnson 43.3*1969 JuniorJohnson 42.01970 JuniorJohnson 41.01971 JuniorJohnson 46.01972 RalphNickerson 58.81973 RalphNickerson 44.51974 StatsMissing1975 FrankBuckiewicz,Jr. 39.61976 FrankBuckiewicz,Jr. 58.81977 KenDahl 46.91978 KenDahl 51.71979 MarioChaves 38.61980 GregBuckiewicz 42.31981 JonhBrunelle 37.91982 JohnBrunelle 43.1*1983 TimDurkin 35.71984 RickCarpenter 39.51985 BrentSmith 42.21986 BrentSmith 55.51987 BrentSmith 52.81988 D.J.Debbs 54.4

Jay Butz

Calvin Myles

John Brunelle

1989 JohnHollie 43.81990 DanOswald 48.11991 DanOswald 45.82010 T.C.Campbell 57.82011 T.C.Campbell 59.4*-doesnotmeetminimum

PACI

FIC

Foot

ball


Individual Category LeadersPASSING YARDS PER GAME(Minimum 5 Games)Yr. Player Avg.1966 LesWong 44.61967 EsChung 40.01968 JuniorJohnson 56.41969 JuniorJohnson 36.61970 JuniorJohnson 106.71971 JuniorJohnson 109.61972 RalphNickerson 157.11973 RalphNickerson 173.31974 StatsMissing1975 FrankBuckiewicz,Jr.84.81976 FrankBuckiewicz,Jr. 138.01977 KenDahl 169.31978 KenDahl 191.81979 MarioChaves 120.11980 GregBuckiewicz 84.31981 JohnBrunelle 98.51982 JohnBrunelle 90.01983 TimDurkin 77.01984 RickCarpenter 100.11985 BrentSmith 129.81986 BrentSmith 212.61987 BrentSmith 284.91988 D.J.Debbs 169.91989 JohnHollie 162.11990 DanOswald 188.41991 DanOswald 138.92010 T.C.Campbell 135.22011 T.C.Campbell 206.4

RECEIVINGPASS RECEPTIONSYr. Player Rec.1960 BobWendel 631961-1965 StatsMissing1966 HowardDurand 181967 ClarenceNathaniel 181968 EdKameeunui 151969 ChadDebnam 311970 ChadDebnam 201971 BuckLorts 271972 JimWills 361973 JimWills 391974 StatsMissing1975 MikeBarber 151976 MikeBarber 351977 MikeBarber 541978 CalvinMyles 321979 CalvinMyles 441980 RussBlunck 381981 DrewValles 231982 ScottPerkins 221983 WayneCarter 101984 WayneCarter 261985 JohnOgden 31 BrianBergquist 311986 EricNicolai 561987 EricNicolai 601988 DavidLorenz 471989 CedricWalker 671990 MarkRahlwes 421991 TroyWalker 492010 JordanFukumoto 302011 JordanFukumoto 50

RECEIVING YARDSYr. Player Yds.1960 BobWendel 9571961-1965 StatsMissing1966 CraigPiennett 2661967 ClarenceNathaniel 1761968 EdKameeunui 2151969 ChadDebnam 2601970 BuckLorts 4441971 BuckLorts 5851972 JimWills 8821973 JimWills 7791974 StatsMissing1975 MikeThomas 2031976 MarkBurt 545

1977 MikeBarber 6881978 CalvinMyles 6031979 CalvinMyles 6381980 RussBlunck 3521981 DrewValles 5261982 ScottPerkins 3571983 KevinSchmidt 1701984 WayneCarter 4911985 DerekCropp 2661986 EricNicolai 8651987 EricNicolai 9011988 CedricWalker 6911989 CedricWalker 7591990 MarkRahlwes 5571991 TroyWalker 7212010 JordanFukumoto 6032011 JordanFukumoto 844

RECEIVING TOUCHDOWNSYr. Player TD1960 BobWendel 91961-1965 StatsMissing1966 CraigPiennett 21967 ClarenceNathaniel 1 DaveVanWinkle 1 BillSwanson 1 CraigPiennett 11968 DaveVanWinkle 21969 ChadDebnam 1 BuckLorts 11970 BuckLorts 51971 BuckLorts 51972 JimWills 101973 JimWills 4 GaryPope 41974 StatsMissing1975 MikeThomas 31976 MarkBurt 41977 MikeBarber 41978 GaryPotratz 41979 CalvinMyles 71980 RussBlunck 31981 TimOsiadacz 31982 ScottPerkins 31983 KevinSchmidt 21984 WayneCarter 81985 DerekCropp 51986 EricNicolai 111987 EricNicolai 101988 CedricWalker 81989 CedricWalker 51990 AaronFentress 41991 TroyWalker 22010 JordanFukumoto 62011 JordanFukumoto 8

YARDS PER RECEPTION(Minimum 20 Receptions)Yr. Player Avg.1960 BobWendel 15.11961-1965 StatsMissing1966 CraigPiennett 22.6*1967 ClarenceNathaniel 9.7*1968 DaveVanWinkle 15.4*1969 ChadDebnam 8.31970 BuckLorts 22.21971 BuckLorts 21.61972 JimWills 24.51973 JimWills 19.91974 StatsMissing1975 MikeBarber 25.0*1976 MarkBurt 17.51977 GaryPotratz 13.91978 GaryPotratz 24.41979 CalvinMyles 14.51980 ChrisOrtiz 10.01981 DrewValles 22.91982 ScottPerkins 16.21983 KevinSchmidt 18.9*1984 WayneCarter 18.81985 DerekCropp 15.61986 EricNicolai 15.41987 EricNicolai15.0

1988 CedricWalker 17.71989 AaronFentress 14.91990 AaronFentress 17.01991 TroyWalker 14.72010 JordanFukumoto 20.12011 JordanFukumoto 16.9*-doesnotmeetminimum

TOTAL OFFENSETOTAL OFFENSE YARDS(Plays-Rushing Yards)Yr. Player Yds.1966 EsChung 5161967 JimWeber 5351968 JuniorJohnson 3581969 JayButz 8081970 JuniorJohnson 7111971 JuniorJohnson 9861972 RalphNickerson 1,6961973 RalphNickerson 1,4971974 StatsMissing1975 FrankBuckiewicz,Jr. 7301976 FrankBuckiewicz,Jr. 1,0431977 KenDahl 1.4291978 KenDahl 1,0761979 MarioChaves 1,0231980 GregBuckiewicz 9621981 JohnBrunelle 9441982 JohnBrunelle 6251983 TimDurkin 1,0331984 RickCarpenter 5931985 BrentSmith 1,0781986 BrentSmith 2,0071987 BrentSmith 2,4331988 D.J.Debbs 1,3331989 JohnHollie 1,2861990 MarkRahlwes 1,8271991 TroyWalker 1,3362010 T.C.Campbell 1,0882011 T.C.Campbell 1,782

ALL-PURPOSEALL-PURPOSE YARDS(Rushing-Receiving-Returns)Yr. Player Yds.1966 EsChung 5161967 JimWeber 5381968 MarkKane 3061969 JayButz 7431970 BuckLorts 4541971 JayButz 8631972 JimWills 9641973 JimWills 1,0901974 StatsMissing1975 MikeThomas 3341976 MarkBurt 7151977 JohnBeal 5251978 CalvinMyles 7721979 CalvinMyles 1,2041980 RussBlunck 4621981 DrewValles 5751982 ThurmanRobbson 5591983 WayneCarter 6551984 MikeConnor 1,1141985 JohnOgden 8251986 EricNicolai 8651987 EricNicolai 9011988 AlNavarro 8941989 AlNavarro 9131990 MarkRahlwes 5571991 TroyWalker 7332010 KelsonKawai 7162011 JordanFukumoto 861

SCORINGTOUCHDOWNS SCOREDYr. Player TD1952 FrankBuckiewicz,Sr. 131953-1965 StatsMissing1966 EsChung 81967 ClarenceNathaniel 21968 BuckLorts 2

DaveVanWinkle 21969 JayButz 51970 BuckLorts 51971 TonyWarren 61972 JimWills 101973 TomBeaver 51974 StatsMissing1975 MikeThomas 31976 MarkBurt 61977 JohnBeal 51978 DrewValles 41979 CalvinMyles 71980 RussBlunck 31981 TimOsiadacz 31982 ScottPerkins 31983 MikeConnor 71984 MikeConnor 101985 DerekCropp 51986 EricNicolai 111987 EricNicolai 101988 AlNavarro 91989 CedricWalker 61990 AlNavarro 51991 RyanWilliams 32010 JordanFukumoto 62011 JordanFukumoto 8

POINTS SCOREDYr. Player Pts.1952 FrankBuckiewicz,Sr. 901953-1965 StatsMissing1966 EsChung 481967 ClarenceNathaniel 121968 BuckLorts 211969 JayButz 301970 BuckLorts 511971 BuckLorts 611972 JimWills 601973 TomBeaver 301974 StatsMissing1975 FrankBuckiewicz,Jr. 211976 MarkBurt 381977 JohnBeal 301978 DrewValles 261979 CalvinMyles 421980 RussBlunck 181981 TimOsiadacz 181982 ScottPerkins 181983 MikeConnor 421984 MikeConnor 601985 DerekCropp 301986 EricNicolai 661987 EricNicolai 601988 AlNavarro 541989 CarlosValdivia 381990 AlNavarro 301991 AkihiroKamada 282010 JordanFukumoto 362011 JordanFukumoto 48

P.A.T. KICKS MADEYr. Player PAT1966 HowardDurand 161967 StatsMissing1968 BuckLorts 61969 BuckLorts 121970 BuckLorts 121971 BuckLorts 191972 DonKyle 181973 FrankBuckiewicz,Jr. 131974-1977 StatsMissing1978 WillieBrosseau 151979 WillieBrosseau 91980 MikHendrickson 61981 None1982 ToddSmith 61983 ToddSmith 121984 ToddSmith 101985 ToddSmith 91986 CubShulund 251987 CubShulund 161988 KevinBuckner 201989 CarlosValdivia 11

Karry Cameron

Lawrence Owen

Mark Rawhles

Russ Blunck

GOBO

XERS

.COM


Individual Category Leaders1990 CarlosValdivia 101991 AkihiroKamada 102010 JonLee 142011 M.Villareal-Gomez 17

FIELD GOALS MADEYr. Player FG1960 BobWendel 41961-1969 StatsMissing1970 BuckLorts 31971 BuckLorts 41972-1975 StatsMissing1976 WillieBrosseau 51977 StatsMissing1978 WillieBrosseau 31979 WillieBrosseau 21980 MikHendrickson 11981 EdRitt 11982 ToddSmith 21983 ToddSmith 61984 ToddSmith 51985 ToddSmith 1 CubShulund 11986 CubShulund 41987 CubShulund 51988 KevinBuckner 101989 CarlosValdivia 91990 CarlosValdivia 41991 AkihiroKamada 62010 JonLee 72011 M.Villareal-Gomez 6

FIELD GOALS ATTEMPTEDYr. Player Att.StatsMissingPriorTo19781978 WillieBrosseau 41979 WillieBrosseau 31980 GregBuckiewicz 3 MikHendrickson 31981 EdRitt 21982 ToddSmith 41983 ToddSmith 101984 ToddSmith 71985 StatsMissing1986 CubShulund 91987 CubShulund 91988 KevinBuckner 101989 CarlosValdivia 161990 CarlosValdivia 81991 AkihiroKamada 72010 JonLee 82011 M.Villareal-Gomez 10

FIELD GOAL ACCURACYYr. Player Pct.StatsMissingPriorTo19781978 WillieBrousseau 75.01979 WillieBrosseau 66.71980 MikHendrickson 33.31981 EdRitt 50.01982 ToddSmith 50.01983 ToddSmith 60.01984 ToddSmith 71.41985 StatsMissing1986 CubShulund 44.41987 CubShulund 55.51988 KevinBuckner 95.21989 CarlosValdivia 56.31990 CarlosValdivia 50.01991 AkihiroKamada 85.72010 JonLee 87.52011 M.Villareal-Gomez 60.0

PUNTINGPUNTING YARDSYr. Player Yds.1966 BillJones 1,9581967 MikeKenyon 1,2451968 MikeKenyon 2,0721969 MikeKenyon 1,4831970 SamSpicher 1,3691971 ChrisCard 1,8931972 ChrisCard 1,585

1973 ChrisCard 1,5861974 StatsMissing1975 KenDahl 1,6871976 KenDahl 1,8131977 KenDahl 1,9691978 KenDahl 1,2731979 MarioChaves 6721980 GregBuckiewicz 1,2231981 CharlieLittle 9551982 ToddSmith 1,1111983 StatsMissing1984 ToddSmith 1,8641985 ToddSmith 1,7921986 JimSnowadski 1,6211987 DerekDebbs 1,9661988 Owens 1,0231989 BrentNicolas 2,0761990 BrentNicolas 2,2031991 KurtNelson 1,8622010 SpencerBell 1,4202011 AaronKoford 1,599

PUNT ATTEMPTSYr. Player Att.1966 BillJones 551967 MikeKenyon 391968 MikeKenyon 641969 MikeKenyon 431970 SamSpicher 461971 ChrisCard 581972 ChrisCard 451973 ChrisCard 471974 StatsMissing1975 KenDahl 511976 KenDahl 531977 KenDahl 551978 KenDahl 361979 MarioChaves 221980 GregBuckiewicz 421981 CharlieLittle 331982 ToddSmith 371983 StatsMissing1984 ToddSmith 551985 ToddSmith 571986 JimSnowadski 441987 DerekDebbs 541988 Owens 331989 BrentNicolas 531990 BrentNicolas 611991 KurtNelson 582010 SpencerBell 412011 AaronKoford 48

PUNTING AVERAGEYr. Player Avg.1966 BillJones 35.61967 JimWeber 42.21968 MikeKenyon 32.41969 MikeKenyon 34.51970 SamSpicher 29.81971 ChrisCard 31.71972 ChrisCard 35.21973 ChrisCard 33.71974 StatsMissing1975 KenDahl 33.11976 KenDahl 34.21977 KenDahl 35.81978 MarioChaves 40.01979 DonMcDowell 32.31980 GregBuckiewicz 29.11981 TimOsiadacz 34.31982 CharlieLittle 35.21983 StatsMissing1984 ToddSmith 33.91985 ToddSmith 31.41986 JimSnowadski 36.81987 DerekDebbs 36.41988 D.J.Debbs 37.61989 BrentNicolas 39.21990 BrentNicolas 36.11991 KurtNelson 32.12010 SpencerBell 34.62011 AaronKoford 33.3

PUNT RETURNSPUNT RETURN YARDSYr. Player Avg.1966 StatsMissing1967 StatsMissing1968 DwightMcBride 391969 ChadDebnam 831970 RonStutzman 121971 StatsMissing1972 JimWills 821973 JimWills 1211974 StatsMissing1975 MikeThomas 1311976 StatsMissing1977 CalvinMyles 771978 CalvinMyles 391979 CalvinMyles 111980 StacySmith 1861981 DrewValles 491982 JeffKaihawalu 181983 WayneCarter 1301984 KevinFeist 501985 Miller 1571986 BrooksHoff 311987 JeffPlatta 451988 DavidLorenz 571989 EricBramwell 1551990 DaveCarroll 1221991 ClaytonColliton 812010 JaysonFukumoto 192011 BrandonHarms 42

PUNT RETURNSYr. Player Ret.1966 StatsMissing1967 StatsMissing1968 DwightMcBride 21969 ChadDebnam 51970 BillMikesell 51971 StatsMissing1972 TonyWarren 111973 JimWills 121974 StatsMissing1975 MikeThomas 61976 StatsMissing1977 CalvinMyles 81978 KarryCameron 81979 KarryCameron 41980 StacySmith 111981 DrewValles 41982 JeffKailawalu 31983 WayneCarter 181984 WayneCarter 101985 Miller 171986 BrooksHoff 81987 JeffPlatta 51988 DavidLorenz 81989 EricBramwell 171990 DaveCarroll 171991 ClaytonColliton 132010 JaysonFukumoto 52011 BrandonHarms 10

PUNT RETURN AVERAGE(Minimum 10 Attempts)Yr. Player Avg.1960 RobOsborn 28.3*1961-1967 StatsMissing1968 DwightMcBride 19.5*1969 ChadDebnam 16.6*1970 RonStutzman 6.0*1971 StatsMissing1972 JimWills 8.21973 JimWills 10.11974 StatsMissing1975 MikeThomas 21.8*1976 StatsMissing1977 CalvinMyles 9.61978 CalvinMyles 6.51979 CalvinMyles 3.6*1980 StacySmith 6.11981 DrewValles 13.01982 JeffKailawalu 6.0

1983 WayneCarter 7.21984 WayneCarter 3.91985 Miller 9.21986 BrooksHoff 3.9*1987 JeffPlatta 9.0*1988 DavidLorenz 7.11989 EricBramwell 9.11990 DaveCarroll 7.21991 ClaytonColliton 6.22010 JaysonFukumoto 3.8*2011 BrandonHarms 4.2*-Doesnotmeetminimum

KICKOFF RETURNSKICKOFF RETURN YARDSYr. Player Yds.StatsMissingPriorTo19691969 NickGitts 2301970 BillMikesell 3321971 StatsMissing1972 TonyWarren 2231973 JimWills 1901974 StatsMissing1975 MikeBoshers 3791976 MarkBurt 1701977 CalvinMyles 2411978 KarryCameron 1571979 CalvinMyles 5201980 RussBlunck 1101981 LynnSmith 2901982 ThurmanRobbson 2021983 WayneCarter 3321984 WayneCarter 3701985 Miller 5001986 BrooksHoff 5841987 SkipDailey 2851988 MartyKammerzell 4071989 EricBramwell 2381990 JoshWheeler 1791991 RyanWilliams 4252010 KelsonKawai 5522011 CalebRoher 363

