poised - placement.isb.eduplacement.isb.edu/recruiter/studentprofile_2010.pdf · age distribution...

65
Student Profile Book 2011 POISED FOR THE WORLD

Upload: others

Post on 07-Jun-2020

1 views

Category:

Documents


0 download

TRANSCRIPT

Page 1: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

1

Student Profile Book 2011

POISEDFOR THE WORLD

Page 2: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

2 3

Student Profile Book 2011

Indian School of Business

Page 3: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

4 5

ContentsDean’s message 6

About the ISB 7

Class of 2011 8

Student clubs: Class of 2011 9

Placement process at the ISB 10

Important dates 11

Contact details 11

PGP core courses 2010 - 11 13

PGP elective courses 2010 - 11 14

Student Profiles - 8 years and above experience 18

Student Profiles - 6 to 8 years experience 28

Student Profiles - 4 to 6 years experience 44

Student Profiles - up to 4 years experience 82

Student Index 123

Page 4: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

6 7

Associate Schools

Dear Associate,

It is with great pride that I introduce to you the ISB’s tenth graduating class of the Post Graduate Programme in Management.

In keeping with the ISB’s vision of grooming future leaders, the ISB has over the nine years, consistently shaped high quality

business leaders, who are valued as much for their analytical capabilities, as for their maturity and leadership skills. The 571

students of the Class of 2011 are well equipped to take this tradition forward.

The Class is diverse in terms of academic, professional and cultural backgrounds. Many of them have international work

experience and have worked across different countries and cultures. They are well-rounded individuals, with much more than

academic achievement to their credit.

At the ISB, we pride ourselves in providing our students with a transformational experience. I am sure that they will bring to

their professional pursuits, a global perspective with an understanding of business practices in emerging markets, and more

importantly, a perceptive mindset to adapt to changing business realities.

We look forward to working with you to provide the best talent for your organisation.

Best Regards,

Ajit Rangnekar

Dean, Indian School of BusinessThe Indian School of Business (ISB) is a

research driven, internationally top ranked,

management institution that grooms business

leaders for India and the world. In a rapidly

changing business landscape, this would

require young leaders with an understanding of

evolving economies and global perspectives.

The ISB is committed to its role in creating

such leaders through its innovative

programmes, outstanding faculty and thought

leadership. With a strong focus on emerging

markets, the ISB brings together best global

practices and relevant research insights

to further its vision of becoming a leading

business school.

Associations with international B-schools

Academic associations with The Wharton

School, The Kellogg School of Management

and The London Business School have helped

the ISB develop a world-class curriculum that

enables students to gain unique insights into

global business. The one year post graduate

programme at the ISB compares with the best

around the world. It is an intense programme,

designed for the most talented students and

taught by world renowned faculty.

Global recognitionThe ISB was ranked 12 among the top

B-schools in the world by the Financial Times,

London. This achievement is particularly

laudable, as it was achieved in just eight years

since the School’s inception. The ISB is the first

Indian B-school to feature in this elite list.

Dean’s message

About the ISB

Page 5: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

8 9

Class size - 571

No.of Students %

Men 424 72%

Women 147 28%

GMAT distribution

750 and above 14%

700 - 740 59%

650 - 690 21%

600 - 640 6%

Industry distribution

Information Technology 27%

Finance 15%

Consulting 14%

Telecom 6%

FMCG 4%

Energy 4%

Real Estate 3%

Automobile 3%

Advertising 3%

Healthcare 2%

Education and Research 2%

Govt./ PSU 1%

Manufacturing 1%

Armed Forces 1%

Others 14%

Work function distribution

IT Consulting/ Products 21%

Operations 19%

Marketing 15%

Finance 9%

Consulting 6%

General Management/ Administration 5%

Accounting 2%

Medicine 1%

Advertising/ Media 1%

Others 21%

Age distribution Avg 27 yrs

35 and above 1%

30 - 35 13%

25 - 30 72%

Below 25 14%

Work experience Avg 5 yrs

8 years and above 6%

7 - 8 years 4%

6 - 7 years 9%

5 - 6 years 14%

4 - 5 years 24%

3 - 4 years 25%

2 - 3 years 18%

The Class of 2011 at the ISB is a diverse pool of experience and exposure. The one year post graduate programme at the

School attracts some of the finest talent from across industries with cross-functional expertise. Diverse backgrounds, including

consulting, finance, marketing, technology, and even defence and medicine ensure a healthy exchange of ideas and a rich

classroom experience.

Business Technology Club

Members 270

Years of Average Experience 5.3

Emerging Markets Club

Members 350

Years of Average Experience 5.7

Entrepreneurship and Venture Capital

Club

Members 320

Years of Average Experience 5.0

Consulting Club

Members 415

Years of Average Experience 4.5

Energy, Manufacturing and Operations

Club

Members 214

Years of Average Experience 4.5

Finance Club

Members 337

Years of Average Experience 4.5

General Management Club

Members 430

Years of Average Experience 4.9

Marketing Club

Members 334

Years of Average Experience 5.0

Net Impact Club

Members 254

Years of Average Experience 5.0

Healthcare Club

Members 130

Years of Average Experience 5.3

Media and Entertainment Club

Members 173

Years of Average Experience 4.8

Real Estate and Infrastructure Club

Members 142

Years of Average Experience 5.0

Retail Club

Members 178

Years of Average Experience 5.0

The wide variety of Student Clubs reflect the diversity of the ISB community.

The Clubs give students opportunities to apply what has been learnt in the

classroom and to gain invaluable leadership and life skills. In addition to

connecting them with others who have similar interests, the students get a

platform to interact with alumni and professionals in their respective fields

of interest, helping them build formal and informal networks, while exploring

career opportunities.

Class of 2011 Student clubs: Class of 2011

Page 6: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

10 11

Policies for Recruiters

The placement process is designed to ensure that both the

recruiter and the student are able to spend quality time with

each other and arrive at satisfying decisions. The Career

Advancement Services (CAS) office at the ISB will work

towards ensuring a flawless placement process.

To optimise the recruiting experience, CAS follows a five-

step process:

• OnlineRegistration

• Pre-placementTalks

• Jobpostings,Applications(ExpressionofInterestand

Resume) and Shortlists

• Interviews

• JobOffersandAcceptances

Online Registration

Recruiters are required to register online at

www.isb.edu/placement. For any assistance in registering,

the CAS team may be contacted. Recruiters are required to

accept the terms and conditions by mailing a printed signed

copy of ‘Terms and Conditions for campus recruitment’

available on the website to the CAS office.

Companies offering Experiential Learning Projects (ELPs)

and wishing to make Pre-placement Offers (PPOs) should

inform the CAS Office and PGP Projects Office before

January01,2011.IfastudentreceivesaPPOitwillbe

considered as One Offer of the two which s/he is eligible for,

and if accepted, it will be treated as an ‘Accepted Offer’ and

the student will be out of the placement process. All other

companies would follow the Placement Process as detailed

below.

Pre-placement Talks (PPTs)

November 01, 2010 onwards

This is an ideal opportunity for companies to share

information about their organisations with students and to

make it possible for them to explore career options.