KICKOFF RETURNSYr. Player Ret.StatsMissingPriorTo19691969 NickGitts 5 GlenHiga 51970 BillMikesell 151971 StatsMissing1972 TonyWarren 111973 JimWills 9 TonyWarren 91974 StatsMissing1975 MikeBoshers 171976 MarkBurt 71977 CalvinMyles 111978 CalvinMyles 101979 CalvinMyles 241980 StacySmith 241981 LynnSmith 201982 ThurmanRobbson 161983 WayneCarter 151984 WayneCarter 171985 Miller 281986 BrooksHoff 281987 SkipDailey 15 TroyTyler 151988 MartyKammerzell 221989 KevinRobbins 161990 JoshWheeler 131991 RyanWilliams 242010 KelsonKawai 272011 CalebRoher 20

KICKOFF RETURN AVERAGE(Minimum 5 Attempts)Yr. Player Avg.StatsMissingPriorTo19691969 NickGitts 46.01970 TonyWarren 31.51971 StatsMissing1972 TonyWarren 20.3

1973 JimWills 19.01974 StatsMissing1975 IrvingSoto 29.71976 MarkBurt 24.31977 CalvinMyles 21.91978 KarryCameron 15.71979 CalvinMyles 21.61980 StacySmith 15.71981 LynnSmith 14.51982 ToddElliott 19.51983 WayneCarter 22.11984 WayneCarter 21.81985 Kim 24.31986 ReedAken 32.21987 SkipDailey 19.01988 MartyKammerzell 18.51989 EricBramwell 29.81990 ScottShimabukuro 16.61991 RyanWilliams 17.72010 SeanValente 20.52011 DevenMcKinney 19.9

PACI

FIC

Foot

ball


Yearly Category LeadersTACKLESTOTAL TACKLESYr. Player Tackles1969 TomWeeks 761980 DeanKline 68.51981 ReedOlaso 86.51982 MikeBrandolino 91.51983 BillConnor 861984 StatsMissing1985 RichVidinha 1101986 JeffPlatta 841987 JeffPlatta 861988 BillBlevins 571989 DaveCarroll 1131990 TimSmith 951991 ErikUtter 742010BryanMills 372011BryanMills 62UNASSISTED TACKLESYr. Player Tackles1980 DeanKline 581981 ReedOlaso 641982 MikeBrandolino 791983 GreggRietmann 471984 StatsMissing1985 RichVidinha 751986 JeffPlatta 591987 JeffPlatta 611988 BillBlevins 471989 DaveCarroll 901990 DaveCarroll 651991 ErikUtter 472010 BryanMills 282011 BryanMills 35

ASSISTED TACKLESYr. Player Tackles1969 TomWeeks 931980 ReedOlaso 281981 ReedOlaso 451982 ReedOlaso 381983 BillConnor 391984 StatsMissing1985 RichVidinha 351986 BillBlevins 311987 JeffPlatta 251988 KurtHanson 141989 DaveCarroll 231990 TimSmith 331991 ErikUtter 272010 BryanMills 182011 TimHastie 29

TACKLES FOR LOSSYr. Player Tackles1982 MikeBrandolino 12 1983 MikeBrandolino 141984 StatsMissing1985 StatsMissing1986 GerryPesavento 71987 KirkSwoboda 91988 JeffBrown 71989 CharltonMoananu 101990 NofoLilo 91991 SteveBrenner 62010 JoshBeck 5.52011 TimHastie 6.5 LandonAano 6.5

QUARTERBACK SACKSYr. Player Sacks1980 FredReisinger 91981 BradVerigan 21982 MikeBrandolino 7.51983 MikeBrandolino 91984 StatsMissing1985 Swan 3 Victor 31986 GerryPesavento 61987 KirkSwoboda 81988 JeffBrown 101989 CharltonMoaneau 12

1990 CharltonMoananu 111991 SeanSatterfield 2 ZachBell 22010 LandonAano 22011 LandonAano 3

INTERCEPTIONSINTERCEPTION RETURN YARDSYr. Player Yds.1966 StatsMissing1967 MikeKenyon 701968 StatsMissing1969 MikeWilliams 861970 BillMikesell 591971 StatsMissing1972 LloydLittle 411973 LloydLittle 501974 StatsMissing1975 DannyBayne 131976 MikeAsuncion 521977 GaryMorris 691978 GaryMorris 631979 KarryCameron 841980 StacySmith 501981 RobertRothschild 1021982 JeffPaul 431983 BartHendrix 921984 KevinFeist 291985-1988 StatsMissing1989 AlanSagon 631990 CharltonMoananu 191991 DanRudometkin 102010 BryanMills 872011 BryanMills 40

INTERCEPTIONSYr. Player Int.1966 StatsMissing1967 MikeKenyon 51968 TimArmbruster 41969 TimArmbruster 71970 BillMikesell 3 JimWestendorf 31971 StatsMissing1972 LloydLittle 61973 LloydLittle 9*1974 StatsMissing1975 MikeAsuncion 41976 MikeAsuncion 41977 GaryMorris 4 MikeAsuncion 41978 GaryMorris 4 KevinGramsen 41979 KarryCameron 4 DeanKline 41980 StacySmith 61981 RobertRothschild 41982 JeffPaul 2 FranshotJohnson 21983 KevinFeist 41984 KevinFeist 71985 Hauck 4 Kim 41986 BillBlevins 71987 BillBlevins 71988 BillBlevins 71989 BrianSherrard 6 DaveCarroll 61990 DaveCarroll 2 ReidHellbusch 21991 MickeyGlaze 32010 BryanMills 32011 BryanMills 1 TimHastie 1 DevinLagorio 1 CraigBailey 1 SamBettencourt 1*-ledNorthwestConference

Ernie Nihi

An ad from the Medford (Ore.) Mail Tribune promoting the 1951 Pear Bowl against U.C. Davis.

GOBO

XERS

.COM


Honor Roll

First Team All-Northwest Conference1926 RobertPollock E WilliamRannow T CarlJohnson FB1927 RobertPollock T1928 RobertPollock T GilbertOddie1929 Tuor G ArtBrachman PeteMiller1930 LaurelFrost RE RussellAchinson RH1931 ArtBrachman LT AlWeinal RH Critchfield FB1932 ArtBrachman LT AlWeinal LH ClemParberry EldonCone1933 LorenDouglas C1934 ClemParberry E SamNixon G JimCorrigan HB1935 Fossati RG TilpherBarstad RT JimCorrigan FB1936 TilpherBarstad T1937 JimWiles LG OscarGiesecke RE EdGilman LH1938 JimWiles E GeorgeRacette E HarveyRoloff T Amend T LewisMerz G EdGilman RB HowardHorner FB1939 ErnieNaef G LenGilman FB1940 DonBryant LG LenGilman FB1941 MaitlandAnderson C GeorgeRisk B1946 ArnoldThorgerson E BillDahlgren G MaitlandAnderson C1947 ArnoldThorgerson E StanRussell HB1948 ArnoldThorgerson E BillMaggette T StanRussell B1949 BobMaggette T LeRoyGamble G JohnJubb C StanRussell B1950 EdRooney E JimHudson T

PaulHutton LB DaleKlaumann HB1951 FrankBuckiewicz B AlGoertzen B GeneLukozsky E DannyHess T JoeKauwaii G JohnZavodsky G GlennZeller LB MarvinBibler HB1952 RonHaworth G FrankBuckiewicz B/S AlGoertzen B DanHess T BobSandgren MG TinkerHatfield HB1954 JerryMillis HB1955 JerryAdams C1957 TomThompson DuaneBaker VinceHeinrich1958 JackNehring HB TomThompson MG ChuckPeterson LB1959 BillHughes E BobBurnside FB BobWendell E ChuckPeterson LB1960 BobWendell E BobLight QB DaveWoodford B1961 BobWendell E DickLawrence LB1962 DickLawrence HB1963 ClairFoley T1

RayAmstadt FB1

1964 DickWeise QB MikeCalvert FB DickDaniels B1965 JonElston HB CharlesChapman T DickDaniels B1966 CharlesChapman T1967 GaleBarcroft HB1970 JimWestendorf B1971 BobWells T DougHorner C ScottWatters E JimWestendorf B1972 JimWillis E LarryCrowley T RalphNickerson QB JayButz RB TerryWoebke E SteveSherrill T ElmerGroener MG ArtKalahiki LB JimWestendorf B

1973 JimWillis E GaryPope E RalphNickerson QB ElmerGroener MG LloydLittle B1978 RickAnderson G BillCarlington L KarryCameron B1979 CalvinMyles R1981 MarkSchneider IL1982 ForrestBarnes G DarrelJames RB EdRitt T MikeBrandolino NG1983 ForrestBarnes G MikeConnor TB MikeBrandolino NG EdRitt T BillConnor LB WayneCarter CB1984 WayneCarter R ForrestBarnes G MikeConnor RB/LB ToddSmith K KevinFeist CB BillConnor,Jr. LB2011 JordanFukumoto WR

First Team All-Columbia Football Association1985 RichardVidinha LB JeffOgden RB JimSwann DE1986 BillBlevins DB EricNicolai WR GaryPesavento DL RichardVidinha LB BrianFleskes C1987 BillBlevins DB MarkKaanapu OL EricNicolai WR GaryPesavento DL JeffPlatta DB BrentSmith QB1988 BillBlevins DB MarkKaanapu OL JeffBrown DL DaveLorenz WR1989 ErnieNihi OL DavidCarroll DB CharltonMoananu DL JonEdmonds OL AlNavarro RB BrentNicolas P CarlosValdivia K CedricWalter WR1990 ErnieNihi OL DavidCarroll DB CharltonMoananu DL

TreyMott LB1991 ErnieNihi OL TroyWalker WR

First Team Little All-Northwest (Associated Press)1953 RonHaworth G1958 TomThompson G

First Team Little All-Northwest(NW Collegiate Sports Service)1971 DougHorner C1972 KenAlbus G TerryWoebke E SteveSherrill IL1983 MikeBrandolino G1984 MikeConnor RB KevinFeist B1987 EricNicolai WR BillBlevins FS1988 BillBlevins FS1989 CedricWalker WR1990 ErnieNihi OL NofoLino DL1991 ErnieNihi OL

NOTE: LittleAll-NorthwestselectedbytheAssociatedPresspriorto1968andbyJackSareault’sNorthwestCollegiateSportsServicefrom1968-2001.Teamdiscontinuedafterthe2001season.

Associated Press Little All-America Team1952 FrankBuckiewicz 2ndTeam1958 TomThompson 2ndTeam

NAIA All-American1983 EdRitt(DL) 2ndTeam1987 EricNicolai(WR) 2ndTeam1990 DavidCarroll(DB) ErnieNihi(OL)

Little All-Northwest Coach of the Year1972 FrankBuckiewicz

Columbia Football AssociationMt. Hood League Coach of the Year1987 BillGriffin

Sources: NorthwestConferencearchives(withappreciationtothelateJackSareault);BobGuptill(formerColumbiaFootballAssociationinformationdirector),pastPacificpressreleases.

Len Gilman Bob Light Joe Kauwaii Forrest Barnes

PACI

FIC

Foot

ball


Year-By-Year Results

Coaching RecordsChronological1892-1898 Burt Powell 10-2-31899 Arthur Arlett 3-1-01900 Mr. Wilcox 3-2-11901-1903 T.L. McFadden 5-12-41904 W.C. Magee 4-3-01905 Mr. Shannon 0-3-01906 Mr. Coon 1-2-11907-1908 Archie Hahn 5-6-01909 H.I. Sherman 2-2-31910 Dan Conville 3-2-01911 Paul Lynch 3-2-01912 Dudley Clark 0-3-01913-1915 Ralph Yakel 8-3-01916 William Handlin 2-3-01919 Jessie Day 2-4-01920 Leon Strong 0-3-1 Richard Abraham 1-1-01921-1929 Leon Frank 29-30-41930-1933 Eldon Jenne 18-13-31934-1935 Anson Cornell 6-6-51936-1942 Roger Folgate 21-24-71946 Ozzie Gates 4-3-11947-1960 Paul Stagg 63-51-61961-1964 Noah Allen 8-26-01965-1980 Frank Buckiewicz, Sr. 40-98-21981-1984 Bill Connor 8-27-11985-1989 Bill Griffin 14-27-11990-1991 Bill Singler 3-14-12010-Present Keith Buckley 1-17-0

By Victories1947-1960 Paul Stagg 63-51-61965-1980 Frank Buckiewicz, Sr. 40-98-21921-1929 Leon Frank 29-30-41936-1942 Roger Folgate 21-24-71930-1933 Eldon Jenne 18-13-31985-1989 Bill Griffin 14-27-11892-1898 Burt Powell 10-2-31913-1915 Ralph Yakel 8-3-01961-1964 Noah Allen 8-26-01981-1984 Bill Connor 8-27-11934-1935 Anson Cornell 6-6-51901-1903 T.L. McFadden 5-12-41904 W.C. Magee 4-3-01946 Ozzie Gates 4-3-11899 Arthur Arlett 3-1-01900 Mr. Wilcox 3-2-11910 Dan Conville 3-2-01911 Paul Lynch 3-2-01990-1991 Bill Singler 3-14-11909 H.I. Sherman 2-2-31916 William Handlin 2-3-01919 Jessie Day 2-4-01906 Mr. Coon 1-2-11920 Richard Abraham 1-1-02010-Present Keith Buckley 1-17-01905 Mr. Shannon 0-3-01912 Dudley Clark 0-3-01920 Leon Strong 0-3-1

BURT POWELL 1892-1898 10-2-3

1892 1-1PAC OPP18 BishopScott’s 66 MultnomahAC 16

1893 1-0PAC OPP28 WesternOregon 0

1894 2-1-1PAC OPP60 GeorgeFox 04 Portland 828 WesternOregon 60 Oregon 0

1895 0-0-1 PAC OPP0 OregonState 0

1896 2-0-0PAC OPP12 HolmesBus.College 010 OregonNat’lGuard 6

1897 RECORDSLOST

1898 4-0-1PAC OPP6 PortlandYMCA 513 Portland 02 Linfield 02 GeorgeFox 05 OregonState 5

ARTHUR ARLETT 1899 3-1-0

1899 3-1PAC OPP OPP5 BishopScott’s 036 PortlandHS 028 Linfield 00 Willamette 24

MR. WILCOX 1900 3-2-1

1900 3-2-1PAC OPP0 PortlandHS 110 PortlandAcademy 00 MultnomahAC 623 GeorgeFox 021 PortlandDental 05 PortlandDental 0

T.L. McFADDEN 1901-1903 5-12-4

1901 3-5PAC OPP6 PortlandAcademy 1012 Chemawa 160 MultnomahAC 60 MultnomahAC 3417 OregonState 016 OregonMed.School 029 HillMilitaryAcad. 00 Oregon 10

1902 1-4-1PAC OPP0 PortlandAcademy 60 Whitman 280 OregonMed.School 016 Linfield 00 Oregon 700 OregonState 31

1903 1-3-3PAC OPP14 HillMilitaryAcad. 00 PortlandAcademy 05 Portland 110 Linfield 390 OregonState 00 Willamette 00 LewisandClark 17

W.C. MAGEE 1904 4-3-0

1904 4-3PAC OPP17 HillMilitaryAcad. 516 Portland 016 OregonMed.School 00 LewisandClark 185 Chemawa 100 Willamette 3812 PortlandYMCA 0

MR. SHANNON 1905 0-3-0

1905 0-3PAC OPP0 HillMilitaryAcad. 50 ForestGroveAC 140 GeorgeFox 5

MR. COON 1906 1-2-1

1906 1-2-1PAC OPP0 HillMilitaryAcad. 00 Portland 100 OregonState 2830 GeorgeFox 0

ARCHIE HAHN 1907-1908 5-6-0

1907 3-3PAC OPP0 PortlandHS 612 PortlandAcademy 00 Oregon 520 OregonState 495 LewisandClark 015 LewisandClark 0

1908 2-3PAC OPP20 PortlandAcademy 00 LewisandClark 50 PortlandAcademy 44 Willamette 04 Chemawa 21

H.I. SHERMAN 1909 2-2-3

1909 2-3PAC OPP20 PortlandAcademy 00 OregonState 216 HillMilitaryAcad. 50 LincolnHS 00 PortlandCYO 00 Chemawa 00 Willamette 8

DAN COLVILLE 1910 3-2-0

1910 3-2PAC OPP8 PortlandAcademy 011 HillMilitaryAcad. 1221 Whitworth 031 MountAngelSem. 00 Willamette 12

PAUL LYNCH 1911 3-2-0

1911 3-2PAC OPP2 Washington 329 MountAngelSem. 633 Chemawa 00 PugetSound 620 OregonState 0

DUDLEY CLARK 1912 0-3-0

1912 0-3PAC OPP0 WashingtonHS 210 Willamette 406 Chemawa 20

GOBO

XERS

.COM


Year-By-Year Results

RALPH YAKEL 1913-1915 8-3-0

1913 3-1PAC OPP6 Willamette 6112 GeorgeFox 020 Lewis&Clark 197 Chemawa 6

1914 3-0PAC OPP61 Lewis&Clark 021 GeorgeFox 047 GeorgeFox 0

1915 2-2PAC OPP0 Oregon 4727 MountAngelSem. 77 Lewis&Clark 67 Willamette 13

WILLIAM HANDLIN 1916 2-3-0

1916 2-3PAC OPP0 MultnomahAC 60 VancouverAC 1414 MountAngelSem. 136 Chemawa 07 Willamette 25

1917-1918No Team – World War I

JESSIE DAY 1919 2-4-0

1919 2-4PAC OPP21 Chemawa 06 OregonState 470 MultnomahAC 200 Willamette 1213 Reed 06 OregonSt.Frosh 28

LEON STRONG 1920 0-3-1

RICHARD ABRAHAM 1920 1-1-0

1920 1-4-1PAC OPP0 OregonSt.Frosh 07 OregonFrosh 240 PugetSound 07 Willamette 230 Chemawa 9040 Reed 0

LEO FRANK 1921-1929 29-30-4

1921 5-1PAC OPP20 MountAngelSem. 67 Oregon 2128 Lewis&Clark 727 PugetSound 1414 Chemawa 0

1922 4-2PAC OPP0 Oregon 270 OregonState 371 MountAngelSem. 07 CollegeofIdaho 627 PugetSound 020 Willamette 6

1923 5-2PAC OPP0 OregonState 120 WashingtonState 19118 GeoegeFox 032 CollegeofIdaho 013 PugetSound 018 Willamette 06 Montana 0

1924 3-3PAC OPP0 WashingtonState 600 Oregon 2020 CollegeofIdaho 147 PugetSound 617 Montana 6126 Willamette 0

1925 3-5-1PAC OPP7 Portland 70 MultnomahAC 320 Oregon 137 CollegeofIdaho 1625 PugetSound 566 Linfield 023 Willamette 06 Whitman 13

1926 2-2-22-2-1 NWC 5thPAC OPP0 Oregon 07 Linfield 09 Whitman 96 Willamette 100 CollegeofIdaho 915 PugetSound 0

1927 1-5-10-4-1 NWC 6thPAC OPP6 Oregon 326 CollegeofIdaho 1350 Lewis&Clark 07 Whitman 180 Linfield 07 Willamette 137 PugetSound 13

1928 2-62-3 NWC 5thPAC OPP0 Oregon 320 Washington 420 OregonState 467 CollegeofIdaho 2820 Linfield 00 Whitman 44

6 Willamette 00 PugetSound 14

1929 4-42-3 NWC 4th PAC OPP0 Oregon 5819 Portland 714 Lewis&Clark 1220 Linfield 013 PugetSound 120 Willamette 2512 CollegeofIdaho 1326 Whitman 39

ELDON JENNE 1930-1933 18-13-3

1930 5-4-12-1-1 NWC 3rdPAC OPP6 CommerceHS 00 Oregon 2013 WesternOregon 76 Portland 1312 Linfield 062 Lewis&Clark 00 OregonState 570 Whitman 06 PugetSound 06 Willamette 34

1931 5-23-2-0 NWC Tie 2ndPAC OPP18 Linfield 612 Portland 728 CollegeofIdaho 713 Whitman 207 Willamette 620 Lewis&Clark 06 PugetSound 25

1932 4-3-23-2 NWC Tie 3rdPAC OPP6 St.John’sBachelor 66 Oregon 2612 Portland 126 PugetSound 130 Whitman 1419 Linfield 718 Lewis&Clark 76 Willamette 20 SouthernOregon 20

1933 4-43-1-1 NWC 3rdPAC OPP7 Portland 00 Linfield 187 Lewis&Clark 014 Whitman 120 Willamette 613 CollegeofIdaho 60 PugetSound 210 SouthernOregon 19

ANSON CORNELL 1934-1935 6-6-5

1934 4-2-33-1-1 NWC 3rdPAC OPP7 SouthernOregon 07 OregonState 1913 Linfield 0

0 WesternOregon 028 Whitman 713 Portland 137 PugetSound 70 Willamette 3427 LewisandClark 6

1935 2-4-21-3-2 NWC 6thPAC OPP6 SouthernOregon 07 Portland 130 Linfield 06 Whitman 137 Lewis&Clark 70 CollegeofIdaho 130 Willamette 136 PugetSound 0

ROGER FOLGATE 1936-1942 21-24-7

1936 4-41-5 NWC 6thPAC OPP20 FortLewis 721 Linfield 619 Whitman 66 PugetSound 277 CollegeofIdaho 1420 Lewis&Clark 00 Willamette 190 Portland 14

1937 4-3-13-1-1 NWC 2ndPAC OPP0 WesternOregon 60 Portland 367 CollegeofIdaho 70 Willamette 624 Whitman 720 VancouverBarracks 019 Lewis&Clark 020 PugetSound 6

1938 4-34-1-1 NWC Tie 1stNWC CO-CHAMPIONSPAC OPP6 Portland 2621 PugetSound 013 Linfield 00 SanJoseCC 397 CollegeofIdaho 146 Willamette 013 Whitman 6

1939 3-2-23-0-2 NWC 1stNWC CHAMPIONSPAC OPP13 PacificLutheran 146 Linfield 00 W.Washington 1913 PugetSound 014 Whitman 013 CollegeofIdaho 130 Willamette 0

1940 2-4-22-1-2 NWC 3rdPAC OPP6 PacificLutheran 266 Portland 256 CollegeofIdaho 613 Linfield 013 Whitman 00 PugetSound 0

0 W.Washington 06 Willamette 20

1941 4-42-3-0 NWC Tie 3rdPAC OPP7 Portland 3018 PortlandAirBase 014 CollegeofIdaho 277 Linfield 69 Whitman 1613 PugetSound 00 Willamette 4020 St.Martin’s 19

1942 0-4-20-3-2 NWC 4thPAC OPP0 Portland 266 St.Martin’s 350 Linfield 014 Whitman 260 CollegeofIdaho 00 Willamette 31

1943-1945No Team – World War II

OZZIE GATES 1946 4-3-1

1946 4-3-13-3-0 NWC 5thPAC OPP7 EverettJC 06 Whitman 00 PugetSound 330 Lewis&Clark 09 Linfield 06 CollegeofIdaho 210 Willamette 631 BritishColumbia 0

PAUL STAGG 1947-1960 63-51-6

1947 6-25-2 NWC 2ndPAC OPP13 LewisandClark 048 PortlandState 025 Whitman 76 Linfield 720 CollegeofIdaho 00 Willamette 2020 UofBritishColumbia 1915 UofPugetSound 6

1948 5-3-15-2 NWC 2ndPAC OPP33 BritishColumbia 00 Montana 270 Whitman 028 Linfield 1414 CollegeofIdaho 2040 OregonTech 00 SouthernOregon 1441 LewisandClark 019 Willamette 0

PACI

FIC

Foot

ball


Year-By-Year Results1949 8-1-14-1-1 NWC Tie 1stNWC CO-CHAMPIONSPAC OPP20 PacificLutheran 2033 W.Washington 1325 Linfield 033 Whitman 2733 ChicoState 034 BritishColumbia 06 Lewis&Clark 1348 CollegeofIdaho 032 Willamette 733 UCDavis* 15*-PearBowlatMedford,Ore.

1950 7-23-2 NWC Tie 2ndPAC OPP12 W.Washington 612 WesternOregon 614 ChicoState 613 CollegeofIdaho 60 Lewis&Clark 2419 Whitman 70 PacificLutheran 193 Linfield 027 Willamette 7

1951 8-24-1 NWC Tie 1stNWC CO-CHAMPIONSPAC OPP0 W.Washingotn 820 CentralWashington 026 Willamette 627 CollegeofIdaho 60 Linfield 620 Lewis&Clark 1220 PacificLutheran 1213 Whitman 025 UCDavis* 7*-PearBowlatMedford,Ore.

1952 7-0-14-0-1 NWC Tie 1stNWC CO-CHAMPIONSPAC OPP9 W.Washington 731 WesternOregon 67 CollegeofIdaho 737 Whitman 1427 Willamette 2633 PacificLutheran 2532 Linfield 025 Lewis&Clark 7

1953 2-4-20-4-1 NWC 6thPAC OPP12 W.Washington 1226 WesternOregon 146 Willamette 613 CollegeofIdaho 4119 PacificLutheran 66 Linfield 200 Lewis&Clark 146 Whitman 13

1954 3-41-4 NWC Tie 4thPAC OPP26 W.Washington 1816 PacificLutheran 266 Willamette 1212 CollegeofIdaho 2019 WesternOregon 620 Linfield 00 LewisandClark 22

1955 4-42-3 NWC Tie 3rdPAC OPP0 WesternOregon 1212 Whitman 1313 PacificLutheran 014 PortlandState 719 Willamette 612 CollegeofIdaho 207 Linfield 137 Lewis&Clark 6

1956 3-61-4 NWC 6thPAC OPP0 UCDavis 267 CollegeofIdaho 397 Willamette 3927 SeattleRamblers 713 EasternOregon 77 Whitman 1914 PortlandState 337 Linfield 2118 Lewis&Clark 6

1957 2-70-5-0 NWC 6thPAC OPP6 ChicoState 4825 PortlandState 187 SeattleRamblers 2812 PacificLutheran 07 Linfield 4114 Lewis&Clark 1919 Whitman 286 Willamette 407 CollegeofIdaho 20

1958 1-7-10-4-1 NWC 6thPAC OPP14 ChicoState 3419 PortlandState 2014 Willamette 2714 PacificLutheran 614 CollegeofIdaho 287 Whitman 127 Linfield 713 Lewis&Clark 33

1959 4-52-3 NWC Tie 4thPAC OPP17 CentralWashington 07 UCDavis 1412 Willamette 146 PacificLutheran 73 Whitman 716 CollegeofIdaho 040 PortlandState 020 Lewis&Clark 3330 Linfield 7

1960 5-42-3 NWC 4thPAC OPP20 PacificLutheran 1228 UCDavis 014 Willamette 2520 WesternOregon 1413 SeattleRamblers 2834 Whitman 1426 Lewis&Clark 2735 CollegeofIdaho 137 Linfield 21

NOAH ALLEN 1961-1964 8-26-0

1961 0-90-5 NWC 6thPAC OPP9 PacificLutheran 1217 ChicoState 200 CollegeofIdaho 3214 WesternOregon 2714 Willamette 3113 Whitman 190 Linfield 450 SouthernOregon 337 Lewis&Clark 36

1962 1-81-4 NWC 5thPAC OPP7 PacificLutheran 1213 ChicoState 197 Willamette 4019 WesternOregon 210 SantaClara 4733 Whitman 014 Lewis&Clark 3920 CollegeofIdaho 00 Linfield 13

1963 3-62-3 NWC 4thPAC OPP14ChicoState 207PortlandState 2721Whitman 2027WesternOregon 03CentralWashington 200Willamette 714Linfield 277Lewis&Clark 3517CollegeofIdaho 0

1964 5-33-2 NWC 3rdPAC OPP20 PortlandState 754 WesternOregon 177 CollegeofIdaho 013 PacificLutheran 2127 Whitman 1421 Willamette 1414 Lewis&Clark 170 Linfield 63

FRANK BUCKIEWICZ, SR. 1965-1980 40-98-2

1965 5-32-3 NWC Tie 3rdPAC OPP23 WesternOregon 718 CollegeofIdaho 70 Willamette 2028 GeorgeFox 1326 OregonTech 206 Linfield 4019 Lewis&Clark 912 Whitman 14

1966 3-5-11-4-1 NWC 6thPAC OPP47 OregonTech 026 Whitman 06 WesternOregon 2928 GeorgeFox 140 Lewis&Clark 27

21 Willamette 2614 Linfield 330 PacificLutheran 09 CollegeofIdaho 17

1967 3-62-4 NWC Tie 4thPAC OPP0 SimonFraser 621 WesternOregon 200 Linfield 2714 CollegeofIdaho 09 Willamette 4212 PacificLutheran 3413 Whitman 00 Whitworth 212 Lewis&Clark 39

1968 1-7-10-5-1 NWC 6thPAC OPP7 WesternOregon 360 SimonFraser 417 Willamette 5514 CollegeofIdaho 270 Lewis&Clark 416 Linfield 260 PacificLutheran 3316 GeorgeFox 07 Whitman 7

1969 3-61-5 NWC Tie 6thPAC OPP34 EasternOregon 021 WesternOregon 1315 CollegeofIdaho 187 Lewis&Clark 283 Linfield 150 PacificLutheran 1314 BritishColumbia 197 Whitman 2720 Willamette 7

1970 0-80-6 NWC 7thPAC OPP13 WesternOregon 1410 Lewis&Clark 416 Linfield 4114 PacificLutheran 457 EasternOregon 2641 Whitman 467 Willamette 1021 CollegeofIdaho 30

1971 4-53-3 NWC 4thPAC OPP7 SimonFraser 3620 WesternOregon 359 Linfield 710 PacificLutheran 1134 OregonTech 2128 Whitman 910 Willamette 2748 CollegeofIdaho 2015 Lewis&Clark 28

1972 8-15-1 NWC 2ndPAC OPP28 W.Washington 137 Linfield 279 PacificLutheran 720 SimonFraser 037 Whitman 021 Willamette 055 CollegeofIdaho 3724 Lewis&Clark 735 SouthernOregon 0

1973 0-90-7 NWC 8thPAC OPP19 EasternOregon 2214 PacificLutheran 2119 Whitworth 3014 Whitman 3210 Willamette 1727 CollegeofIdaho 19*29 Lewis&Clark 10*19 Linfield 216 SouthernOregon 7*-winslaterforfeited

1974 1-71-6 NWC Tie 6thPAC OPP3 SouthernOregon 2127 Lewis&Clark 226 Linfield 413 CollegeofIdaho 286 Whitworth 3714 Willamette 276 PacificLutheran 4912 Whitman 18

1975 1-81-6 NWC Tie 6thPAC OPP14 OregonTech 157 SouthernOregon 397 Linfield 306 CollegeofIdaho 150 Whitworth 3513 Willamette 206 PacificLutheran 4261 Whitman 147 Lewis&Clark 18

1976 2-72-5 NWC 6thPAC OPP23 WesternOregon 266 OregonTech 169 CollegeofIdaho 60 Whitworth 4521 Willamette 238 PacificLutheran 4828 Whitman 2326 Lewis&Clark 5721 Linfield 37

1977 2-70-6 NWC 7thPAC OPP13 WesternOregon 4217 W.Washington 1323 Whitworth 263 Willamette 140 PacificLutheran 4530 EasternOregon 148 Lewis&Clark 287 Linfield 4123 CollegeofIdaho 24

1978 4-43-2 NWC 3rdPAC OPP25 WesternOregon 2717 W.Washington 1621 Lewis&Clark 1414 Willamette 628 Linfield 6214 EasternOregon 210 PacificLutheran 3231 Whitworth 23

GOBO

XERS

.COM


Year-By-Year Results1979 1-80-5 NWC 6thPAC OPP20 WesternOregon 427 OregonTech 383 EasternOregon 437 W.Washington 177 PacificLutheran 4021 Willamette 2413 Linfield 3919 Whitworth 5822 Lewis&Clark 34

1980 0-90-5 NWC 6thPAC OPP20 WesternOregon 490 OregonTech 203 EasternOregon 556 W.Washington 2822 Lewis&Clark 4220 PacificLutheran 4114 Willamette 200 Linfield 546 Whitworth 49

BILL CONNOR 1981-1984 8-27-1

1981 0-90-5 NWC 6thPAC OPP10 OregonTech 320 CentralWashington 1714 SouthernOregon 3214 WesternOregon 2120 Whitworth 480 Lewis&Clark 286 PacificLutheran 516 Willamette 386 Linfield 33

1982 2-72-3 NWC 4thPAC OPP3 OregonTech 170 CentralWashington 5115 SouthernOregon 3718 WesternOregon 520 Linfield 4115 Whitworth 4721 Lewis&Clark 146 PacificLutheran 1713 Willamette 11

1983 4-51-4 NWC Tie 5thPAC OPP17 SimonFraser 480 OregonTech 2133 W.Washington 2324 WesternOregon 1437 Willamette 1513 Linfield 4616 Whitworth 4111 Lewis&Clark 263 PacificLutheran 34

1984 2-6-11-3 NWC Tie 3rdPAC OPP24 WesternOregon 2417 SimonFraser 2218 OregonTech 2337 W.Washington 297 PacificLutheran 4535 Willamette 130 Linfield 27 Whitworth 2219 LewisandClark 34

BILL GRIFFIN 1985-1989 14-27-4

1985 2-71-5 CFA Mt. Hood Tie 6th PAC OPP8 OregonTech 296 SimonFraser 2428 Lewis&Clark 1533 EasternOregon 270 PugetSound 310 WesternOregon 417 SouthernOregon 350 Willamette 3714 Linfield 25

1986 2-71-5 CFA Mt. Hood 6thPAC OPP14 OregonTech 197 SimonFraser 4546 Lewis&Clark 4848 EasternOregon 2721 PugetSound 5821 WesternOregon 407 SouthernOregon 1753 Willamette 1626 Linfield 42

1987 4-3-23-2-1 CFA Mt. Hood 4thPAC OPP14 OregonTech 4018 WesternOregon 1523 SimonFraser 1732 EasternOregon 1428 SouthernOregon 313 W.Washington 1331 Whitworth 3524 Willamette 2412 Linfield 17

1988 3-5-13-3 CFA Mt. Hood Tie 3rdPAC OPP7 OregonTech 4517 WesternOregon 3813 SimonFraser 4424 EasternOregon 627 SouthernOregon 3814 W.Washington 3428 Whitworth 2823 Willamette 2138 Linfield 24