• TimeslotsforPPTvarybydayoftheweek:

Monday to Friday - 1930 hrs to 2300 hrs

Saturday and Sunday - 1100 hrs to 1730 hrs

• ISBgivesequalopportunitytoallrecruiters.EachPPT

therefore is allotted 45 minutes:

• 30minutesforpresentation

• And15minutestorespondtostudents’queries

• ToregisteradateandtimeforPPT,pleaselogontoour

placement website www.isb.edu/placement

• TheCASOfficewillarrangeforfacilities(audio-visual

and support services) that may be needed for the

presentation. Companies are requested to let CAS

know about their requirements in advance

Job Posting, Applications and Shortlist

• Jobpostingscanbeuploadedbytherecruiteronthe

ISB placement website

• Studentswillrespondbysubmittingtheirapplications

(Expression of Interest and Resume) according to the

company’s deadlines

• Companiesarerequestedtoforwardshortlisttothe

CAS office at least 7 Days before the interview date.

The CAS office will inform the shortlisted students

Interviews

January14,2010onwards:Interviewswillbeheldbetween

0900 hrs to 1800 hrs. The schedule is as below:

Slot Dates Offer opening date & time

Day01 Jan14-16,2011 Jan16,2011@1800hrs

Day02 Jan29-30,2011 Jan30,2011@1800hrs

Day03 Feb12-13,2011 Feb13,2011@1800hrs

Day04 Feb14,2011 Feb14,2011@1800hrs

Day05 Feb15,2011 Feb15,2011@1800hrs

Day06 Feb16,2011 Feb16,2011@1800hrs

Day07 Feb17,2011 Feb17,2011@1800hrs

Day08 Feb18,2011 Feb18,2011@1800hrs

Day09 Feb19,2011 Feb19,2011@1800hrs

Day10 Feb20,2011 Feb20,2011@1800hrs

Subsequently the interview process will continue till March 31, 2011.

Pre-Interview Process: Companies can visit campus to

complete Pre-interview processes earlier to DAY 01.

Companies cannot make offers on these dates. Pre-

interview process includes:

a) Any Questionnaire, written assessment / psychometric

test or group discussions.

Policy for senior students

ISB has senior students with 8 or more years of work

experience. They need a separate process, as they may

have to go through multiple rounds of detailed interviews,

considering their seniority. The placement process for these

students will start earlier.

Job Offers and Acceptance policy

• TheISBallowsastudenttoreceiveTWOoffersor

accept ONE offer. Thereafter, the student exits the

placement process

• Tofacilitatelogisticsforinternationalcompanies/teams,

who cannot come in during the regular placement

schedulestartingonJanuary14,2011,CASallows

them to complete the process earlier. The dates could

be fixed in consultation with CAS. Such companies will

have to hand over sealed Final Interview Forms (FIF)

& offers to CAS and these offers will be opened only

attheendofthefirstdayofPlacements(January16,

2011)

• CompaniesarerequestedtoprocesstheVisa

requirements and other travel formalities, for students

who may have to attend an interview in any of the

client’s international/ domestic locations

• Allcompaniesarerequestedtohandoverthefilledin

FIF to CAS, on completion of the process and to send

the Formal Offer Letter within seven days, to the CAS

Office

• FinalInterviewForm:Tomakeanoffertoastudent,

companies need to complete the FIF

• Attheendofthefinalinterview,ifcompany

representatives are considering making an offer to

the student, they have to fill in the FIF with details of

offer which is then signed by the student

• Ondecidingtomakeanoffer,theofferconfirmation

portion is completed, by the recruiter and then the

FIF is handed over to the CAS Office in a sealed

envelope

• CASwillbroadcastthestudentstatusonthe

placement website at the end of each placement day.

All companies are advised to check the status of their

shortlisted students on the website

• StudentsarerequiredtoconfirmtheirAcceptance/

Rejection of job offers according to the company’s

deadline. The earliest offer acceptance deadline that a

recruiter can ask for is the end of the next placement

day

Placement process at the ISB• Pre-placementoffers:OnorbeforeJanuary01,2011

• Pre-placementstalks:November01,2010onwards

• Jobposting,applications:November01,2010onwards

• Shortlists:Atleast7daysbeforeinterviews

• Interviews:January14,2011onwards

• Joboffersletters:OnorbeforeMarch31,2011

• Youmayusethestudentprofilehandbookasa

reference to understand the diversity at the ISB. We

urge you not to use the handbook for shortlisting

candidates

• Pleasechannelallcommunicationrelatedto

placements only through the CAS office

([email protected])

• DetailedCASpoliciesareavailableonthe

website: www.isb.edu/placement

Shrinivas Hari, [email protected],+919394568035

Kartik Agarwal, ISB Campus [email protected],+919963288022

Kiran Neti, ISB [email protected],+919701473666

Aakash Nagpal, [email protected],+919899040111

Sachiin Rai, [email protected],+919810412821

Vishal Goyal, [email protected],+919818002792

Anil S Kumar, South & [email protected],+919342564953

Amitesh Gir, [email protected],+919920629505

Bhishm Chugani, West [email protected],+919833070100

Important Dates

Contact Details

Page 7: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

12 13

Course Title Faculty and Affiliation

Term1:April26-June6,2010

Financial Accounting in Decision Making Mary Lea McAnally, Texas A&M Shivaram Rajagopal, Foster School of Business MohanVenkatachalam,DukeUniversity

Managerial Economics Amit Bubna, ISB TarunJain,ISB Mudit Kapoor, ISB Bruce W Allen, The Wharton School

Marketing Management Asim Ansari, University of Columbia Rajdeep Grewal, Pennsylvania State University Sundar Bharadwaj, Goizueta Business School ZJohnZhang,TheWhartonSchool

Statistical Methods for Management Decisions Amit Mehra, ISB Ravi Mantena, University of Rochester

Term2:June7-July18,2010

Competitive Strategy Naga Lakshmi Damaraju, ISB Harbir Singh, The Wharton School Raveendra Chittoor, ISB Akbar Zaheer, Carlson School of Management PrashantKale,JesseHJonesGraduateSchoolofManagement

Decision Models and Optimisation Sumit M Kunnumkal, ISB Milind G Sohoni, ISB

Global Economics Sudip Gupta, ISB Amartya Lahiri, University of British Columbia Krishna B Kumar, RAND Corporation

Marketing Decision Making Pradeep Bhardwaj, Sauder School of Business JagmohanSRaju,TheWhartonSchool S Sajeesh, Zicklin School of Business

Term3:July19-August29,2010

Corporate Finance Bhagwan Chowdhry, UCLA Anderson School of Management Suren Mansinghka, University of California, Irvine N R Prabhala, Robert H Smith School of Business Amit Bubna, ISB

Entrepreneurship Atul Nerkar, Kenan Flagler Business School RamakrishnaSVelamuri,CEIBS-China

Leadership Development Programme (One credit compulsory Pass/ Fail Course) E S Srinivas, XLRI Lalitha Maheswaran Rajeshwar Upadhyaya S Ramnarayan, ISB

Managerial Accounting and Decision Making Swaminathan Sridharan, Kellogg School of Management NanduNagarajan,JosephMKatzGraduateSchoolofBusiness Sunil Dutta, Haas School of Business