1989 3-5-12-3-1 CFA Mt. Hood 5thPAC OPP17 SimonFraser 130 SouthernOregon 717 Willamette 173 Whitworth 2722 Linfield 3448 WesternOregon 2010 Lewis&Clark 3226 EasternOregon 109 OregonTech 13

BILL SINGLER 1990-1991 3-14-1

1990 3-5-12-3-1 CFA Mt. Hood 5thPAC OPP21 SimonFraser 143 SouthernOregon 2325 Willamette 2912 Whitworth 240 Linfield 2324 WesternOregon 1722 Lewis&Clark 2228 EasternOregon 3015 OregonTech 14

1991 0-9 0-6 CFA Mt. Rainier 7thPAC OPP13 Lewis&Clark 320 SouthernOregon 6614 CentralWashington 7318 Whitworth 3438 PacificLutheran 07 SimonFraser 3410 W.Washington 303 Willamette4331 PugetSound 35

1992-2009 No Team

KEITH BUCKLEY2010-Present

1-17

2010 0-90-6 NWC 7thPAC OPP19 PugetSound 369 ClaremontM-S 370 Lewis&Clark 487 Willamette 6914 Linfield 6612 Whitworth 2431 PugetSound 4223 PacificLutheran 5042 Menlo 44

2011 1-81-5 NWC 6thPAC OPP28 SimonFraser 3616 Menlo 239 Claremont-M-S 2835 Lewis&Clark 617 Willamette 496 Linfield 406 Whitworth 4844 PugetSound 2524 PacificLutheran 35

Series History First Last Last Team Game Game Rec. Streak WinBishop Scott’s Academy* 1892 1899 2-0-0 Won 2 1899British Columbia* 1946 1969 4-1-0 Lost 1 1949Cal Poly 1958 1958 0-1-0 Lost 1 —Central Washington 1951 1991 2-4-0 Lost 4 1959Chemawa Indian School* 1901 1921 5-5-1 Won 1 1921Chico State* 1949 1963 2-5-0 Lost 5 1950Claremont-Mudd-Scripps 2010 2011 0-2-0 Lost 2 —College of Idaho* 1922 1977 19-26-5 Lost 1 1976Commerce HS* 1930 1930 1-0-0 Won 1 1930Eastern Oregon 1956 1990 8-6-0 Lost 1 1989Everett JC* 1946 1946 1-0-0 Won 1 1946Forest Grove AC* 1905 1905 0-1-1 Lost 1 —Fort Lewis Academy* 1936 1936 1-0-0 Won 1 1936George Fox+ 1894 1968 11-1-0 Won 7 1968Hill Military Academy* 1901 1910 4-2-1 Lost 1 1909Holmes Business College* 1896 1896 1-0-0 Won 1 1896Lewis & Clark 1903 2011 28-34-4 Lost 3 1985Lincoln HS 1909 1909 0-0-1 Tied 1 —Linfield 1898 2011 25-39-4 Lost 4 1988Menlo 2010 2011 0-2-0 Lost 2 —Montana 1923 1948 1-2-0 Lost 2 1923Mount Angel Seminary* 1910 1922 6-0-0 Won 6 1922Multnomah AC* 1892 1925 0-7-0 Lost 7 —Oregon 1894 1932 0-13-2 Lost 5 —Oregon Freshmen 1920 1920 0-1-0 Lost 1 —Oregon Medical School* 1901 1904 2-0-1 Won 1 1904Oregon National Guard* 1896 1896 1-0-0 Won 1 1896Oregon State 1895 1934 2-11-3 Lost 7 1911Oregon State Freshmen 1919 1920 0-1-1 Tied 1 —Oregon Tech* 1948 1990 5-13-0 Won 1 1990Pacific Lutheran 1939 2011 8-27-3 Lost 15 1972Portland* 1894 1942 5-11-3 Lost 7 1933Portland Academy* 1900 1910 4-3-2 Won 2 1910Portland Air Base* 1941 1941 1-0-0 Won 1 1941Portland CYO* 1909 1909 0-0-1 Tied 1 —Portland Dental College* 1900 1900 2-0-0 Won 2 1900Portland HS* 1899 1907 1-2-0 Lost 2 1899Portland State 1947 1964 5-3-0 Won 1 1964Portland YMCA* 1898 1904 2-0-0 Won 2 1904Puget Sound 1911 2011 15-13-3 Won 1 2011Reed* 1919 1920 2-0-0 Won 2 1920Santa Clara* 1962 1962 0-1-0 Lost 1 —San Jose CC* 1938 1938 0-1-0 Lost 1 —Seattle Ramblers* 1956 1960 1-2-0 Lost 2 1956St. John’s Bachelor Club* 1932 1932 0-0-1 Tied 1 —Simon Fraser 1967 2011 5-9-0 Lost 2 1990Southern Oregon 1932 1991 4-15-0 Lost 4 1987St. Martin’s* 1941 1942 1-1-0 Lost 1 1941UC Davis 1949 1959 2-2-0 Lost 2 1951Vancouver AC* 1916 1916 0-1-0 Lost 1 —Vancouver Barracks* 1937 1937 1-0-0 Won 1 1937Washington 1911 1928 0-2-0 Lost 2 —Washington HS* 1912 1912 0-1-0 Lost 1 —(Portland)Washington State 1923 1924 0-2-0 Lost 2 —Western Oregon 1893 1990 17-18-2 Won 2 1990Western Washington* 1939 1991 9-7-2 Lost 2 1984Whitman* 1902 1976 22-23-4 Won 2 1976Whitworth 1910 2011 2-18-1 Lost 5 1978Willamette 1899 2011 25-52-5 Lost 4 1988

* - school no longer sponsors football+ - George Fox will reinstate football for the 2013 seasonBold Type denotes 2011 opponents

PACI

FIC

Foot

ball


Pacific’s Championship Teams

1938Northwest Conference Co-ChampionsRogerFolgatehadneverpostedalosingrecordinhisfirsttwoyearsasPacificheadcoach,butthreeittookthreeseasonstofinallybringatrophytoForestGrove.InwinningPacific’sfirstNorthwestConferencefootballtitle,theBadgersof1938wouldearnthemselvesthetitleof“GiantKillers”togetthere.

Apairoftoughnon-conferencelosses,includinga26-6defeattotheUniversityofPortlandanda39-0shutoutatthehandsofSanJoseState,didlittletosmashtheteam’sresolve.TheBoxerspostedshutoutsintheirfirsttwoNWCgames,winning21-0overPugetSoundand13-0overLinfield.

A14-7losstotheCollegeofIdaho,buoyedbyalackofdepthandillness,settheBadgersupforashowdownwithapowerfulWillametteteamforatleastashareoftheleaguetitle.Inahard-foughtcontest,LenGilmantossedtoAll-NWCendGeorgeRacetteforthegame’sonlyscore,securinga6-0winovertheBearcats.Thevictorysnappeda26-gamewinstreakinNWCgamesbyWillamette,whichdatedbacktothe1934season.

TheBadgersfinishedtheseasonwitha13-6winoverWhitman,completingtheyearwitha4-3overallrecordand4-1NWCmark,tyingwithWillametteforPacific’sfirstfootballtitle.

1938 SCHEDULE (4-3)Portland L26-6PugetSound* W21-0Linfield* W13-0SanJoseState L39-0CollegeofIdaho* L14-0Willamette* W6-0Whitman* W13-6*-NorthwestConferenceopponents

1938 NORTHWEST CONFERENCE STANDINGS Points PointsTeam NWC For Against OverallPacific 4-1 60 20 4-3Willamette 4-1 88 6 5-3CollegeofIdaho 2-2-1 35 74Whitman 1-3-1 40 67 2-4-1PugetSound 1-3 21 41 2-5Linfield 1-3 12 48 2-6

1939Northwest Conference ChampionsInarepeatperformanceoftheyearbefore,PacificsecuredwhatwouldbetheironlyoutrightNorthwestConferencechampionshiptodatewith,ironically,onelesswinthattheBadgershadputtogetherintheirfirstthreeyearsunderHeadCoachRogerFolgate.

Acloseseason-opening14-13non-conferencelosstoPacificLutheran,theBadgersredoundedwitha6-0winoverLinfield,thefirstoffourshutoutsontheseasonandtheirthirdconsecutivewinovertheWildcats.LenGilmanconnectedona50-yardpassingplaytoLeePangleforthegame’sonlyscore.

A19-0losstoWesternWashingtonwouldbePacific’slastastheBadgerswent2-0-2overtheirremainingfourgames.Pacificscoreda13-0winoverPugetSoundanda14-0shutoutofWhitmanbeforesurvivingaclosecallbytheCollegeofIdaho.TheCoyotesrantheopeningkickoffback85yardstoopenthegame.TheBadgerswouldneedalast-seconddrivesecurea13-13tieandsetupanothertitlegamewithWillamette.

AfterWIllamettedroppedashocking8-7decisiontoWhitmanearlierintheyear,Pacificneededawinoratieforthetitle.Thetwoteamsmovedfromalow-scoringtheyearbeforetoano-scoringgamein1939,holdingaBearcats’teamthathadscored91pointsoverthecourseoftheseasontoa0-0tie.ThedeadlockallowedPacifictofinish3-0-2inconference,justaheadofWillamette’s3-1-1.

1939 SCHEDULE (3-2-2)PacificLutheran L14-13Linfield* W6-0WesternWashington L19-0PugetSound* W13-0Whitman* W14-0CollegeofIdaho* T13-13Willamette* T0-0*-NorthwestConferenceopponents

1939 NORTHWEST CONFERENCE STANDINGS Points PointsTeam NWC For Against OverallPacific 3-0-2 48 13 3-2-2Willamette 3-1-1 91 27 3-4-2Whitman 3-2-0 53 61 4-3Linfield 2-3-0 68 79 2-7PugetSound 1-3-0 45 90 1-5-1CollegeofIdaho 0-3-1 27 60

GOBO

XERS

.COM



1949Northwest Conference Co-ChampionsPear Bowl ChampionsDr.PaulStaggbroughtcoachingexperienceandnamerecognitiontoPacific.ThesonofAmosAlonzoStaggwasboundtoknowhowtocoachthegame,buthealsobroughtwinningandreturnedtheBadgerstothetopoftheNorthwestConferencepodium.

Inhisthirdyearleadingtheprogram,PacificbecameanoffensivelypotentprogrambehindthequicklegsofAll-NWCandLittleAll-AmericanStanRussell,whoearnedleaguehonorsforthethirdconsecutiveseason.TheBadgersscoredaleague-high144points(297againstallopponents),31morethantheCollegeofIdaho.

Afteropeningtheseasonwitha20-20tiewithPacificLutheran,Pacificsteamrolledtheirnextfiveopponents.Thevictoriesincludeda25-0blankingofLinfield,a33-0shutoutofChicoStateand34-0defeatofBritishColumbia.Lewis&ClarkendedthewinstreakandPacific’schancesfortheirsecondoutrighttitle,scoringforthefirsttimeovertheBadgersinfouryearswithtwofourthquarterscorestowin13-6.

Pacificsecuredthetiewithconvincingvictoriesintheirlasttworegularseasongames,tallyinga48-0shutoutovertheCollegeofIdahoanda32-7victoryoverWillamette.Pacificfinishedtheconferencescheduleat4-1,tyingwithLewis&ClarkandtheCollegeofIdahofortheleaguetitle.

Theteam’s7-1recordsecuredtheBadgerstheirfirstpostseasonberth,acceptinganinvitationtoplayinthePearBowlinMedford,Ore.Pacificcollecteda33-15triumphoverUCDavisinthefourthannualgame,whichwaspresentedbytheShriner’sHillahTempleatMedford’sSpiegelbergStadium.

1949 SCHEDULE (8-1-1)PacificLutheran T20-20WesternWashington W33-13Linfield* W25-0Whitman* W33-27ChicoState W33-0BritishColumbia W34-0Lewis&Clark* L13-6CollegeofIdaho* W48-0Willamette* W32-7UCDavis(PearBowl) W33-15*-NorthwestConferenceopponents

1949 NORTHWEST CONFERENCE STANDINGS Points PointsTeam NWC For Against OverallPacific 4-1 144 47 8-1-1CollegeofIdaho 4-1 113 100Lewis&Clark 4-1 97 42 5-3-1Linfield 2-3 48 66 4-4Willamette 1-4 61 138 3-6Whitman 0-5 78 146 2-6

1951Northwest Conference Co-ChampionsPear Bowl Champions

Afterfallingtwowinsshortofarepeatchampionshipin1950,PaulStagg’swinged-ToffenseallowedPacifictoonceagainlayclaimtoashareofthe1951NorthwestConferencecrown.TheBadgerscameinwitha4-1conferencemarktotiewithLewis&Clark,butwonavotebyfacultyathleticsrepresentativestoearnasecondtriptothePearBowl.

TheiropponentinthePearBowlwasthesameandtheresultwasthesameasitwasin1949.TheBadgersscoredthreetouchdownsinthefourthquarter,overcominga7-6deficittobeatUCDavis25-7.

Aclose8-0losstoWesternWashingtontoopentheseasonyieldedtoathree-gamewinstreakasCentralWashington,WillametteandtheCollegeofIdahoscoredjust12pointsagainsttheBadgersduringthestring.Pacific’shopesfortheirsecondoutrighttitlewerethwartedbyrivalLinfield,whoupsettheBadgersinPacific’shomecomingbyaclose6-0margin.

Pacificclosedtheregularseasonwiththreemorewins,beatingLewis&ClarkandPacificLutheranbyidentical20-12marginsbeforefinishingoutwitha13-0shutoutofWhitman.PacificlandedeightplayersontheAll-NorthwestConferenceTeam,themosttheredandblackwouldhavenameduntil1972.1951 SCHEDULE (8-2)WesternWashington L8-0CentralWashington W20-0Willamette* W26-6CollegeofIdaho* W27-6Linfield* L6-0Lewis&Clark* W20-12PacificLutheran W20-12Whitman* W13-0UCDavis(PearBowl) W25-7*-NorthwestConferenceopponents

1951 NORTHWEST CONFERENCE STANDINGS Points PointsTeam NWC For Against OverallPacific 4-1 86 30 8-2Lewis&Clark 4-1 179 71 9-0CollegeofIdaho 3-2 80 95Linfield 1-3-1 58 93 3-3-3Whitman 1-3-1 40 96 3-5-1Willamette 1-4-0 49 204 3-5

PACI

FIC

Foot

ball



1952Northwest Conference Co-Champions

Columbia Football AssociationFrom 1985 until the program’s discontinuation in 1991, Pacific competed as part of an NAIA super-conference known as the Columbia Football Assocation.

The conference formed when football programs from the Northwest Conference and the Evergreen Conference combined to compete in one large 14-team league. The CFA’s Mt. Hood League was comprised of seven of the league’s eight Oregon schools: Lewis & Clark, Linfield, Oregon Tech, Pacific, Southern Oregon, Western Oregon and Willamette.

Eastern Oregon and Simon Fraser of Canada joined the league’s five Washington schools in the Mt. Rainier League: Central Washington, Pacific Lutheran, Puget Sound, Western Washington and Whitworth.

Pacific moved to the Mt. Rainier League as part of a pre-determined rotation that put one Oregon school in the northern half of the CFA for a two-year term.

The CFA dropped to a 13-team league when Pacific cut football following the 1991 season and to 12 teams when Oregon Tech dropped the sport in 1992. The association became a one division, six-team league in 1996 when the Northwest Conference schools returned to conference play in preparation for their move to NCAA Division III affiliation.

Humboldt State of Arcata, Calif., replaced Eastern Oregon in the CFA in 1997. The league officially disbanded after the 2000 season when Central Washington, Humboldt State, Western Oregon and Western Washington gained NCAA Division II affiliation and became the Great Northwest Athletic Conference. Simon Fraser continued to compete as a NAIA independent in football until becoming affiliating with Canada Interuniversity Sport for the 2002 season.

Pacific went 12-27-3 in its seven years in the Columbia Football Association. The Boxers’ best finish was a tie for third place in the CFA’s Mt. Hood League during the 1988 season.

COLUMBIA FOOTBALL ASSOCIATION CHAMPIONS1985 Pacific Lutheran1986 Linfield1987 Central Washington, Oregon Tech1988 Central Washington, Oregon Tech1989 Central Washington1990 Central Washington, Southern Oregon1991 Central Washington, Linfield, Lewis & Clark1992 Linfield1993 Pacific Lutheran, Linfield1994 Pacific Lutheran, Linfield1995 Western Washington, Pacific Lutheran1996 Western Washington, Willamette1997 Western Oregon1998 Central Washington1999 Western Washingon2000 Central Washington, Western Washington

Forthesecondtimeinschoolhistory,Pacificsucceededinbecomingback-to-backchampions.Butonceagain,theirquestforthetitleoutrightwouldbestoppedthanksto7-7tiewiththeCollegeofIdaho,whichsharedleaguehonors.

The1952campaignwouldbemarkedbyclosecalls.TheBadgersbarelyescapedWesternWashingtoninthenon-conferenceopenerbya9-7,comingfrombehindonatouchdownreceptionbyFrankBuckiewicztoKayFrizell.Pacificalsofoundthemselvesonthewinningendofanarrow27-26winoverWillametteandanexciting33-25victoryoverPacificLutheran.TheBadgersclosedtheseasonoutwithararity,handingPaulDurham’sLinfieldteama32-0shutout.

PacificplayedatotalofsixplayersontheAll-NorthwestConferenceteamandsawtheselectionofthequarterbackBuckiewicztotheAssociatedPressLittleAll-AmericaSecondTeam.

1952 SCHEDULE (7-0-1)WesternWashington W9-7WesternOregon W31-6CollegeofIdaho* T7-7Whitman* W37-14Willamette* W27-26PacificLutheran* 33-25Linfield* W32-0Lewis&Clark* W25-7*-NorthwestConferenceopponents

1952 NORTHWEST CONFERENCE STANDINGS Points PointsTeam NWC For Against OverallPacific 4-0-1 128 54 7-0-1CollegeofIdaho 4-0-1 120 52Willamette 3-2-0 137 54 5-2-2Linfield 2-3-0 59 120 5-3-1Lewis&Clark 1-4-0 72 101 1-6-1Whitman 0-5-0 41 76 3-6-0

GOBO

XERS

.COM


All-Time RosterNOTE:All-timerosterincludesallplayersonrosterbetween1920and1991.From2010on,listingisbasedonathleteswhohaveplayedatleastonegame.

All-timerosterismissinginformationfromthefollowingseasons:1929,1933,1934,1935,1937,1938,1940,1941,1942,1948,1950,1956,1958,1959,1960,1961,1962,1971,1973,1974,1980,1985.

AC.J.Aalona 2010KimoAalona 1981LandonAano 2010-11NickAbbott 1982BrandenAbiva 2011JerryAdams 1952-53BimAdamson 1951ClintAgee 1951-53LeonAggalot 1975-76JoeAgost 1949KuAiona 2010-11ReedAken 1986BerylAkers 1952-53DerekAki 1988HajimeAlabanza 2010MikeAlbrecht 1982-84KenAlbus 1969-70-72ForrestAllen 1957GregAllen 1991GordonAllured 1977MattAltier 2010BruceAlton 1972AustinAlvarez 2010-11JohnAlves 1975RickAlves 1976JulianAmaya 1952NeilAmina 1982-84LondonAmorin 2010RayAmstadt 1963-64CooneyAnderson 1940DaveAnderson 1987DickAnderson 1970RickAnderson 1976-79ChrisAndrews 1984DaveAndrews 1968BillAngelos 1968-70BlakeAnthony 2011SamArashiro 1977SeanArbogast 2011MarlinArd 1972TimArmbuster 1968-70AdamArmstrong 2011JackArnold 1966DaytonArruda 1963-66ReeceAsakura 1990ReidAshley 2010DavidAskew 1978-79DevinAsselin 2010MichaelAsuncion 1975-77AaronAtkins 1990-91CarrollAtkinson 1947TimAuringer 1980-81DanielAustin 1982

BJimBachman 1983RobBachman 1982-83BillBacon 1954-55CraigBailey 2010-11TimBailey 1987ChazBajet 2011MattBajo 1981-82DuaneBaker 1955GregBaker 1970KennyBaker 1986KeithBakkum 1949RockyBalada 1972BryceBaldwin 2010

SeanBangs 2010-11MerleBarber 1968MikeBarber 1975-76GaleBarcroft 1964,1966-67JeffBarmby 2011ForrestBarnes 1982-84CameronBaron 2011JoeyBarros 1987-88ScottBaumgartner 1986-87JohnBeal 1975-77PatBeard1983JoshBeck 2010JoeBee 1968AdamBell 2011JimBell 1955JonBell 1989KevinBell 1989SpencerBell 2010ZachBell 1991DuaneBelvoir 1984MichaelBen 1967-69SteveBenight 1975ChuckBennett 1976-77DonBerg 1953ArnoldBergren 1946BrianBergquist 1986-87DuffBergquist 1984WadeBerrett 1986DanBerry 1982-84JoshBerry 1991SamBettencourt 2011WadeBettencourt 2010MarvBibler 1951BillBieker 1946-47,1949BillBird 1967BillBishop 1983-84BobBishop 1951-52DennisBlackwell 1975-76TimBlackwell 1976FrankBlair 1953-54PaulBlanchard 1983-81BillBlevins 1986-89RussBlunck 1978-79,1981TomBonsell 1953DanBoomer 1955KawikaBoro 2010MikeBoshers 1975LyleBosket 1988ChrisBoullet 1991DaveBowman 1972JoeBoyd 1964-65JohnBoyd 1970-72DamonBoydston 1977BrianBracci 2010RogerBraker 1986-87EricBramwell 1989MikeBrandolino 1983MarkBrazelton 1984PatBrennan 1981SteveBrenner 1991JaredBridgewater 2010JoshBrinkworth 2011BobBroberg 1972SteveBrody 1967-68WillieBrosseau 1976-79AustinBrown 2011ChrisBrown 1986GregBrown 1975JeffBrown 1988KendallBrown 2010LyleBrown 1947-49TonyBrown 1949EdBruer 1975JohnBrunelle 1978-79,1981-82FrancisBrusco 1946-47DonBryant 1940GregBuckiewics 1978-79FrankBuckiewicz 1949-52FrankBuckiewiczJr. 1975-77WaltBuckiewicz 1951KevinBuckner 1988JohnBunke 1966-67MarvinBuntin 1947-49

DonBurg 1952DaveBurgess 1969-70CraigBurkhart 1972KenBurkhart 1972FrankBurki 1940BobBurnside 1957MarkBurt 1975WilliamButcher 1987BobButler 1963-64JackButler 1983JayButz 1969-72WillardButzloff 1953

CRubenCaballero 1986PatCadiz 1990JimCain 1977TonCain 1972EdrickCallejo 1986TrippCallery 1967MikeCalvert 1964KerryCameron 1978-79IanCampbell 2010T.C.Campbell 2010-11DannyCannon 1976PhilCaputo 1983ChrisCard 1972DanCarlile 1969-70BillCarlson 1990-91RickCarpenter 1983,86RonCarper 1968EddieCarrillo 2011DaveCarroll 1988-1990WayneCarter 1983-84QuinnCarver 1986BruceCasias 1981BoCasillas 1987GabeCasillas 1986JimCason 1975FloydCastellano 1981GeneCavell 1965CharlieChapman 1965-66SpencerChandler 2011MarioChaves 1978-79BenCheek 2011JimChilders 1976JackChildress 1986-87ErnestChinen 1968-69LesChing 1972BillChristensen 1990DaleChristiansen 1952-55DanielChun 2011JeffChun 1986-87EsmondChung 1965-67LarryChung 1951-54ConorClark 2010-11RandyClark 1989ZachClark 2010BobClarke 1949KentClausen 1970-72FrankCleys 1952JeffClose 1978-79FrancisCloudt 1991MikeCoates 1967MarkColangelo 1975-76ChrisColeman 1991ClaytonColliton 1990-91BillConnor 1983-84DaveConnor 1983-84MikeConnor 1983-84WendyConnor 1953GaryConnors 1953-55EdContreras 1988LynnCoon 1966MarkCooper 1978-79MarvCooper 1955-57MervinCooper 1949ScottyCooper 2011GrantCorliss 1983-84JimCorn 1972BlakeCornell 1986-87WilliamCosier 1983ErnestCotton 1975

AllanCovington 1976JeffCox 1976TomCox 1991RonCraig 1953-55ChrisCronin 1991DaneCrossley 1986-88JimCrowell 1970LarryCrowley 1970-72StocktonCrowley 2011GordonCroston 1952-54GeraldCrumpacker 1949KenCrutch 1981KenCurfew 1986VincentCyphers 1947CurtCyr 1970

DSpencerD’Amato 2011KenDahl 1975-77BillDahlgren 1946-47BillDahlgren 1940WayneDahlke 1986SkipDailey 1987-88CylerDalgord 2010SeanDalton 2010-11Petr,Danchev 2011DickDaniels 1963-65HunterDassonville 2010-11AlDavidson 1949-51PatDavidson 1969SkipDavidson 1975BrentDavies 1978-79BenDavis 1954-57FrankDavis 1972HowardDavis 1940RalphDavis 1968RustyDavis 1965-66DakotaDavison 2010D.J.Debbs 1987-89ChadDebnam 1969-70TomDeBord 1981-81RogerDeLeon 1969-70TomDelgato 1975ScottDenney 1977KalenDennis 2011JohnDerby 1975-77NormanDeponte 1986HarveyDethlefs 1955DamonDias 1988-90DougDick 1976-77KenDickerson 1969PaulDiederich 1965-68DanDieringer 1987-90RobDimick 1975-78ConradDivis 1972BobDixon 1957KenDixon 1966-67MatthewDodier 2011ToddDodson 1983EricDomingo 1989RobertDominiak 1988DominiqueDonaghy 2011KevinDopps 2011CalDowney 1966-69KevinDoyle 1986MarsDuffy 1983KaseyDukes 2010-11JosephDunn 2010HowardDurand 1965-67TimDurkin 1982-84DougDuvall 1977FredDyer 1983-84PatDyer 1967TomDyer 1978-79ETateEakin 2011AlexEasley 2011MaxEasley 1986KenEastman 1978-79BillEddy 1972SteveEdminson 1978-79DickEdwards 1963

DickEdwards 1963JerryEdwards 1977-79BradEbel 1988EricEcklund 1986ChrisEisenbarth 1989-90JohnElder 1968RoyEllington 1966MikeElliot 1978-79ToddElliot 1982OrvilleElliott 1940JohnElston 1963-65LarryElton 1968KyleEngland 2010TimEngles 1975-76MarkEppenbach 1983BillErickson 1969JoshErickson 1989-90ErlErlandson 1940RonErnish 1954BobEstok 1954TedEtten 1983-84MarkEvans 1966-67MaxEvans 1955JerryEvenson 1963-64FJustinFa’agau 2011LarryFallin 1965DavidFalk 1986-87JohnFanning 1975TerryFarr 1963BillFate 1957RobFazio 1972-75KevinFeist 1982-84AaronFentress 1989-90JimFerguson 1957EliFerreira 2010AesFerrer 2010MikeFerris 1981DaleFessenden 1968-70ShaneFeuerbach 2010-11RudyFigueroa 1987-88AlvinFinkley 1989JakeFischer 2010DavidFish 1978-79PatFisher 1970GaryFisk 1954-57RonFitzgerald 1990-91BrianFleskes 1983-86GabeFlory 2010-11BillFoelker 1940DavidFok 1984ClairFoley 1963JoeFontaine 1947MichaelFord 1978-79LarryForsyth 1965-66DonFort 1969MarkFrack 1986-87ArnieFrancis 1972BobFranck 1940FrankFranklin 1947ToddFred 1981DanFrench 1952-55RayFritz 1975-76KayFrizzel 1951-52RichardFromdahl 1957WillieFruseau 1977AndyFujimoto 2011JaysonFukumoto 2010JordanFukumoto 2010-11BretFullmer 1991

GHankGaffke 1977FredGaines 1970-72LeroyGamble 1947-49DerrickGarcia 1976BillGarlington 1976-77DonGarrett 1986CecilGates 1983EdGayle 1957BobGaytas 1954-55LarryGehrts 1954-55

PACI

FIC

Foot

ball


All-Time RosterJerryEdwards 1977-79BradEbel 1988EricEcklund 1986ChrisEisenbarth 1989-90JohnElder 1968RoyEllington 1966MikeElliot 1978-79ToddElliot 1982OrvilleElliott 1940JohnElston 1963-65LarryElton 1968KyleEngland 2010TimEngles 1975-76MarkEppenbach 1983BillErickson 1969JoshErickson 1989-90ErlErlandson 1940RonErnish 1954BobEstok 1954TedEtten 1983-84MarkEvans 1966-67MaxEvans 1955JerryEvenson 1963-64FJustinFa’agau 2011LarryFallin 1965DavidFalk 1986-87JohnFanning 1975TerryFarr 1963BillFate 1957RobFazio 1972-75KevinFeist 1982-84AaronFentress 1989-90JimFerguson 1957EliFerreira 2010AesFerrer 2010MikeFerris 1981DaleFessenden 1968-70ShaneFeuerbach 2010-11RudyFigueroa 1987-88AlvinFinkley 1989JakeFischer 2010DavidFish 1978-79PatFisher 1970GaryFisk 1954-57RonFitzgerald 1990-91BrianFleskes 1983-86GabeFlory 2010-11BillFoelker 1940DavidFok 1984ClairFoley 1963JoeFontaine 1947MichaelFord 1978-79LarryForsyth 1965-66DonFort 1969MarkFrack 1986-87ArnieFrancis 1972BobFranck 1940FrankFranklin 1947ToddFred 1981DanFrench 1952-55RayFritz 1975-76KayFrizzel 1951-52RichardFromdahl 1957WillieFruseau 1977AndyFujimoto 2011JaysonFukumoto 2010JordanFukumoto 2010-11BretFullmer 1991

GHankGaffke 1977FredGaines 1970-72LeroyGamble 1947-49DerrickGarcia 1976BillGarlington 1976-77DonGarrett 1986CecilGates 1983EdGayle 1957BobGaytas 1954-55LarryGehrts 1954-55PaulGeorge 1965

TravisGeorge 2010-11FrankGeske 1975-76BruceGiesbrecht 1978-79RolfGiesler 1975EricGietzen 2010-11LenGilman 1940TomGilmore 1955MarcGiltner 1986EarlGipe 1940RichardGipe 1968FrancisGirt 1940NickGitts 1969-72MickeyGlaze 1991RonGlenn 1984AlGoertzen 1949-52DanGonzales 1988RickGoode 1976EdGoodell 1987-89,91BobGraham 1955-57KevinGramson 1977JosephGrandberry 1976EricGranstrom 1986-87DougGraven 1968JohnGreen 1983TomGrigg 1963-64BobGrimsbo 1963-65ElmerGroener 1970WilmerGroener 1972BrettGroves 1986DanGrund 1976-77JeffGrundon 1976-79JonGudmundson 1988GregGustin 1989-88JoeGutowsky 1953-55SteveGuy 1988RonnieDeGuzman 2011

HBryanHadley 1991-90JohnHadley 1957SteveHafer 1967-69TreyHairabedian 2011RoyHale 1983-84NormanHallyburton 1940DaleHamerus 1947BobHamilton 1964DonHammer 1940PatrickHan 1991SteveHancock 1983-84BrandonHand 2011MichaelHangai 1988-90MichaelHanki 1972KurtHanson 1987-88RandyHanson 1990-91CyrusHanuna 1986-89MerleHarbor 1967BrandonHarms 2011AndyHarris 2011BrianHarris 1989-90GregHarris 1976-79EricHarrison 1987JohnHart 1988TimHastie 2010-11RoderickHatch 1991SteveHateyama 1967TinkerHatfield 1951-52JacobHauge 2010DennisHavens 1969-70KennethHawkins 1966RonHaworth 1949-53BrettHayes 1988-90HaroldHaynes 1963JasonHays 1990PatrickHazelton 1991BradHebing 1982-83VinceHeinrich 1953-55ReidHellbusch 1990BrianHeller 1984MichaelHenderson 2010MikHendrickson 1978-79BartHendrix 1982-83MikeHennessy 1964RickHerrera 1983

SteveHerrick 1987-88SteveHeselius 1989DanHess 1951-53PatrickHessler 1991BrentHicks 1965TaylorHickson 2010GlennHiga 1966-69PatrickHiga 1991TodHiginbotham 1983,86ScottHiggins 2010DanHodges 1965-68BrooksHoff 1986KenHoff 1953MorrisHoff 1940DonHolbert 1987-88DanHolladay 1991FlintHolland 1991J.J.Hollie 1988-90JohnHollie 1989MikeHolm 1989BrianHolman 1978-79TimHolub 1981WesleyHooper 2010-11OmarHorani 2010DaveHorner 1972DougHorner 1968-70GeorgeHorner 1940TomHouse 1949-51DwayneHoward 1976FrankHoward 2010-11JohnHoward 1970-72BrianHoy 1986JimHudson 1946-49NateHudson 1991TimHudson 1963-64TorinHuff 2011MattHuffman 1988-89BillHughes 1957RayHughes 1955DavidHunt 1988ElvanHuntington 1970GaryHuntley 1964JohnHutchison 1987PaulHutton 1947-49

IMikeIgnowski 1968-69YukiIgushi 1984JarrinInagaki 2011DennisIngram 1963-64KyleIngram 1983-84RubenIosefa 2011DonIverson 1957

JGeorgeJackson 1968DavisJacobs 2010-11StephenJacobsen 1966CalvinJames1966DanJames 1982-84DarrelJames 1981-84LeeJames 1984DanJansen 1972WalterJaross 1946ClareJarvis 1940ThomasJayo 1983KeithJeffries 1975KaipoJenkins 1981-82ChrisJohnson2010ChrystianJohnson 2010-11JuniorJohnson 1968-70KenJohnson 1972NickJohnson 2011RussJohnson 1954TorryJohnson 1940BillJones 1963-66DougJones 1946JaimeJones 1978-79JimJones 1972ChrisJorgenson 1988-89GarrettJorgensen 1983JohnJubb 1946-49MikeJuhala 1990-91