Operations Management AdityaJain,ISB Ram Bala, ISB

Term 4: August 30 - October 10, 2010

Government, Society & Business Mudit Kapoor, ISB A K Shiva Kumar, UNICEF

Investment Analysis Rajnish Mehra, University of California, Santa Barbara Krishnamurthy Subramanian, ISB Ramabhadran S Thirumalai, ISB Ramana Sonti, ISB

Management of Organisations JonathanPinto,ImperialCollege Niro Sivanathan, London Business School Luis L Martins, McCombs School of Business JamesMSchmidtke,CaliforniaStateUniversity,Fresno

Strategic Analysis of Information Technology Ramnath K. Chellappa, Goizueta Business School Deepa Mani, ISB

PGP core courses: 2010 - 11

Page 8: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

14 15

Course Title Faculty and Affiliation Concentration Area(s)

Term 5: October 11 - November 21, 2010

Advanced Corporate Finance Sankar De, ISB FINC

Business to Business Marketing Sudipt Roy, ISB MKTG

BusinessValuationUsingFinancialStatements Ram Ramakrishnan, University of Illinois at Chicago FINC, ENTR

Change Management S Ramnarayan, ISB STLD

Consumer Behaviour Rishtee Batra, ISB MKTG

Corporate Development: Mergers, Acquisitions and Alliances Naga Lakshmi Damaraju, ISB STLD

Corporate Strategy and Organisation Design Kannan Srikanth, ISB STLD

Entrepreneurial Decision Making Arun Pereira, ISB ENTR

Fixed Income Securities Bruce Tuckman, University of Pittsburgh FINC

International Finance Rajesh Chakrabarti, ISB FINC

Introduction to Indian Marketing (One Credit Pass/ Fail course) Sridhar Samu, ISB NA

Leveraging Web 2.0 - Social Media, Online Advertising Ravi Bapna, Carlson School of Management INTMand Web Analytics VaibhavArya,Media.Net(Directi)

Marketing Research SudhirVoleti,ISB MKTG

Negotiation Analysis Amit Nandkeolyar, ISB STLD, ENTR

Options and Futures Ramabhadran S Thirumalai, ISB FINC

Outsourcing and IT Based Businesses Nishtha Langer, ISB INTM

Pricing Manish Gangwar, ISB MKTG, ENTR

SustainableBusinessOperations:ValueCreationand VaidyJayaraman,UniversityofMiami OPMTEnvironmental Considerations

Term6:November22-January2,2011

Advertising Tanuka Ghoshal, ISB MKTG

Brand Management Sridhar Samu, ISB MKTG

Business Intelligence using Data Mining Ravi Bapna, Carlson School of Management INTM Galit Shmueli, Robert H Smith School of Business

Corporate Control, Mergers and Acquisitions Krishnamurthy Subramanian, ISB FINC

Experiential Learning Programme (Credit 1) NA NA

Financial Engineering Sanjiv Ranjan Das, Leavey School of Business FINC Krishna Ramaswamy, The Wharton School

Financial Statement Analysis Gerald Lobo, C. T. Bauer College of Business FINC Shiva Sivaramakrishnan, C. T. Bauer College of Business

International Marketing VenkateshShankar,MaysBusinesSchool MKTG

Investing in Private Equity Amit Bubna, ISB FINC, ENTR, STLD VinayBNair,AdaInvestmentManagement

Logistics and Supply Chain Management Milind G Sohoni, ISB OPMT

Managing Teams Henry Moon, London Business School STLD

Marketing Services Piyush Kumar, Terry College of Business MKTG

Negotiation Analysis AbhijeetVadera,ISB STLD,ENTR

Power and Politics Tanya Menon, Kellogg School of Management STLD

Strategic Performance Management Dhinu Srinivasan, FINC, STLD, OPMT JosephMKatzGraduateSchoolofBusiness

Strategy Implementation Raveendra Chittoor, ISB STLD

ValueInvesting RaviJagannathan,KelloggSchoolofManagement FINC Ramana Sonti, ISB

Term7:January03-February10,2011

Asset Management VinayBNair,AdaInvestmentManagement FINC

Capital Raising Strategies in Corporations Nikunj Kapadia, Isenberg School of Management FINC, ENTR N R Prabhala, Robert H Smith School of Business

Corporate Governance N K Chidambaran, Graduate School of Business, Fordham University FINC N R Prabhala, Robert H Smith School of Business

Customer-Focused Product Planning VSrinivasan,StanfordGraduateSchoolofBusiness MKTG,ENTR

Economics of Strategy Louis A Thomas, The Wharton School STLD

FinancialValuationofTechnologyBusiness Amit Mehra, ISB INTM, FINC Rajiv D Banker, Fox School of Business

Areas of Concentration: FINC: Finance, ENTR: Entrepreneurship, INTM: Information and Technology Management OPMT: Operations Management, MKTG: Marketing, STLD: Strategy and Leadership

Gender, Diversity and Leadership Stacy Blake-Beard, Simmons College STLD Lynda L Moore, Simmons College

Information Economics TarunJain,ISB FINC

Managing Complexity Edward W Rogers, NASA STLD

Managing Strategic Partnerships Saikat Chaudhuri, The Wharton School STLD Mitrabarun Sarkar, Fox School of Business

Marketing Strategy George Day, The Wharton School MKTG, STLD VKumar,J.MackRobinsonCollegeofBusiness

Marketing Strategy and Economic Analyses David Godes, Robert H Smith School of Business MKTG, STLD

PlanninganEntrepreneurialVenture Kavil Ramachandran, ISB ENTR

Pricing and Revenue Optimization Kalyan Talluri, University of Pompeu Fabra OPMT RakeshVVohra,KelloggSchoolofManagement

Property Finance and Investment Richard Green, University of Southern California FINC

Retailing Ram Rao, School of Management, UT Dallas MKTG, OPMT

ServiceBusinessVenturesandFranchising ChandrasekarV,ISB ENTR

Service Operations Management Sumit M Kunnumkal, ISB OPMT

Strategic Challenges for Innovation-based Start ups Anand Nandkumar, ISB STLD, ENTR

Technology Strategy Consulting Nishtha Langer, ISB INTM, STLD Rajiv D Banker, Fox School of Business

Trading Strategies and Systems VasantDhar,SternBusinessSchool INTM

Transaction Analysis and Modeling Ashish Kohli, Richard Ivey School of Business FINC

Transaction Analysis and Modeling (TURBO) Ashish Kohli, Richard Ivey School of Business FINC

Term 8: February 21 - April 3, 2011

Behavioral Finance Sudip Gupta, ISB FINC

Business Law Sumesh Reddy, Dr Reddy’’s Laboratories ENTR, STLD

Consumer Behaviour Geeta Menon, The Wharton School MKTG

Database Marketing P B Seethu Seetharaman, MKTG, INTM JesseH.JonesGraduateSchoolofManagement Anand Bodapati, Anderson School