JimJust1982-83

KErnestKaai 1955AbeKaalele 1965MarkKaanapu 1987-88JoeKaauwai 1951LloydKadow 1972TerryKadrmas 1991BruceKaelani 1967JeffKaihewalu 1981-84ArtKalahiki 1968,72AmaniKalamba 2010ThomasKaleikini 1986IaoneKaluhiokalani 1988AkihiroKamada 1991AlynKamakaala 1978-79FurlKamakaala 1983DarinKamealoha 2010EdKameenui 1967-68MartyKammerzell 1988-90AnthonyKane 1987MarkKane 1966-69ChrisKarcher 1983TimKarrick 1989HenryKaulia 1981KeoniKaulukukui 2010RobbKawahukui 1986JoeKawaai 1954-55KelsonKawai 2010-11RodKawakami 1966-67DaveKeck 1970TilsonKekua 1983HarleyKelley 1952-54LarryKelley 1963Tre’Kennedy 1986WayneKennedy 1957ChadKent 1972MikeKenyon 1966-69AlKeranen 1968MikeKerns 1964BryceKerschner 2010-11HendersonKiaha 1975TerryKiefer 1975-77KoreyKier 1989ConnorKihune 2010MatthewKillingsworth 1988-90StanleyKim 1983-84MikeKimber 1988-91MarvinKincade 1968-69TomKintzley 1965-67DaleKlaumann 1947-49DeanKline 1978-81PhilKlingsheim 1951-52BobKlaumann 1972DougKnight 1947TracyKnight 1978-79JerryKnudsen 1955MelKnutson 1964KyleKobashigawa 1983KarlKobaski 1953AaronKoford 2010-11AndrewKonieczka 1986MarkKonyn 1978-79BillKreiger 1983TrentKroll 1987JordanKronen 2010-11KawikaKunewa 1990ClydeKunihiro 1969DonKyle 1972

L DanLabasan 1969BobbyLadiges2011DevinLagorio 2010-11JoeLally 1978-79MichaelLarson 2011ShawnLaRue 1981MikeLau 1983JakobLawrence 2011FredLeach 1957LorenLeach 1953BrianLeachman 1976-77

BillLee 1940JonLee 2010CharlieLemcke 1976FredLemcke 1940KirkLemley 1978-82MikeLena 1991BobLepschat 1949DickLewin 1963-64JayLewis 1986RickLight 1983NofoLilo 1989-90CraigLisko 1989-90CharlieLittle 1981LloydLittle 1970-72VinceLittrell 1986J.C.Lizza 1987RexLockett 1953-55TomLogan 1983-84TylerLohrke 1978-79JerryLong 1982-84DaveLorenz 1988BuckLorts 1968-70TrevinLoza 2010GeneLukoszyk 1949-51MikeLum 1981-83,86TalbertLumHo 1986TedLuther 1967RogerLyman 1983HeathLynn 1991MSteveMabry 1988BillMackaness 1951MikeMagee 1984BobMagette 1947-49KramerMahoe 1988MikeMaki 1955HankMakini 1981-82NoahManingo 2011RogerManiscalco 1951-54DickMannila 1957JaysonManning 2011CraigMarcin 1968-69DougMarshall 1978-79GregMartin 1972EnriqueMasane 1981BillMasei 1990WillMarchbanks 2010-11StanMasneri 1976DickMason 1964J.A.Massaquoi 2010NickMauro 1955TimMausen 1968BillMazelin 1988J.T.May 2010-11DwightMcBride 1968MikeMcCabe 1972DickMcCain 1964-66MattMcCann 1991MikeMcCartney 1981MontyMcCleary 1991ScottMcCrae 1967JohnMcDaniel 1991DonMcDowell 1978-79MikeMcEwan 1976-79JohnMcGee 1991MonteMcGovern 1975DevenMcKinney 2011FrankMcLain 1967MikeMcLaury 1990-91ChrisMcLinden 2010TrevorMcMahon 2010RandyMcMichael 1954TimMcMillen 1977KevinMcNulty 1983KenMead 1968NickMeares 2011RogerMedges 1966-67KeithMeeuwsen 1982KellyMeguro 2011AnthonyMeneses 2010KyleMerriam 2010-11NormanMetheny 1953

GOBO

XERS

.COM


All-Time RosterSteveMetteer 1964BentleyMeyers 1978-79LelandMichael 1947,49BillMikesill 1968BobMikolasy 1972RussMikolasy 1972TomMillbrooke 1970BillMiller 1952BrueMiller 1967RobertMiller 1952-53JerryMillis 1951-54BryanMills 2010-11RickMills 1978-79P.J.Minaya 2010-11KenMiner 1984HarveyMinnich 1981RonnieMinolli 2010-11DavidMinter 1976-77MichaelMiura 1986ChrisMiyasato 1991CharltonMoananu 1988-90AlMoberg 1963-64BobMoeller 1963-65JimMoffitt 1986BrianMonoian 1991ScottMonroe 1986-88MarcMoody 2010-11QuinMoore 2010SeanMoore 2010JimMorford 1983KamuMorita 2010-11GaryMorris 1977-79RobertMorris 2011CalMosley 1965TreyMott 1989-90NickMucisko 1952-55MarkMulvihill 1983-84DeanMunkers 1990-91ConnorMurdock 2010-11DerekMyers 1986CalvinMyles 1976-79

NSteveNacheff 1947ShawnNagata 1991KenNash 1947LarryNash 1940ClarenceNathaniel 1966-69AlNavarro 1988-90DanNeef 1989-91DaveNehring 1981,1983JackNehring 1957HarlanNelson 1964JerredNelson 2010KurtNelson 1991AaronNemec 1986TravisNess 1991BrentNicholas 1989-90KenNichols 1969AlanNicholson 1986RalphNickerson 1972EricNicolai 1986-87MattNiemann 1986ErnestNihi 1988-1991DukeNihipali 1983JohnNissley 1983JohnNorgren 1947-49ChrisNovakoff 1976-77NikkNovero 2010-11HansNowka 1990MartinNowka 1987MattNyberg 2011

OChrisObay 1989LanceOelke 1981JohnOgden 1983-86DougOkabayashi 1966-69TrevorOkamoto 2010TimO’Keefe 1977ReedOlaso 1981SteveOlberg 1986JohnOlivera 1981-83

MikeOlsen 1991RandyOlsen 1972AlanOlson 1946-49JimOlson 1949StanleyOno 1972ChrisOrtiz 1981TimOsaidacz 1981-83JerryO’Shea 1972,75DanOswald 1987-88,90-91KipOswald 1972,75RickOswald 1972,75RangoOta 1965AdamOtte 1990-91HowardOttman 1964-68

PBrucePace 1972JovannPacheco 2010KimoPadello 1988PabloPagaduan 1984KaleoPahukula 1989-91BjornPaige 1987JasonPang 1988LeePangle 1946DustinParadis 2011FredParis 1984EvansonPark 2010RogerPatton 1964-65GregoryPay 1982AlanPayne 1964FrankPayne 1969DougPeach 1978-79BobPeacock 1963-64ChuckPease 1975-77DickPekala 1955LeonPeldyak 1954DickPerkins 1953RalphPerkins 1957ScottPerkins 1982NickPernicano 2010SeanPerry 1983StevePerry 1982GarryPesavento 1986LarryPeschka 1964-65ChuckPeterson 1957DanPeterson 1983KevinPeterson 2011DarinPhilialoha 1986GeorgePhillips 1981GlenPhillips 1976PaulPhillips 1975-77NikosPhipps 1984MarkPicard 1989CraigPienett 1964-67GaryPiepkorn 1968JacobPintok 1989-90JeffPlatta 1986-87PaulPlaza 1951-52GaryPope 1970-72LancePopoff 1965-66VicPorter 1987-88GaryPotratz 1976-79GeorgePotter 1946-47JimPresnell 1984-87DerekPrice 1990-91GialPrintz 1957TrevorProcive 2010GeorgePrummer 1963SuonePulotu 1983CameronPumphrey 2010-11RonPuzey 1952-55

QEricQuan 1987RWaltRacette 1940JimmyRadcliffe 1976-79DuaneRadliff 1947MarkRahlwes 1989-90GabeRamirez 2011JimRandall 1951,53DanRangel 1986-87

DanRangel 1986-87DeanRaven 1968LarryRay 1978-79OzzieRay 1954-55JimReach 1976GusRedding 1976-77DustinReed 2011LeeReinhart 1949FredReisinger 1978-79ArtReynolds 1964NickReynolds 2010-11PatRibellia 1965-66KenRichards 1965CarlRichardson 1984GreggRietmann 1981-84TannerRietmann 2011JasonRiggle 1989GeorgeRisk 1940EdRitt 1981-83DavidRivera 1988BobRoark 1963-65KevinRobbins 1989RupertRobbins 1979-78ThurmanRobbson 1981-82J.C.Roberts 1978-79MattRoberts 1987SteveRoberts 1975FrankRobinson 1966BradRobson 1978-79DanRoby 1968SteelRocha 2010-11BillRock 1965ThomasRock 1966VirgilRock 1964BillRoff 1954-55LarryRoff 1953ChaseRogers 2011JohnRogers 1983-84MikeRogers 1976CalebRoher 2011DanRollins 1946-47HarveyRoloff 1940DanielRondez 2010JustinRoney 2010EdRooney 1949BruceRosbach 1949EdRosin 1940EricRoss 1988-91MarkRoss 1988JimRoth 1970RobertRothschild 1981JerryRudd 1955DanRudometkin 1990-91TerryRuff 1964-67JoeRussell 1964StanRussell 1946-49TraceyRutledge 1978-79RickRyan 1972

SDickSabo 1970AlanSagon 1986-89GarySakihara 1967JorgeSalang 1989,91CarlosSalvatierra 1989-90JohnSalvey 1989-91JoeSamer 1986BobSandgren 1949-52EricSandwith 1984ChrisSantiago 2010-11DanSantoro 1954BrandonSattelmeier 2011SeanSatterfield 1990-91JonSausser 1972KenSawyer 1990TaylorSchad 2011DaveScheidt 1984SteveSchireman 1983ChrisSchlegel 1983JowSchmelzer 1989-90SteveSchmick 1975AustinSchmidt 2011JeffSchmidt 1972

KevinSchmidt 1982-83BrianSchneider 1990MarkSchneider 1981RandySchoenborn 1978-79JerryScholes 1972EvanSchreurs 2010-11GuntherSchultze 2010-11DonSchur 1963-65JackScott 1955JimSeaney 1990MikeSears 1966MarcSeitz 1983-83BrandonSelvey 2010-11PaulShannon 1988DaveShaw 1965PeteShea 1970DannySheldon 1966-67SpencerSheldon 1988-90JohnShepard 1991CharlesSheron 1940BrianSherrard 1988-89SteveSherrill 1970,72ScottShimabukuro 1989-91SteveShipley 1977MikeShores 1986-88CubShulund 1984-87SethSiddle-Mitchell 2010-11WallySigler 1949BobSimmons 1968MarvinSimmons 1947BudSimpson 1946DaveSimpson 1963-64EverettSimpson 1947JeffSinclair 1986WaltSinclair 1947CraigSinger 1975-77ChuckSkov 1965RobertSlauson 1975-77BrentSmith 1986-87BillSmith 1952-55DennisSmith 1966GarySmith1 1957GregSmith 1968JackSmith 1955,57LarrySmith 1983LawrenceSmith 1988LynnSmith 1981MikeSmith 2010-11MikeSmith 1967OtisSmith 1968RickSmith 1976RonaldSmith 1947StacySmith 1981TimSmith 1988-91ToddSmith 1983-84JimSnowadski 1986PhilSnyder 1946RickSnyder 1977IrvingSoto 1975JoeSpanish 1990-91KirkSpaulding 2010JeffSpeiser 1983-84SamSpicher 1970MarkSpier 1986AngusSprankle 1946BradSpringer 1981JoeStark 1968-70PaulStark 1969CameronStauffer 2010ChuckSteifbold 1967-68DrewSteindl 2010JimStevens 1964DaleStewart 1952DonStewart 1968DougStewart 1957GeorgeStewart 1952-54GregStewart 1990-91SteveStewart 1972NeilStrachan 1978-79JerryStruck 1977EltonStorment 1949,51WayneStovall 1965GeneStuben 1988,90

DennisSturgis 1976RonStutzman 1970GarySuchy 1965-1968DeanSueoka 1967AlenSuklje 2010JimSunderland 1949-51PaulSurgeon 1981KirtSwaleson 1991JimmieSwann 1986BillSwanson 1964-68KirkSwoboda 1986-87TLeoTacca 1968-69TroyTactay 1986CourtneyTagupa 1965CliffTahely 1955JerryTalbert 1963PatTalesfore 1987RalphTanga 1977RyanTate 2011FredTatman 1982WilliamTavai 1983BillTaylor 1946-47BillTaylor 1940BrianTaylor 2010-11RickTaylor 1969TonyTaylor 1964DaveTengan 1975-76BenTennant 1951-54BernardTerry 1976-77EdThiel 1984ArnoldThogerson 1946-47JamieThomas 1989JimThomas 1963MikeThomas 1975-76CourtlandThompson 2010KenThompson 1964MarkThompson 1990-91MartinThompson 1977RodThompson 1967TomThompson 1955,57RonThornhill 1964BillTiedgen 1954-55RyanTimm 1990-91C.J.Tipler 1972JakeToll 2010AdamTolley 2010PhilTolley 2010DavidTom 1986-87RobertTow 1966DennisTracey 1975,77KyleTreadway 2011SteveTrukositz 1964SteveTucker 1957TroyTyler 1987-89UWillUlrich 2011EdmondUnutoa 1989ErikUtter 1990-91

VCarlosValdivia 1989-90SeanValente 2010-11DrewValles 1978-81DickValovick 1957ErickVanDyke 1983DrewVanRoekel 2010DaveVanWinkle 1966-68BradVerigan 1981KurtVictor 1983-84AaronVictorino 2010-11RichardVidinha 1983-86MarkViggiano 1978-79JorgeVillanueva 1986MosesWillareal-Gomez 2011BillyVincent 1972MartyVoge 1967GaryVolz 1967-69JakeVonScherrer 1977

PACI

FIC

Foot

ball


All-Time RosterWBrianWakefield 1991CedricWalker 1988-89FrankWalker 1963JohnnyWalker 1972TroyWalker 1991RoydenWatanabe 1963-64JimWard 1967RickWard 1970DaleWarren 1955TonyWarren 1970,72BradyWaters 1949,51TylerWatkins 2011ScottWatters 1968-70DerekWebb 2010DickWebb 1965-68JimWeber 1967-69GaryWeeks 1965-68JohnWeeks 1970KennyWeeks 1966TomWeeks 1969-70LandonWeimar 2011RickWeinhold 1972DonWeis 1949BobWells 1970EdwinWells 1947LennyWells 1946-49CraigWessel 1977BrianWest 1983GaryWest 1965-68JerryWest 1957JimWestendorf 1969-72JerryWesterholm 1964JonWesterholm 1954-55KenWestover 1957JoshWheeler 1990MertonWhipple 1940CarlWhite 1940CaseyWhite 1991JacobWhite 2010-11DickWiese 1963-64GeneWidmer 1957RonWika 1952DarrellWilcox 1986DeanWilcox 1946-49GeorgeWilkes 1975-76MattWilkin 1987JimWilkins 1964AlexWilleford 2011CharleyWilliams 1965DanWilliams 1981KyleWilliams 2011LeviWilliam 1981MikeWilliams 1966-69RyanWilliams 1991SteveWilliams 1970FredWillis 1963-64ZachWillits 2010-11JimWills 1972MikeWilsey 1975-77ClarenceWilson 1977JeffWilson 1983RandyWilson 1983SpencerWilson 2011LonnieWinbush 1978-79RoyWinterroth 1947GeorgeWise 1969CalebWistock 2010-11TerryWoebke 1969-72TomWoehler 1983AlvinWong 1947LesWong 1966PatrickWong 1983-84BobWoodard 1940FredWoods 1984PatWoods 1963DickWooley 1966-67ChrisWright 1986GaryWright 1966-67MikeWulf 1983

YBertYamaoka 1978-79CameronYip 2010-11ChuckYoung 1966-67DonYoung 1953FordYoung 1984-87GordonYoung 1949JamieYoung 1987-88RickYounts 1978-79ChadYowell 1977DickYurk 1949

ZDougZarosinski 1968BobZavodsky 1953-54JohnZavodsky 1951-53GlenZeller 1951ColtonZimmerman 2010TroyZuroske 2010TomZyp 1964

PacificUniversity


PACI

FIC

Foot

ball


The Best In SyntheticFrom a distance, the Lincoln Park Stadium’s infield surface looks like well manicured grass. Upon

closer look, however, one finds one of the top synthetic surfaces on the market.

Lincoln Park’s FieldTurf surface pro-vides the look and feel of grass without the mud, water or daily maintenance. The turf itself is developed from a wide gauge, tall pile fabric, engineered to look and feel as much as possible like natural grass.

Under the turf, the field is cushioned by 10 pounds per foot of a special infill comprised of a mixture of sand, rubber granules and Nike Grind, a fill made of re-ground athletic shoe material.

The addition of FieldTurf gives the Lincoln Park Stadium a surface on-par with professional and Division I stadiums across the nation. FieldTurf is the current surface of choice at Autzen Stadium in Eugene, Reser Stadium in Corvallis and CenturyLink Field in Seattle.

FieldTurf is used for pitches in some of the world’s top soccer leagues, including the English and Scottish Premier Leagues, Germany’s Bundesliga and Spain’s Prim-era Liga.

Lincoln Park Stadium

PacificUniversity’sfootballprogramplaysinoneofthenewestandmostintimatefacilitiesintheregion,LincolnParkStadium.

Thestadium,trackandFieldTurfsurfacedpitchwerebuiltinauniquepublic/privatepartnershipbetweenPacificUniversityandtheCityofForestGrove.InadditiontoPacificathleticevents,thefacilityhostsavarietyofhighschoolandyouthteamsandevents.