Experiential Learning Programme (Credit 2) NA NA

Global Operations Management NViswanadham,ISB OPMT

Global Strategic Management Kannan Srikanth, ISB STLD

Indian Financial System Rajesh Chakrabarti, ISB FINC

Marketing Models Anand Bodapati, Anderson School MKTG

Microfinance Shamika Ravi, ISB FINC, ENTR

Mobile Policy and M-Commerce Gireesh Shrimali, ISB INTM, ENTR

Negotiation Analysis Ruchi Sinha, ISB STLD, ENTR

Operations Strategy AdityaJain,ISB OPMT,STLD

Personal Effectiveness for Leadership E S Srinivas, XLRI STLD

Project Management M R Rao, ISB OPMT

Rural Marketing Harish Bijoor, Bijoor Consultants, Inc. MKTG

Security Markets and Trading Ramabhadran S Thirumalai, ISB FINC

Strategic Innovation Management Anand Nandkumar, ISB STLD, ENTR, INTM

Strategy, Leadership and Resource Management in Kavil Ramachandran, ISB ENTR, STLDFamily Business

The Green Business Gireesh Shrimali, ISB INTM, ENTR

Transformational Leadership: Prasad Kaipa, ISB STLDIgniting the Genius Within Self and Others

Course Title Faculty and Affiliation Concentration Area(s)

Term7:January03-February10,2011(Continued)

PGP elective courses 2010 - 11 PGP elective courses 2010 - 11

Page 9: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

16 17

8YEARS&ABOVE

Page 10: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

18 19

English, Hindi, Telugu, Oriya

B.Sc.,NationalDefenceAcademy,JawaharlalNehruUniversity

10 years 4 months of experience in Defence Services.

Indian Air Force: Squadron Leader (Helicopter Pilot)

• AwardedShauryaChakraforleadershipinTsunami Relief Operations across Andaman and Nicobar Islands

• PlannedandexecutedvarioushelicopteroperationsincludingPresidentialflights, both in international and domestic airspace

• Managedlogistics,budgeting,manpowerutilisationandcareerprogressionof300 personnel in my squadron

• LiaisonwithvariousagenciesofIndiangovernment,andforeigndiplomatswhileon deputation with the United Nations in Sudan

A Vijay Kumar

English, Dutch, French, German

BBS (Accounting and Auditing), Nyenrode Business University, Netherlands

17 years 4 months of experience in Financial Services industry.

Compliciti: Owner

• ImplementedBusinessComplianceStrategyforclients including Dutch and international banks

• TrainedforBusinessCompliance

• Expandedandmaintainedclientnetworks

Netherlands Authority for the Financial Markets: Supervision Officer

• ProjectManagerforimprovementofbusinesssupervision

• Providedadviceoncomplianceissues

Ernst & Young Audit: Senior Staff

• Managedandplannedauditteams

• Performedauditsacrossvariousclients

Bart Korteweg

English, Hindi, Gujarati, Marathi

MS (Computer Science), University of California - San Diego

B.E. (Computer Engineering), Thadomal Shahani Engineering College, University of Mumbai

8 years 8 months of experience in Telecommunications industry.

International Lubricants Pvt. Ltd.: Co-Owner

• Generalmanagementwithregardtochemicalfactoryandpersonnel

Motorola Inc.: Technical Account Manager

• Directedandledtheglobalsoftware,hardware,system,field,testandproduct management teams through the carrier acceptance process

• CustomerrelationshipmanagementandsupportedsalesincreasefromUSD80 million to USD 120 million

Nokia: Software Design Engineer

• Designed,implemented,testedandmaintainedthe2G&3GCDMAProtocolStock

• Instrumentalinthelaunchof20+Nokiaphones

Aaras Pradeep Vasa

English, Hindi, Telugu

MS (Computer Science), University of Minnesota, Twin Cities

B.E. (Electrical Engineering), University College of Engineering, Osmania University

11 years of experience in IT (Services) industry.

Ameriprise Financial Services: Programme Manager

• Directedstrategicandtacticalapproachforcreationandexecutionofadatastorage re-engineering programme (USD 5 million budget)

• AchievedaninfrastructurecostreductionofUSD20millionover3years

V2Tech:FounderandCEO

• Assistingclientswithcreatingtechnologyroadmapsandexecutingthem;Primary clients - public company in pharmacy benefit management, a healthcare startup

Seagate Technology: Senior Systems Engineer

• CreatedroadmaptoconnectR&Dfacilitiesacrossthreecontinentsonasingle platform

Deepa Kodur

English, Hindi

B.E. (Marine Engineering), Marine Engineering Research Institute

9 years 6 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Project Manager

• Executedlargeprojectsinlogisticsandretaildomain for Fortune 200 clients

• Independentlyhandledaccountswithrevenues>USD4million

• Salesteammembertowinaturnkeyoutsourcingdealfromamultibilliondollarluxury retailer

• Managedlargeteams,developedsecondtierleadershipandprovidedmentoring

• BrandAmbassadorawardfromInfosysforexceptionalperformanceinclient management

Abhishek Bisht

English, Hindi, Telugu, Kannada

B.A. (Marketing), B H S First Grade College, Bangalore University

10 years 11 months of experience in Financial Services and Distribution industry.

Indiabulls Financial Services Ltd.: Regional Manager Collections

• Detectedlargescalefraudandtookappropriatemeasures

ValueaddFinancialServices:Partner

• Sourced2500applicationsamonthforHDFCcreditcardsandINR15millionin personal loans per month for Barclays bank

ICICI Bank Ltd.: Area Manager

• Selectedasco-ordinatorforBangaloreandrepresentedSouthZone

Customer Operational Services Pvt. Ltd.: Assistant Manager Operations

• StoodfirstinacertificationprogrammeforadvancedCallCentreManagement

Meridian Electronics Pvt. Ltd.: Director - Sales and Marketing

• BecameSouthIndia’slargestcompanyforvideogames

BPL Ltd.: Branch Manager - Goa

• BecameBranchManagerwithinoneyearofjoining

Deepak Gopal Rao Vudathala

English, Hindi

B.Tech. (Hons.) (Industrial Engineering), IIT Kharagpur

10 years 6 months of experience in Entertainment industry.

ImagesChain Animations (India) Pvt. Ltd.: Founder

• Foundedananimationstudiowithinvestmentsby HNIs and managed its operations

• Attractedinternationalclientele(Pepsi,ColmanCommunications,VeriteProductions) and generated repeat business

• Creationanddistributionofentertainmentproperties,showcasedpropertiesat various international festivals. Won a nomination at FICCI FRAMES in the short-film category

• Createdadvertisements(Nestle,Reckitt)andTVseries(storytime)forbroadcast

Alphadog Procurement Management, Inc.: Software Consultant

Wipro Technologies: Senior Systems Engineer

Adarsh Kumar Jain

English, Hindi, Punjabi, French

B.E. (Mechanical Engineering), Delhi College of Engineering, University of Delhi

10 years 2 months of experience in Diversified Service industry.

Impeccable Communications Pvt. Ltd.: Director

• Commissioned345telecomtowers,laid225kmof optical fiber cable creating assets worth INR 1 billion

• Completeddevelopmentof37,000sftofmanufacturingfacility

Amadeus SAS: Product Development Analyst

• CompletedanalysisanddefinitionofEuropeanleisuretravelmarket

• Partofthecoreteamcreatedtofindsynergiesandintegrateanothertravel reservation company in Germany

Tech Mahindra: Software Engineering

• DevelopedHumanResourceManagementSystemforTechMahindra

• Ledateamof15softwareengineers

Gaurav Sheoran

English, Hindi, Kannada, Tulu

B.E. (Electronics and Communication), Manipal Institute of Technology, Mangalore University

11 years 7 months of experience in IT (Products) industry.

Oracle India Pvt. Ltd.: Group Manager, Development

• Globalproductdevelopmenthead;OracleeBusiness suite SOA integrations, business intelligence and balanced scorecard

• Extensiveexperienceinideation,strategicdirection,productdevelopmentand management

• Topperformeraward,OracleEBS,2008;amongst2000employees

• TwopatentspendinginERPintegration

Trigyn Technologies Ltd.: Technical Lead

• Strongtechnicalexpertise;developedmiddlewarecomponentsforApollo convergent billing system

Tata Consultancy Services Ltd.: Assistant Systems Engineer

• DesignedanddevelopeddatawarehousingsolutionsforGeneralElectric

Arjun Hegde

English, Hindi, Marathi

CA, ICAI

B.Com., University of Pune

11 years 5 months of experience in Investment Banking industry.

Standard Chartered Bank: Director

• StrategicfinancingtransactionsforRelianceADAG, JSW,DLF,Videocon,GTL,Jaypee,Essaretc.

• Lead-managedIndia’slargestrealestateECBdeal

CreditSuisseSecurities(India)Pvt.Ltd.:VicePresident

• LedfinancingtransactionsforWipro,Suzlon,EmaarMGF,Unitech,ICICIBanketc.

ICICI Bank Ltd.: Assistant General Manager

• AcquisitionfinancingtransactionsforTatagroup,Suzlon,UnitedSpirits, Cholamandalam

• StructuredfinancetransactionsforRelianceIndustries,RPG,CromptonGreavesetc.

KotakMahindraGroup:AssociateVicePresident

• DebtCapitalMarket-Sales

• Treasury,ALM&Hedging

Gaurav Shukla

English, Hindi, Spanish

B.Tech. (Civil), IT-BHU

10 years 7 months of experience in Government Services.

Ministry of Finance, Government of India: Assistant Controller General of Accounts

• GOI-WorldBankprojectsonimprovingpublicfinancial management

• CapitalrestructuringcellforPSUs

• Centralplanschememonitoringsystemtomonitorplanfundtransfers

• DeputedtoGermanyfor8monthsforaprogrammeon‘ManagingGlobal Governance’

Ministry of Urban Development, Government of India: Assistant Controller of Accounts

• DesignandcontroloffundtransfermodalitiesforallCPWDdivisions

• InternalauditinMoUD

InstituteofDevelopmentStudies,Jaipur:ResearchAssistant

• Projectsonpovertyalleviation

Arun Sharma

English, Hindi

MCA, Thapar Institute of Engineering and Technology, Patiala

B.Sc. (Computer Science), Shivaji College, University of Delhi

8 years 9 months of experience in IT (Services) industry.

MphasiS Ltd. (an HP Company): Project Lead (Open systems)

• ManagedakeyUSD108,000migrationprojectforapplicationsupporttakeoverfrom Cognizant

• SupportedCallCenterApplicationsfor18monthsmeeting100%SLAs

• Authoredcost-benefitanalysisforanewproject,increasedteamheadcountand revenue by 17%

Siemens Information Systems Ltd.: Associate Consultant (Telecom)

• Institutedprojectbuildprocess,reducingdeploymenttimebyabout50%

• Managedend-to-enddeliveryforathree-monthlyreleaseforaglobalautomajor; implemented in production with zero defects

Girish Malik

Page 11: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

20 21

English, Hindi, Telugu

MS (Technology), BITS Pilani

MS (Finance), Stuart School of Business, Illinois Institute of Technology

8 years 6 months of experience in Consulting industry.

Sol Millennia, Inc.: Founder & President

• FormedanewventuretosegregatetheservicesdeliverybusinessesofUnimind

• Grewrevenuesto~USD2millionbyFY2009

• EstablishedCompanytoprovideBOsupporttoSolMillennia,US

UniMindSoftwareSolutions,Inc.:VicePresident,Partner

• EstablishedConsultingPracticeforsolutionsdeliveryinFinance&SCM

• IncreasedrevenuesfromUSD300,000in2004toUSD6millionin2008

• DevelopedsuiteofITproducts

NaviSite, Inc.: Principal Consultant

• ProvidedSMEinFinanceandSCMSystems

GSS America Infotech: Business Development Associate

• EstablishedGSS-America’sERPPractice

Ibbotson Associates (Now Morningstar): Senior Analyst, Research

Goda Chandrasekhar

English, Hindi

Bachelor of Design in Interior Architecture, Centre for Environmental Planning and Technology, Ahmedabad

8 years 6 months of experience in Hospitality and Interior Design industry.

VatikaHotelsPvt.Ltd.:SeniorManager-ProductStrategy

• Evaluatedandexecuteddesignandserviceproposals, spearheaded collaborations with Starwood Westin’s operations team and aligned theirrecommendationswithVatika’sgoals

• Customisedthesignature‘WestinGuestExperience’fortheIndianmarket

Pradeep Sachdeva Design Associates: Director - Interior Design

• Ledteamtoenterandestablishfirm’spresenceinhoteldesign

• Grewfirmrevenuewithinhoteldesignby300%withseveraltoptier5Starhotelsas clients

Office of Design and Development: Designer

• Accessoryandfurnituredesign

Namrata Mehra

English, Hindi

B.A. (Hons.) (History), Lady Shri Ram College, University of Delhi

10 years 6 months of experience in Textiles and Apparel industry.

Levi Strauss Pvt. Ltd.: Brand Manager - Levis Sykes

• Developedstrategicbranddirectionfor‘Street Sportswear’ line in Levis Sykes - youthwear segment

V.F.ArvindBrandsPvt.Ltd.:Productmanager-HerobyWrangler

• AchievedturnoverofINR150millioninfirst18monthsofoperationwithpenetration of>100counters

Indus Clothing Pvt. Ltd.: Product Manager - Lee Cooper

• Upgradedproductmanagementprocessresultinginincreasedturnoverfrom INR 280 million to INR 550 million in 2 years

Arvind Brands Ltd.: Product Manager - Wrangler

• Executednewproductlaunchfor‘Distress’jeansinrecord45days

Weekender Kids: Assistant Merchandise Manager

• Developedprofitablelineofaccessoriesfromotherproductionfabric-waste

Kavita Singh

English, Hindi

B.E. (Computer Science), IIT Roorkee

11 years of experience in Government Services industry.

Government of India, Indian Police Service: Senior Superintendent of Police, Lucknow, Uttar Pradesh

• RecipientofPresident’sPoliceMedalforGallantry

• Workrationalisation,togetoptimumoutputfromforceof9,600policepersonel reporting to me

• Regularinteractionwithseniorpoliticians,governmentofficialsandseniorcorporates

• Supervisionofcomputerisationofstatepolice

• DevelopedstateoftheartGPS-GISbasedAutomaticVehicleLocationSystem

• HalfwaythroughwebenabledHRMsolutionforstatepolice

Navniet Sekera

English, Hindi, Telugu, Russian

MS(ComputerScience),Fairfax,VA,GeorgeMasonUniversity

B.Tech. (Computer Science and Systems), Gandhi Institute of Technology and Management, Andhra University

14 years 8 months of experience in IT (Services) industry.