Constructiononthe$10millioncomplex,whichincludestheChuckBafaroBaseballStadiumatBondFieldandtheLincolnParkSoftballStadium,commencedinMarch2007.Thepark,locatedjustnorthoftheStollerCenter,originallyopenedin1976.ThefacilityremainsintheownershipoftheCityofForestGroveandwillbemanagedbythecity’sParksandRecreationDepartment.

Forfootballplayers,thecrownjewelofthefacilityisthesyntheticsurfacedplayingfield.TheFieldTurfsurfacefeaturesthetoptechnologyavailableforanartificalfield.Thestadiumislitwithfourlargelighttowers,allowingforeveningpracticesandmatches.

Anadjacentnaturalgrasspracticefieldallowsflexibilityforteampracticeschedulesandprovidestheteamanareatopracticeinpreparationforcompetionongrassfacilities.

Surroundingthefieldisalong-awaitedtrack,thefirstonthePacificcampussincethecinderera.The400-meterovalisoneofjustahandfulofnine-lanefacilitiesintheNorthwest,makingitcapableofhostinglargeinvitationalsandNCAAchampionship

events.Thestadium’slongjumppitsareuniquelylocatedbetweenthestraightawayandthestadiumseatingarea,providingunprecedentedaccesstofieldeventsfortrackfans.

TheLincolnParkStadiumgrandstandrivalssmallcollegefacilitiesnationwideintermsofcomfortandaesthetics.Thegrandstandseats1,100fanswithexcellentsightlinestoviewsoccer,lacrosse,footballandtrackevents.Theseatsaresituatedtogivefansaviewoftheentirecomplex,makingitpossibletowatchtrackorlacrosse,baseballandsoftballallfromonespot.

Thestadium’sbrickfacadeisuniqueamonglocalsmallcollegeprogramsandisaradicaldeparturefromtheportablebleachersofTomReynoldsField.ThebrickusedinthestadiumisthesamebeingusedinotherUniversitybuildingprojects,includingthelibraryandBerglandHall,providingasenseofcontinuitybetweentheschool’sacademicandathleticprograms.

Thestadiumpressboxisequippedtoprovidesupportforthelargestevents.Themainpresstribuneseats20reportersandoperationalstaffcomfortablyandalsofeaturesalargeworkarea.Fouradditionalcompartmentsareavailableforradiobroadcasts,officialsandVIPfunctions.ThepressboxisfullyequippedwithhardwiredandwirelessInternetaccess.

Initsthreeyearhistory,LincolnParkStadiumhasstagedanumberofbigathleticevents,includingthePacificTwilightandCowapaLeaguetrackandfieldchampionshipsandPortlandTimbersexhibitionmatches.PacificUniversityhelditscommencementexercisesinthestadiumforthefirsttimein2010.

The home of Pacific football’s new era

GOBO

XERS

.COM


Stoller Center

The center of Pacific’s athletic experience

The Stoller Center has been home to a number of exciting events over it’s nearly 40-year history, from championship events to professional training camps.

2003-2011: OSAA/U.S. Bank 1A/2A State High School Volleyball Championships

2005-2010: Pacific Kickoff Volleyball Tournament, featuring some of the top teams in NCAA Division III volleyball.

2007: National Collegiate Women’s Wrestling Championships

1997 & 2000: Northwest Conference men’s basketball tournament games (Pacific won tournament in 1997)

1997: Rare exhibition game between Pacific men’s basketball alums and the former Portland Power women’s professional basketball team

1982: NAIA National Wrestling Championships (Pacific finished fifth)

1970-1975: Preseason training camp site for the NBA’s Portland Trail Blazers

LocatedatthenorthendofthePacificUniversitycampus,theBill&CathyStollerCenteristhehubofactivityforBoxerathleticsandahostofrecreationalandintramuralactivities.

Constructedin1970,theStollerCenterisoneofthelargestsmallcollegeathleticfacilitiesintheNorthwestwith95,000-square-feetoffloorspaceontwolevels.

OriginallyknownasthePacificAthleticCenter,thefacilitywasrenamedin2010tohonordonorsBill&CathyStoller.Thecoupleprovidedfundstoprovideforanumberofexpansionsandrenovationstothefacilityoverthepastdecade.

TheStollerCenterishometoPacific’s21intercollegiateathleticprograms,athleticoffices,lockerroomsandofficesandclassroomsfortheUniversity’sdepartmentofexercisescience.

Remodelingprojectsoverthelastdecadehaveremadethe40-yard-oldcomplexintooneofthetopsmallcollegeathleticfacilitiesintheNorthwest.In2000,a$3millionoverhaulofthebuildingincludedtheconstructionofa5,000-square-footweightandfitnesscenter,remodeledathleticoffices,anewfullwidthwoodgymflooraswellasanumberofaestheticimprovements.

Asecondremodelingproject,in2003,sawtheadditionofspaciousteamroomsforall20Pacificvarsityprograms,theadditionofwoodflooringfortheracquetball/handballcourtsandexpansionoftheUniversity’sathletictrainingfacilities.Newscoreboardswere

installedinthegymasiumin2006.Withtheadditionofthefootballprogram

in2010,furtherrenovationsallowedfortheconversionofthebuilding’sdanceroomtoteamoffices,anewfootballteamroomonthelowerlevelandconstructionofaweightfacilityinpartofthecenter’sfieldhouse.

ThegymnasiumisthehomearenaforPacific’svolleyball,men’sandwomen’sbasketballandwrestlingprograms.Withseatingfor2,000fans,theaggressivenatureoffansgivestheStollerCenterareputationasa“toughplacetoplay”amongmanyofitsconferenceopponents.BoxerNationcontinuestobecomestrongerandstrongerinitssupportofPacificathletics.In2006,forexample,Pacificrankedintop-50nationwideforattendanceamongNCAADivisionIIIvolleyballprograms.

Theweightandfitnesscenter,openedin2000,featuresthelatestinfreeweights,Nautilus-stylefitnessmachinesandcardiovascularworkoutequipment.Userscanenjoytheirworkoutwhileturnedintooneofcenter’ssixtelvisionmonitors.

Sittingoppositefromthegymnasiumisthefieldhouse,oneofthefirstindoorpracticefacilitiesforoutdoorsportsintheNorthwest.ThenewlyinstalledFieldTurfsurfaceprovidesdrypracticeconditionsforPacific’soutdoorsportswhenthewetconditionsoftheNorthwestpersist.

TheStollerCenterwasthesiteofthe2007NationalCollegiateWomen’sWrestlingChampionshipsandhostedtheOSAA/USBank1A/2AStateVolleyballChampionshipfrom2003to2011.ItwasalsothepracticehomeforthePortlandTrailBlazersfrom1970to1975.

Defining Moments

PACI

FIC

Foot

ball


Athletics Facilities

HomeofthePacificswimprograms,theForestGroveAquaticCenterislocatedjustsouthwestoftheStollerCenter.

Thecity-ownedfacilityfeaturesa25-yardswimming,therapypoolandspa.Aremodelin2001addedanoutdoorsplashparktothefacilityandmodernizedthelockerrooms.

InadditiontotheBoxers’swimteams,theForestGroveAquaticCenterishometotheForestGroveHighSchoolswimmingandwaterpoloteamsandtheForestGroveSwimClub.

Thethreeprogramshavepartneredoverthelastseveralyearstoimprovethefacilityforcompetitiveswimming.Afund-raisingdrivespearheadedbytheForestGroveSwimClubresultedinthepurchaseofnewstartingblocks.In2007,thethreeprogramsbandedtogetherforthepurchaseofanewscoreboardandtimingsystem.

PacificUniversitystudentsarealloweduseofthepoolfreeofchargewithcurrent“BoxerCard”identification.

Forest Grove Aquatic Center

PacificgolfershavetheopportunitytoplaytheirhomematchesattwoofthetopcoursesinthePortlandmetropolitanarea.

TheGhostCreekcourseatthePumpkinRidgeGolfClubisthehomecourseofBoxermen’sgolf.Thecoursehasbeencontinuallyratedasoneofthe“Top100PlacesYouCanPlay”byGolfMagazine.Thecoursehostedthe1993and1994NikeTourchampionshipsandthe2006U.S.SeniorOpen.

DesignedbyRobertCupp,thecoursealsohostedthe2007PacificLegendsGolfClas-sic,theUniversity’sannualcelebritygolfeventbenefittingPacificUniversityAthletics.

TheQuailValleyGolfCourseinnearbyBanksisthehomeofPacificwomen’sgolfandtheregularpracticecourseforbothteams.Openedin1994,QuailValleyisabeautifullyconditioned,linksstylecoursethatofferschal-lengestogolfersofalllevelsandability.

Golf FacilitiesSherman/Larkins StadiumPacificbaseballmovedintoitsnewfacility,ChuckBafaroStadiumatBondField,inMarch2008.

ThenewfacilityisnamedinmemoryofChuckBafaro,whomentoredthePacificbaseballprogramfrom1964to1994andwasinstrumentalinthecreationandoperationofmanyareayouthsportsprograms.

ChuckBafaroStadiumstandsasoneofthebestsmallcollegebaseballfacilitiesanywhere.The500-seatstadiumandpressboxopensontoanewlyplantedplayingsurfacewhichwillfeatureimproveddrainageandlights.ThefieldisoneofonlythreelightedfieldsintheNorthwestConference.

TheplayingsurfaceisnamedforlocallongtimebaseballboostersKenandNancyBond.Thenamewascarriedoverfromtheoriginalbaseballfield,whichsatonthecurrentlocationoftheLincolnParkStadiumandtrack.Thefieldoriginallyopenedin1976.

Chuck Bafaro Stadium

Holce Tennis CourtsPacific’sThomasHolceTennisCourts,openedinJune2009,arethehomeoftheBoxers’men’sandwomen’stennisprogramsandisalsoopenforcommunityuse.Pacificplayeditsfirstseasononthecourtsin2010.

Thefacilityfeaturessixcourts,alllitforbothdayandeveningaccess.Threeofthecourtsarecovered,allowingforpracticeandplayforPacificteamsduringtherainywintermonths.

Thecourtswererecognizedin2009asoneofthetopnewtennisfacilitiesinthenationbytheAmericanSportsBuildersAssociation.

ThesiteofthenewcourtsistheformersiteofTomReynoldsField,whichwashometothePacificsoccerprogramsfrom1993to2007.AsMcCreadyField,thefacilitywasPacific’sfootballfieldfrom1892untiltheprogramwasdiscontinuedfollowingthe1991season.

Afteryearsofplayingoncityrecreationaldiamonds,thePacificsoftballteammovedintothenewSherman/LarkinsStadiuminMarch2008.

Likeitsbaseballbrother,thesoftballfacilityrivalsanyotherlikefieldamongsmallcollegesofitstype.Itfeaturespermanentseatingfor300fansandanenclosedpressfacilitybehindhomeplate.

TheplayingsurfacemeetsallNCAAspecificationsandwillincludeenhanceddrainage,battingcagesbeyondtherightfieldfenceandaninning-by-inningelectronicscoreboardinrightcenterfield.

ThefacilityisnamedinhonoroflongtimePacificsoftballcoachJudySherman,wholedtheBoxerstosixconferencetitlesandeightnationaltournamentappearances.Italsohonorsherfather,EllerdLarkins,whofundedthefirstsoftballfieldbuiltinForestGroveinthe1950s.

GOBO

XERS

.COM


Hall of Fame/Boxer Club

Boxer ClubThe Pacific University Boxer Club provides alumni, friends, fans, faculty and staff a chance to provide support for the 21-sport Pacific athletics program.

Boxer Club members have an active interest in supporting student-athlete success. The stronger the member base, the more support the Boxer Club can provide to student-athletes.

Money raised by the Boxer Club supports a wide variety of programs and needs, including equipment, supplies and uniforms, regional travel costs, part-time assistant coaches, major equipment needs, recruiting costs and other department-wide needs.

For more information on the Boxer Club, and to become a member, please visit www.goboxers.com/boxerclub.

Thank You To Our Boxer Club Donors

INDIVIDUALSClay ActorKenneth AlbusKen AlcornChristie AlecksonNorma AndersonRobert BabekStacey BakerSean BanfsLee BarckmannForrest BarnesRobert BarrettBrian BatemanTom BeLusko, Jr.Russ BlunckKent BondTom BoyceBill BraunJim BrazeauVance BrownEverett BruerKeith BuckleySherley BuckleyRich BurkScott CarterRichard ChristensenSteve ClarkGrant CorlissEve CrainBrad CroxfordAaron DalgordCharles DallasAlan DavidsonPhilip DickiePaul DohertySean EatonPatricia ElofsonArlene EvansDale FeikMark FeuerbachAndrew FifieldBill FoelkerJonathan FuruyaManami FuruyaSandy GarryJonathan GehrsTim GeorgeLarry GiengerPatrick GillemClifford GoyaJames GrantJerry GreenfieldSteve GriffelsNeal Halousek

Rusty HamptonSteven HaugenVince HayesJohn HayesDiane HayesWilliam HendersonScott HicksonGlenn HigaTim HillBill Hilson, Jr.Gary HunterTimothy HurleyBrian JacksonDarrel JamesMark JohnsonJames A. JonesJames L. JonesDavid KeckKris KosikDick KrollWarren LacasterJoe LangLori LarsonDerek LaskoMark LewisAllyson MayRoger MayfieldLewis McArthurMyles McCartneyMichael McGrathEly McNealyGail MeadeMatthew MeyerJames MillsKen Mitchell-PhillipsDaniel MonbergRobert NixonJohn NosackLuke NosackGlenn OkadaRodney OkanekuNelson OlfMajid OmanaCameron PerryCharles PetersonPaul PhillipsVince PowellJohn PragBob ProciveBill RayJack ReevesPamela ReynoldsSharon RissmillerLeroy Rocha

Pacific Athletic Hall of FameSince1992,thePacificAthleticHallofFamehashonoredthebeststudent-athletes,coachesandcontributorsthathavebuiltthelonglegacyoftheBoxers’athleticprogram.InductionintothePacificAthleticHallofFameisthehighesthonorpresentedbythePacificAthleticDepartment.

The2012inductionclasswillbeinductedinFebruary.TonominateanindividualforthePacificAthleticHallofFame,pleaselogontowww.goboxers.com/hof.

ATHLETE INDUCTEESVictorAdams Football,Basketball Baseball,Track&FieldNelyAgbulos Softball,VolleyballChuckAhsmuhs WrestlingWarrenArakaki BaseballForrestBarnes FootballJohnBass BasketballSallyBaierski SoftballKevinBinkerd WrestlingBillBlevins FootballPeachesBode Basketball,SoftballArtBrachman FootballBillBraun BaseballFrankBuckiewicz Football, BasketballMarkBurt Track&FieldSusanBusk SoftballJayButz FootballSereneCanettesPrat(Jefferson) BasketballTomCason Track&FieldSuziChaffee-Armstrong Volleyball, Track&Field,BasketballKrisChatari-Sanchez Volleyball, BasketballLundChin TennisAlanaChongHurdle SoccerJimCorrigan Football,Basketball, BaseballZackChown SoccerDickDanielsFootball,Track&FieldJonElston Football,Track&FieldDeeAnnFitzgerald SoftballRickFranklin WrestlingDanFrench Basketball,Football, Track&FieldLeeGarboden WrestlingLisaHarings Soccer,Basketball, SoftballBrandiGill-Hendryx SoftballLenGilman FootballAmyHigginsSchmitt Track&Field VolleyballNormHubert BasketballBrettJefferies BasketballNancyJewett Volleyball,SoftballAmyJohnson BasketballFrankJohnson WrestlingLeonJohnson BasketballJoeKaauwai FootballRonKeil BaseballJackKillits Track&FieldDianaKreigerWaterstreet SwimmingKarenLally Volleyball,Softball, BasketballEanLensch SoccerBobLight FootballLloydLittle Football,BaseballLeonMeade BaseballGeraldMillisFootball,Track&Field

CalMosely BaseballRalphNickerson FootballChuckPetersen Wrestling,Football, Track&FieldStevePiercy SoccerRobert Pollock FootballVincePowell BaseballJanaRansom Softball,BasketballWaltReason BasketballEdRitt Wrestling,FootballEdRooney BasketballStanRussell FootballKurtisSaiki WrestlingJeffSandborn BaseballCindySchuppert Basketball,SoftballJenniferSharp SoftballSteveSherrill Baseball,FootballBrentSmith FootballBrianSpringberg WrestlingChrisTarabochia-VanWagner BasketballTaraTaylor BasketballArnold“Tug”Thogerson FootballJoannaVaandering SoftballNancyVanderwerf Softball,VolleyballNickVorberg SoccerCindyWackerNehring GymnasticsBrendaWall-Manser Softball, BasketballKimWarner SoftballRobertWendel Football,BaseballChristyTaylorZimmer Basketball

COACH INDUCTEESChuckBafaro BaseballMikeClock WrestlingRogerFolgate FootballLeoFrank FootballPeteMiller BasketballDavidOlmsted Women’sBasketballToeReynoldsMen’s&Women’sSoccerHarveyRoloff Football,BasketballJudySherman SoftballPaulStagg FootballJimWeber CrossCountry, Track&Field

MERITORIOUS SERVICE INDUCTEESVarinaFrenchJeffGrundonGeorgeHornerJeanHornerRuthLoomisDougOkabayashiDonSpieringKathyThurman

HONORARY INDUCTEESA.C.Gilbert Football,Track&Field

James RowlandSpencer RubinMichael RushfeldtStephanie SchulteKen SchumannJudy ShermanRebecca ShipmanGary ShummSherry SmithNathan StanleyAndrea StewartBill StollerH. Joe StoryTroy StrassJan StricklinDan SyversonDana TakashimaKathy ThurmanMark TruaxGerald TsutakawaBelinda UhallJohn VidovichBaokhanh VuDuane Valn, Jr.Joe WalshLoren WaltzAlec WebsterCynthia WestSteve WhislerMardi WilburnDean WilcoxTimothy WilliamsRichard WoldDavid WolfLloyd YasumotoGarrett YoshimotoGlen Zuroske

CORPORATE PARTNERSLasko PrintingWoodfold ManufacturingWoodridge Vision ClinicUptown Vision CenterJohn A. Prag & AssociatesHandy Andy’s TowingDana S. Takashima, DDSSchulte & CompanyB.S. Uhall M.D., PLLCMichael G. Cleary, M.D.Stinner & Nelson, LLCNystrom & CompanyR &C Tool & Die, Inc.St. Helens Youth Basketball

PACI

FIC

Foot

ball


Athletics AdministrationKen Schumann

Director of Athletics George Fox (1982)

Lesley Hallick, Ph.D.President

Pomona (1967)

LesleyM.Hallick,Ph.D.,recentlyenteredherthirdyearasthe17thpresidentofPacificUniversity.