VerizonCommunicationsInc.:SeniorProjectManager

• PlannedandexecutedoffshoringofmajorityofSQCfunctionstoIndia

• ImprovedcostofSQCoperationsby30%

• Establishedperformancebenchmarks

VerizonCommunicationsInc.:TechnicalManager

• TransformedexistingreportingsystemtoCXOdash-board

• ArchitectedandLeadconvergenceofBellAtlanticandGTEBillingSystemsasper FCC mandate

Krishna Venkata Naga Rao Durbha

English, Hindi, Swahili, Gujarati

B.E. (Electronics and Communications), Sardar Patel University

8 years of experience in Telecommunications industry.

Indigo Telecom Ltd.: Chief Operating Officer

• Initiatedexpansionofglobalfootprint;helpedsetup Australian subsidiary

• Expandedproductofferingbymorethan300%bysigningupmore3MajorSatellite Network Operators

• HelpedtransformIndigofrombeingastart-uptoamultimilliondollarenterprisewithin 6 years

• Ledplanningandstrategyinitiativesin,policymaking,learning&developmentand operations

New Edge Communications Ltd.: Business Development and Technical Manager

• DesignedandimplementedfirstEmergencyResponseRadioNetworkforNairobi International Airport

Niteshkumar Lalji Dudhia

English, Hindi, Bengali

B.Tech. (Hons.) Mining Engineering, IIT Kharagpur

8 years of experience in Government and Family owned industry.

Government of India - Ministry of Labour: Assistant PF Commissioner

• In-chargeofAdministrationforA.P.Region,comprising 11 offices and 2500 employees

• Achievedrecoverytargetof80%againstaprevious5yearsbestof25%

• Ensuredlegalcompliancebyapproximately1000companiesintheMumbaiRegion

• ReconciledcashaccountsvaluedatUSD6billion,pendingsince1993

Family Business: Manager

• ManagedrefractorybusinessvaluedatINR15million

• ManagedcivilengineeringprojectsvaluedatINR100million

Tata Consultancy Services: Computer Consultant

Manish Kumar

English, Hindi

GNIIT (Advanced Computer Systems), NIIT Delhi

B.Sc. (Biology), Isabella Thoburn College, Lucknow University

8 years 10 months of experience in IT (Services) industry.

MphasiS (an HP Company): Project Manager

• DevelopedtheSchedulercomponentofanAmericanbankinggiant’saward winning post-trade platform that consolidated cash and derivative products into a single portal

Quinnox Consulting Services: Consultant

• Initiatedthecentreforbusinessintelligencesolutions,trainedandmentored resources

• Projectleadandbusinessanalystformanufacturingautomationprojectforan American apparel company

NIIT Technologies: Software Engineer

• GainedexpertiseondifferentReportingandBItoolsworkingwiththelargest automobilecompanyinJapan

Parul Srivastava

English, Hindi

B.Com. (Hons.), Shaheed Bhagat Singh College, University of Delhi

8 years of experience in Manufacturing industry.

Tinna Overseas Ltd.: General Manager (Marketing)

• Territorialresponsibility(25members)-BPNorth, Central-Eastern region - 70% market-base

• Managingandco-ordinatingdemand-supplybetweenrefineryunits,buyersand suppliers

• ConsistentlyachievedtargetsaleINR4-5millionperday,salesgrowthmorethan 50% last 2 years

• Explorednewareasofsales,convincedcompanytoselldirectlytocontractors

Tinna Oils & Chemicals Ltd.: Business Manager - Bio-diesel

• LandacquisitionplantationJatropha-plant

• Tie-upwithuniversitiesjointplantations

Jaitex:Promoter&Proprietor

• Set-uparetaildistributionnetworkinNorthDelhi

Mohit Mittal

English, Hindi

CA, ICAI

B.Com. (Hons.), Hindu College, University of Delhi

8 years 3 months of experience in ITES & Manufacturing industry.

Headstrong Services India Pvt. Ltd.: Manager - Global Revenue

• Processimprovementsaving5man-days

• Handledaccountsreceivablemanagementforthelargestcustomer;improvedDSO metric by 25 days

Timex Watches Ltd.: Treasury Manager

• Treasurysupport,cashflowbudgeting,forecasting

• Transitionedglobalaccountsreceivablecontrollershipandledaccountspayable team

GE Capital International Services: Assistant Manager

• Treasurysupportfor9EuropeanplatformsofGEFleetservices

• LedMatchFundingPolicyComplianceenablingbusinesstohedgeinterestrisk exposure on USD 340 million of net investment

Preeti Pateria

English, Hindi, Marathi, French

Post Graduate Diploma in Management, IMDR, Pune

M.A. (Economics), University of Pune

B.A. (Hons.) (Economics), Ferguson College, University of Pune

8 years of experience in Financial Services industry.

INGVysyaLifeInsurance:DeputyGeneralManager-ProcessManagement

• Headofprojectsandprocessmanagementvertical

• Responsibleforthecontinuousprocessimprovements,whichledtosavingsof INR 20 million

• Designedonlinecustomerportal,whichhashadmorethan2lakhhits

ICICI Prudential Life Insurance Ltd.: Senior Manager - Business Excellence

• ProvidebusinesssolutionsusingSixSigma,automation

• ServiceDeliverySetupforHNIindividuals

• Streamlinedpremiumcollection,costsavingof20%

P&O Nedlloyd: Change Manager - South Asia

• WorkedasachangecatalystdrivingprocessandsystemchangesacrossSouthAsia

Metric Consultancy: Research Trainee

Mukta Karandikar

English, Hindi

PGDBA, Symbiosis Center for Distance Learning

MCA, Indira Gandhi National Open University

BCA, Dynamic College of Professional Studies, Makhanlal ChaturvediNationalUniversityofJournalism

9 years 7 months of experience in IT (Services) industry.

Confidign Solutions Pvt. Ltd.: Co-founder and Manager - Technology Deliveries

• Built,led,managedandmentoredmulti-disciplinaryteamsforinternationaldeliveries for auto majors in work flow process and R&D areas

• Foundedateamtofocusoninnovationintechno-creativesolutions

• ConsultedclientsinoptimisingITspendandportfoliomanagement

• GrewthecompanytorevenuesofEuro1.2million

• Formulatedorganisationalanddeliveryprocessesforoperationalefficiency

DuskValleyTechnologiesPvt.Ltd.:JuniorAssociate-XperienceDesign

• Prototypetheideasofcreativeconsultinggroupusingtechnology

Puneet Gupta

Page 12: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

22 23

English, Hindi

Master in Military Sciences, Defence Services Staff College, University of Madras

B.Sc.,NationalDefenceAcademy,JawaharlalNehruUniversity

23 years 3 months of experience in Defence Services.

Indian army: Instructor Directing Staff

• InstructorforJuniorCommanders

• Operationalstrategyplanningandriskassessmentformilitarywarfare

• AssetManagementandco-ordination

• InstructorforoneofthemostprestigiouscoursesofIndianArmy

Indian Army: Commanding Officer

• CommandedanAirDefenceRegimenthaving1000troops

• AwardedGOC-in-Ccommendationcardforexcellenceincommand

Rajiv Bhargava

English, Hindi, Tamil, French

B.E. (Computers), Pune Institute of Computer Technology, University of Pune

11 years of experience in IT (Products and Services) industry.

Miter Consulting: Partner

• FoundedITriskandfraudreductionventure

• FacilitatedUSD6millionrevenueforclientover18months

EMC Corporation Inc.: Business Manager - Banking & Financial Services - India & SAARC

• HeadedFraudProtectionbusiness

• Revenueover-achievementby245%for2007

• BusinessIndia‘YoungSpokespersons2007’

• Contributedhalfof300%revenueincreasefrom2002to2005

• Built30-resellerpan-Indiadistributionnetworkin2002

Ernst & Young Pvt. Ltd.: Associate Consultant

• ContributedtodoublefigurerevenuesasITESriskspecialist

HCL Comnet (HCL Technologies) Ltd.: Account Manager

• USD5millionrevenuefromBFSIvertical

Srikiran Srinivasa Raghavan

English, Hindi

B.Tech. (Mineral Engineering), Indian School of Mines, Dhanbad

8 years 1 month of experience in Energy/Extractive Minerals industry.

Mecontech FZE: Director

• DevelopedexpertiseinphysicaltradinginLMEmetals

• InitiatedbasemetalbusinessworthUSD8million

Kalyani Carpenter Special Steels Ltd.: Assistant Manager

• ResponsibleforcapitalpurchasesworthUSD15million

• Purchaseplanningofrawmaterialssuchasironoreandcoal

Bramco W.L.L.: Materials Manager

• Responsibleforoverallprocurementforamid-sizedsteelandmetalproducer

• Purchasedrawmaterialinlowmarketsthusbeatingtargetsby50%

SteelAuthorityofIndiaLtd.:JuniorManager(Technical)

• Optimisedironoreprocessingtoenhancequality

Rajnish Kumar

English, Hindi, Bengali

B.E. (Hons.) Computer Science, NIT Durgapur

11 years 6 months of experience in IT (Products) industry.

Hewlett Packard, India Software Operations Pvt. Ltd.: Engineering Manager

• Managedengineeringfor14productfamilieswith revenues of USD 23.5 million

• Ledglobalcross-functionalteamsinIndiaandUSAdrivingandimplementing product roadmap decisions

• Builtteams,ensuredbenchmarklevelsofemployeesatisfaction

• Managedcomplexnetworkingandstorageprojects,achievedProjectManagement Professional Certification

• Enabled3criticalOraclereleasesonHPplatformsworkingwithteamsfromHP& Oracle

Wipro Infotech: Software Engineer

• SupportingTelecomclientsforNortelNetworks

Subhadip Majumder

English, Hindi

B.Sc.,NationalDefenceAcademy,JawaharlalNehruUniversity

14 years 3 months of experience in Defence Services.

Indian Navy: Commander, Executive (Pilot)

• OnlyofficertobeselectedfordeputationstotheIndian Army, Air Force, Coast Guard, Customs and Police

• TheyoungestIndianNavalOfficerselectedfortwoCommandtenuresonboardtwo different warships

• ThefirstofficerselectedfromtheNavytoserveasanAides-de-CamptoanArmy Commander-in-Chief

• Awardedmedalsfordistinguishedserviceinremoteareasandforcurbingterrorism

Rishi Raj Singh

English, Hindi, Tamil, Marathi

B.E.(Instrumentation),VivekanandEducationSociety’sInstitute of Technology, University of Mumbai

8 years 1 month of experience in IT (Products and Services) industry.

Computer Associates India Pvt. Ltd.: Team Lead

• Firstamongfivenewteams,toinitiatecriticalsoftware components ownership transfer

• Ledteamtoconcurrentlydeliveronenhancements,integrationsandcustomerissue fixes

Conexant (India) Pvt. Ltd.: Lead Software Engineer

• PromotedasLeadwithinayearfordeliveringoncriticalprojects

Wipro Technologies: Systems Engineer

• BusinessUnitlevelpaperpresentations

• Awarded‘FeatherInMyCap’(twice)and‘BestDeliveryTeam’

TataConsultingEngineers:JuniorEngineer

• SPoCforInstrumentationDepartmentforFluegasDesulphurizationproject

Sujata Ramachandran

English

BS (Hons.) (Finance & Accounting), Depaul University, Chicago

9 years of experience in Financial Services and Hospitality industry.

PricewaterhouseCoopers: Senior Associate

• Auditofalternativeinvestmentmanagementand broker-dealer clients

• WorkedforaglobalhedgefundclientwithUSD12billionAUM

• ClientsincludedtoptenChicagobasedhedgefund,topthreebroker-dealer,and PE funds

• TeamLeadforimplementationofclient’sfirstcostallocationprocessinanticipationof registration as investment advisor

• AssistedPEclientwithsettingupofaSPVcontainingdebtinterestsofamajorbank

Arlington House International Hostel: Front Desk Manager

Hard Rock Cafe: Supervisor & Corporate Trainer

Saba Bhamidipati

English, Hindi

B.E. (Electronics & Communications), Delhi College of Engineering, University of Delhi

10 years 9 months of experience in IT (Products and Services) industry.

Motorola (India) Pvt. Ltd.: Senior Technical Lead

• Conceptualisedfeatures,definedengineering requirements and co-ordinated end-to-end deliveries for multiple projects on CDMA BaseStationControllerproductforoperatorssuchasVerizon,KDDIandChina Unicom

• Co-ordinatedresolutionsforissuesreportedfromfieldandpre-launchtestactivities

• Publishedtechnicalpapers

Wipro Technologies: Technical Lead

• Ledandsetupteams(bothonsiteandoffshore)formultipleprojectsfortelecom clients across Europe, China and US

Sumit Khurana

English, Tamil, French

B.E. (Hons.) (Computer Science), BITS Pilani

8 years 8 months of experience in IT (Products) industry.

Cisco Systems Inc.: Systems Engineer, Sales

• Pre-salestechnicalrolesupportingAT&T,Cisco’s largest service provider account

• TechnicalsalesresponsibilityforAT&T’scoreandenterprisenetworksworth USD 250 million and USD 80 million respectively in annual revenues to Cisco

• LedsalesanddesigneffortsforcriticalnetworksolutionsthatreducedAT&T’soutage times by 99%

• WonSalesAchieverinFY08andAT&TCoreRegion’sSystemsEngineeringAwards in FY08 and FY10

Sangeetha Narasimhan

English, Hindi, Bengali

B.E. (Electrical Engineering), Bengal Engineering College

9 years 8 months of experience in IT (Services) industry.

Wipro Technologies: Project Manager

• Extensiveexperienceinprojectmanagement,IT consulting and customer relations, handling a USD 10

million account

• Ledcrossculturalteams,deliveredbusinesssolutionsforclientsinSecurities, Telecom and Media

• Incorporatedprocessimprovementinitiatives,whichcutdevelopmentcostby7%

• WorkedinmultiplelocationsinIndiaandUSA

Infosys Technologies Ltd.: Software Engineer

• DesignedanddevelopedNumberPortabilityproductsfortelecomserviceproviders

• Achieved90%performanceimprovementonOraclereports

Supriyo Mukhopadhyay

English, Hindi, Tamil, Kannada

B.E.(MechanicalEngineering),RVCollegeofEngineering,Bangalore University

10 years of experience in IT (Services) industry.