ShesucceededPhilCreightoninAugust2009andquicklyestablishedherselfasconsensus-builderbymeetingwithUniversityalumni,friends,studentsandparentsfromallcornersofthecountryandHawaiiduringanationwide“ListeningTour.”

Thefour-monthtourresultedinawidespectrumofviewpointsthatultimatelyplayedapivotalroleinthedevelopmentofHallick’sambitious10-yearVision2020strategicplanfortheUniversity.

InHallick’sshorttenure,theUniversityhasopenedasecondbuildingonstate-of-the-artHealthProfessionsCampusinHillsboro,approvedtheadditionofacademicprogramssuchasgerontology,audiologyandspeechlanguagepathologyandcompetedinintercollegiatefootballforthefirsttimein19seasons.

HallickcametoPacificUniversityfollowingadistinguished32-yearcareeratPortland’sacademichealthcarecenter,OregonHealth&ScienceUniversity(OHSU).HallickjoinedOHSUasanassistantprofessorinmicrobiologyin1977.SheadvancedthroughtherankstotenuredfullprofessorandservedasvicepresidentforacademicaffairsandtheUniversity’sfirstprovostfor20years.

Asprovost,HallickwasanintegralpartoftheteamthatoversawthetransformationofOHSUfromacollectionofregionalschoolsintoanationallyrecognizedleaderinhealthsciencesresearchandeducation.Hallickhasearnedareputationasaproblem-solver,expertcollaboratorandskilledcommunicator.Sheisespeciallyrecognizedforherroleinbuildingpartnershipsbetweeninstitutionsinnursing,alliedhealth,andthebiomedicalsciences.

KenSchumann,alongtimememberofthePacificUniversityathleticdepartment,hasserveddirectorofathleticssince2004.

UnderSchumann’sleadership,thePacificathleticdepartmenthasexperiencedanunprecedentedperiodofgrowthandsuccess.Threesports,football,women’slacrosseandmen’sswimming,havebeenaddedunderhiswatchandthenumberofstudentsparticipatinginathleticsatPacifichasgrownfromaround250towellover400.

In2011,SchumannwasselectedastheSmallCollegeFundraisieroftheYearbytheNationalAssociationofAthleticsDevelopmentDirectors(NAADD)inrecognitionofhisfundraisingforPacificfootballandwiththePacificUniversityLegendsGolfClassic.

SchumannhasoverseenamajorexpansionintheUniversity’sathleticsfacilities,mostvisibleinthe$11millionLincolnParkAthleticComplex.Completedin2008asapartnershipbetweenPacificUniversityandtheCityofForestGrove,thecomplexresultedinnewfacilitiesfortheUniversity’sfootball,soccer,lacrosse,trackandfield,baseballandsoftballteams.ThefacilitiesareconsideredamongthefinestamongsmallcollegesintheUnitedStates.HealsoledconstructionofthenewHolceTennisCourtscomplex,whichwasnamedoneofthebestnewtennisfacilitiesinthenationin2009.

Schumannhasalsoplayedakeyroleinthesuccessofthedepartment’sannualfundraisinggolftournament,thePacificUniversityLegendsGolfClassic.WiththehelpofcelebrityhostandPacifictrusteeTommyThayer,theeventhasraisedover$500,000forPacificAthleticsoverthelastfouryears.

SchumannbeganhiscollegiateathleticscareeratPacificin1984.HewaspromotedtoassociateathleticdirectorandsucceededBobBonnasheadmen’sbasketballcoachin1992,acapacityheDr. Lisa Sardinia

Faculty Athletics Representative Whitworth (1979)

LisaSardinia,associateprofessorofbiology,hasservedasPacific’sFacultyAthleticsRepresentativesince2003.

ThechairofPacific’sDepartmentofBiology,SardiniaassiststhedepartmentwithcomplianceissuesandservesasaliaisonbetweentheathleticdepartmentandtheUniversityfaculty.

AmemberofthePacificfacultysince1996,SardiniateachesmolecularbiologyandmicrobiologyandservesontheboardofthePacificInstituteforEthicsandSocialPolicy.

Sardiniaiscurrentlyco-principalinvestigatorofaNationalInstitutesofHealthgrantstudyingtheimpactofpeoples’religiousfaithontheirviewsconcerningmoderngenetictechnologies.Shehaspresentedanumberofworkshopsandlecturesongenetictestingandethicsandstemcellresearch.

AgraduateofWhitworthwithadegreeinbiology,SardiniaearnedherPh.D.inmicrobiologyfromMontanaStatein1985andherlawdegreefromtheUniversityofCalifornia’sHastingsCollegeoftheLawin1996.UpongraduationfromMontanaState,Sardiniawasawardedathree-yearNationalCancerInstitutePostdoctoralFellowshipattheUniversityofCalifornia-SanFrancisco.

SardiniaisamemberoftheOregonStateBar.AnativeoftheBayArea,SardiniagrewupanardentSanFranciscoGiantsfanandspentmanyafternoonsbattlingtheswirlingwindsofCandlestickPark.

Lauren EsbensenAssociate Athletic Director

Kansas (2005)

LaurenEsbensenisinherfirstyearasPacific’sassociatedirectorofathleticsandseniorwomanadministrator.ShebeganherdutiesinForestGroveinSept.2012.

HerdutiesatPacificincludeservingasthedepartment’scomplianceofficer,oversightofthedepartment’sboosterclub,BoxerClub,andoversightofthedepartment’sclubsportsprograms.ShewillalsoassistSchumannintheday-to-dayoversightPacific’s21intercollegiatesportsprograms.

EsbensenspentthelastfiveyearsattheUniversityofPortland,whereshemanagedtheday-to-daycompliancesprocessesforthePilots’15NCAADivisionIsportsprograms.Shealsooversawthedepartment’sfinancialaidprocessesandinitiatedandexpandedNCAALifeSkillsprogrammingforthedepartment’s250student-athletes.

PriortoherarrivalontheBluff,Esbensenspentfrom2005to2007asalifeskillsinternattheUniversityofOregon,wheresheassistedindevelopingthedepartment’sdiversityplananddidgenderequityreportsforOregon’sDivisionIcertificationreport.BeforecomingtotheNorthwest,Esbensenspentsixmonthsasaninternwiththeseniorwomen’sadministratorattheUniversityofKansas.

Afour-yearvarsityathleteatKansas,EsbensenearnedfourlettersaspartoftheJayhawks’crosscountryandtrackandfieldprograms.SheearnedherdegreeinsportsmanagementfromKansasin2005andaMaster’sdegreeinintercollegiateleadershipfromWashingtonin2007.

GOBO

XERS

.COM


Athletics Administration

Linda McIntoshHead Athletic Trainer

Oregon (1985)

LindaMcIntoshhasbeenPacific’sheadathletictrainersince1988.Sheoverseesalloperationsoftheathletictrainingdepartment,theathletictrainingfacilityandsupervisesthestudentathletictrainingstaff.

McIntoshhas26yearsofathletictrainingexperience.Shehasreceivednumerousawardsforathletictrainingexcellence.Shewasselectedtobeacertifiedathletictrainerforthe1996ParalympicGames,heldinconjunc-tionwiththeOlympicsinAtlanta.

McIntoshholdsabachelor’sofscienceandamaster’sofsciencedegreefromtheUniversityofOregonandiscertifiedbytheNationalAthleticTrainersAssociation(NATA).

Dr. Brad ButlerTeam Physician Tulane (1988)

Dr.BradButlerhasservedasPacific’steamphysiciansince1997.Dr.Butlerisasportsmedicinespecialist,affiliatedwiththeOrthopedic&FractureClinicinPortland.

Dr.Butlerisfellowshiptrainedinsportsmedicineandshouldersur-gery,andworkswithafullrangeoforthopedicpatients.Hehasspecialskillsinthereconstructionofshoulders,elbows,kneesandankleusingarthroscopictechniques.

InadditiontoworkingwithPacificathletes,Dr.ButleristhemedicaldirectorfortheCenterofSportsMedicineatProvidenceSt.VincentMedicalCenterandprovidesathletictrainingservicesforCycleOregon.

Marriedwiththreechildren,Dr.ButlerearnedhismedicaldegreefromTulaneUniversityin1988andservedhisresidencyinorthopedicsatTulane.HeisafellowwiththeAmericanAssociationofOrthopedicSurgeons.

Athletic Department Support StaffBlake TimmSports Information Director

Pacific (1998)

A1998graduateofPacificUniversity,BlakeTimmhasservedasPacific’ssportsinformationdirectorsince1999.

The2011NorthwestConferenceSportsInforma-tionDirectoroftheYear,TimmisinchargeofthedailypublicityandmediarelationsforPacific’s21intercollegiatesports.Thosedutiesincludedailycontactwithmedia,producingpublicationsandmaintainingstatis-ticsforallsports,coordinatinggamemanagementforallhomeeventsanddailymaintenanceoftheathleticdepartment’sWebsite,www.goboxers.com.

TimmhasbeenhonorednumeroustimesforhisworkinpublicizingPacific’sstudent-athletes.In2008,TimmwasnamedaGrantBurgerMe-diaAwardwinnerbytheAmericanVolleyballCoachesAssociationastheNCAADivisionIIIWestRegionwomen’svolleyballSIDoftheyear.

In2007andagainin2011,TimmwasvotedbyhispeersattheNorthwestConferenceSportsInformationDirectoroftheYear,becomingjustthesecondpersonsohonored.In2006,hewasrecognizedbyPacificwithit’s“OutstandingContributionofanIndividualforUniversityService”award,whichhonorsstaffmemberswhohavegivengreatservicetotheinstitution.

Chelsey ChamberlainAsst. Sports Information Dir.

NOT PICTUREDBob SmithAsst. Facilities Manager

Vicki McGeeAdministrative Assistant

Richard RuttAsst. Athletic Trainer

Andrea StewartMgr. of Admin. Services

Philip LentzAsst. Athletic Trainer

Alma MattocksAsst. Athletic Trainer

Head Coaching Staff

Greg BradleyBaseballFacilities Mgr.

Tim ClearyMen’s Basketball

Tim HillSoftball

Wynne LobelWomen’s Lacrosse

Severin WalshMen’s & Women’s Wrestling

Sharon RissmillerWomen’s Basketball

Richard WarrenMen’s & Women’s Golf

Alec WebsterMen’s & Women’s Swimming

Brian JacksonMen’s & Women’s Tennis

Tim BoyceCross CountryTrack & Field

Jim BrazeauMen’s Soccer

Eric PitkanenAsst. Athletic Trainer

Morgan CrabtreeWomen’s Soccer

Kip YoshimuraVolleyball

Keith BuckleyFootball

PACI

FIC

Foot

ball


Pacific University

Portland & Mt. Hood

Downtown Forest Grove

Marsh Hall, Forest Grove

Women’s Volleyball; Division III

Pacific University Library; Study

A TEXTURED TRADITIONPacificUniversityisnationallyknownfortransforminglivesandequippinggraduatesfordynamicfuturesbystayingtruetoitsunique162-yearhistoryofservice,strongsenseofcommunityandteachingexcellence.Pacificisatrulyengagingandpluralisticcampus,providingopportunitiesforstudentstobecomemoreinformed,moreinvolvedcitizensandprofessionals,readytocontributetosocietyandtheworld.

LIFE UNFOLDS AT PACIFICAtPacific,facultyandstaffworkcloselywithstudentstoweavetogetherdynamicclassroomexperiences,servicelearning,internationaleducation,internships,research,andco-curricularactivities.TheseingredientspresentadistinctivecombinationoflearningopportunitiesintheacclaimedcollegesofArts&Sciences,Education,HealthProfessionsandOptometry.

Pacificprovidesopportunitiesforstudentpersonalgrowthanddevelopment,creatinglivingtapestriesofunderstandingaboutthemselves,theirdisciplines,andtheirworld,inanatmosphereofthoughtfuldebateamongasocietyoflearners.StudentsattendingtheCollegeofArts&Sciencesarepreparedforthechallengesofgraduateorprofessionalstudy,thedemandsofemployment,andthecomplexitiesofafulfillinglifefromacurriculumbasedintheliberalartswhichembracesthewholeindividual.

GREAT LOCATION WITH A PERSONAL TOUCHPacific’sthreecampuses—ForestGrove,HillsboroandEugene—offerattractive,state-of-the-artandenvironmentallyfriendlyfacilitiesclosetothecoastandmountains.Thecomfortablesmalluniversityatmospherefeaturesalowstudent-to-facultyratio,personalattentionandanatmosphereofthoughtfuldebateamongasocietyoflearners.TheUniversityalsooffersmanyofthe“big”experiencesofferedbylargerinstitutionssuchasstudyabroad/travelcourses,thelatesttechnology,intramuralandNCAAsportsteams,musicandartgroups,andextensivejobandinternshipopportunities.

Follow Us |twitter.com/pacificuLike Us |facebook.com/pacificuSubscribe |youtube.com/pacunivVisit |www.pacificu.edu

PACIFIC AT A GLANCELocation: Forest Grove, Ore.; 25 miles west of Portland and 50 miles east of the Pacific OceanFounded: 1849Enrollment: 3,302 (1,603 undergraduate, 1,699 graduate)Fields of Study: 41undergraduate programs, 13 graduate/professional programsStudent/Faculty Ratio: 13:1Average Class Size: 19Study Abroad: 38 sites in 18 countriesAcademic Calendar: 4-1-4 with January “Winter III” TermCampus: 53 buildings on three campuses (Forest Grove, Hillsboro & Eugene)Athletics: 21 NCAA Division III sports (men and women), intramurals & club sportsScholarships & Financial Aid: Over 90 percent of undergraduate students receive financial aid in the College of Arts & Sciences. Merit-based and need-based awards are given, including Pacific Pacesetters Scholarships (competition held in the winter)Recognition: 2012 “Best Regional Universities” by U.S. News & World Report; 2012 “Best Western Colleges” by The Princeton Review; 2011 “America’s Best Colleges” by Forbes.Tuition & Fees: $33,612 (2011-12)Room & Board: $9,208 (2011-12)Alumni: 22,400

AT YOUR FINGERTIPSPacific SAT Code: 4601Pacific FAFSA Code: 003212Pacific ACT Code: 3488Pacific Financial Aid Code: 003212Admissions Office Phone: 503-352-2218 or 1-800-677-6712Admissions E-Mail: [email protected]

NEARBY RECREATIONOregon Coast • Tillamook State Forest • Banks-Vernonia Linear Trail • Oregon Zoo/Washington Park • Golf Courses • Washington Square Mall • Streets of Tanabourne Mall • Downtown Portland • State Parks • Ski Resorts • Mt. Hood • Whitewater Rafting & Kayaking • Camping Hiking & Biking Trails • Cascade Range • Volcanoes • Fernhill Wetlands • Jackson Bottom Wetlands • Washington County History Museum

DRESSING FOR SUCCESS2012 Uniforms

Home

Pacific Helmets Through The Years

2010-Present

Away

1960 1961-1965

1966-1971 1972-1977

1978-1980 1981-1984

1985-1986 1987-1989

1990-1991

Date Opponent Location TimeThurs., Aug. 30 Simon Fraser Forest Grove 7 p.m.Sat., Sept. 8 at Occidental Los Angeles, Calif. 7 p.m.Sat., Sept. 22 at Willamette Salem, Ore. 1:30 p.m.Sat., Sept. 29 Whitworth* (Homecoming) Forest Grove 1 p.m.Sat., Oct. 6 at Puget Sound* Tacoma, Wash. 1 p.m.Sat., Oct. 13 Pacific Lutheran* Forest Grove 1 p.m.Sat., Oct. 27 at Lewis & Clark* Portland, Ore. 1:45 p.m.Sat., Nov. 3 Willamette* Forest Grove 1 p.m.Sat., Nov. 10 at Linfield* McMinnville, Ore. 1 p.m.

* - Northwest Conference games Home games in Bold TypeAll game times local to game site and subject to change. Visit GoBoxers.com for schedule updates.

facebook.com/pacificuboxers twitter.com/goboxers youtube.com/pacificuboxers

goboxers.com

pacific university football 2012 media guide

Documents

homecoming forest grove

simon fraser forest

collegeway forestgrove

pacific lutheran

comgoboxersyoutube youtube

compacific university

somephotoscourte assistance