Infosys Technologies Ltd.: Senior Project Manager

• Ledateamof100peopleforrevenueofUSD5million

• Extensiveexperienceinprogrammemanagementand client relationship with Fortune 50 financial services and retail clients

• Ranthefirst100%offshoreproductionsupportprojectinInfosys

• InfosysSixSigmablack-beltcertified;executedanoptimisationprojectthatisstill amongst the top 3 in Infosys

• WorkedacrossBangalore,Chennai,London,Phoenix,MinneapolisandNewYork

Srikanth Chandrasekhar

English, Hindi, Kannada

B.E.(Instrumentation&Electronics),R.V.CollegeofEngineering, Bangalore University

8 years 2 months of experience in IT (Products) industry.

IBM India Pvt. Ltd.: Technical Consultant/ Advisory Software Engineer

• Mappedclient’sbusinessrequirementstoproductscapabilitiesenablingsmooth product adoption

• Ledproofofconceptworkshopsforleadingclientcorporationsworldwide

• DesignedandcommercialisedIBM’snewgenerationapplicationlifecycle management product

• EvangelisedIBMsproductsatglobaltechnicalforumsandcustomerconferences

• Received‘RisingStarofTechnology’awardat12thAnnualGlobalWomenofColor Awards Conference in Atlanta

National Instruments Systems India Pvt. Ltd.: Software Developer

• Designed,developedandtestedproprietaryproducts

IvegaCorporation:SoftwareDeveloper/JuniorAssociate

Swathi Brahma

Page 13: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

24 25

English, Hindi

B.Tech. (Mechanical Engineering), IIT Bombay

8 years 1 month of experience in IT (Services) industry.

Infosys Technologies Ltd.: Project Manager

• CreatednewlineofbusinessforInfosysresultingin increased account revenue of 20%

• DevelopedcomprehensiveMIStodeliverhigh value-added services to HNIs, resulting in improved client retention and acquisition rates by 70%

• Managedlargesized,crossculturalteamsacrossgeographiesleadingtohigh performance, and increased productivity

• LedchangemanagementprojecttosolidifysupportservicesformultipleBUsfora largest investment bank

MphasiS (India) Pvt. Ltd.: Systems Engineer

Vipin Gupta

English, Telugu

M.E. (Computer Science), Cornell University

B.E. (Computers), Chaitanya Bharathi Institute of Technology, Osmania University

13 years 6 months of experience in IT (Products) industry.

Oracle USA Inc.: Principal Technical Staff

• WorkedonVirtualOperatingsystemsandExadata;onepatentfiledandapproved

• PartofArchitectureGroupforOnDemand

• BusinessdevelopmentresponsibilityforOracleServeronplatforms

• HostingCollaborationssuiteforOracle

• MemberoftheOracleStandardsCommittee

Vivekananda Chowdhary Kolla

English, Hindi

M.Sc. (Technology), Weapon Systems, School of Artillery, University of Pune

B.Sc., National Defence Academy, Khadakwasla, JawaharlalNehruUniversity

11 years of experience in Defence Services.

Indian Army: Major

• ExtensiveexperienceinOperations(Logistics),Strategy&PlanningandGeneral Management

• ManagedLogisticsResourcesfor3,000personnel

• PreparedPolicyStatements&QualitativerequirementsforArmyHeadquarters

• MemberofArtillery’s‘FutureAcquisitions’thinktank

• CarriedoutresearchinarmamentsandtrialsofSwedishandIsraeligunsystems costing INR 160 - 180 million apiece

• AwardedChief-Of-ArmyStaffandArmyCommander’sCommendationCardsfor Professional Excellence and Leadership

Vivek Singh

Page 14: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

26 27

6 TO 8 YEARS

Page 15: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

28 29

English, Hindi, Marathi

MS(ComputerScience&Engineering),JohnsHopkinsUniversity, Baltimore, USA

BS (Computer Science & Engineering), Thadomal Shahani Engineering College, University of Mumbai

6 years 2 months of experience in IT (Products) industry.

Amazon.com, Inc. (Seattle, USA): Product and Program Manager

• Launchedbrand-newWebStoreproductwithaggressivetimelines

• LaunchednewWebStorecustomersegments(30%increase),andincreasedflagship account sales (14%)

• ReducedWebStoresupportcosts(7%),attrition(15%)

• QuadrupledscopeofAmazon’scross-functionalavailabilityprogramme (USD 19 million savings)

• Pioneeredcompany-wideadoptionofnewsales-dropmetrics(USD1.5million savings)

• Designedandmaintainedcomplex,business-criticalsystems

eOriginal Inc.: Integration Engineer

• Customerandvendorcustomisationsandfunctionaltesting

Abhishek Chitlangia

English, Hindi

BS(MechanicalEngineering),VirginiaTech,Blacksburg,USA

6 years 9 months of experience in Import & Export industry.

Surface Investments Pvt. Ltd. (A Div. of Midex Global Pvt. Ltd.): Controller of Finance

• Reviveda600metrictonoilseedextractionunit,basedinZimbabwe

MidexGlobalPvt.Ltd.:VicePresident,Project

• Designedanddevelopedmotorcontrolstationswithnextgenerationtechnology

RPI Distributors Inc.: Director, Corporate Services

• Procuredover400consumerproductsfromChina

Orient Centres: Director

• Exportedlow-costhigh-volumegoodslikehandtools,jutebags,brassartware, stainless steelware

Samsung (India) Electronics Ltd.: Engineer, R&D

• Workedonrefrigeratordesignanddevelopment

Abhishek Kapilaansha Mohunta

English, Hindi, Marathi, Gujarati

CA, ICAI

B.Com., Brihan Maharashtra College of Commerce, University of Pune

6 years 1 month of experience in Accounting industry.

Capgemini (India) Pvt. Ltd.: Senior Consultant

• Reviewedmonthlyclosureandmonthlyreporting

• Liaisedwithauditors;wassinglepointofcontactforallaudits

PricewaterhouseCoopers: Assistant Manager

• Preparedauditplanandensureditseffectiveimplementation

• Identifiedandresolvedcriticalaccountingissues

• Conductednegotiationsfornewassignments/newclients

• Conductedinternaltrainingonauditandaccountingtopics

• Value-addedtoclientsintheformofimprovementstoprocessesandfunctions

Aditya Patil

English, Hindi

B.A.(Hons.)(Economics),SriVenkateswaraCollege,University of Delhi

6 years 8 months of experience in Investment Management industry.

Benchmark Asset Management Company Pvt. Ltd.: AssistantVicePresident,NorthIndia

• LedcompletebusinessoperationsacrossNorthIndia

• Launched6products,3becamecompany’stopperformersacrossIndia

• EquityLinkedDebenturesandExchangeTradedFundsbecamemarketleaders

ING Investment Management - Optimix Division: Area Manager

• DevelopedthesalesanddistributionchannelforsalesofassetsworthINR1billion

• ClosedthesinglelargestdealfortheNorthernterritory

Standard Chartered Bank: Credit Analyst

• CreditappraisalandassessmentforSMEclients

IDBI BANK: Assistant Manager

• TradeandForexoperationsforcorporateclients

Aditya Sharma

English, Bengali

B.E.(Hons.)ElectronicsandCommunications,NITJaipur

6 years 10 months of experience in Electronics industry.

LSI Research India Pvt. Ltd.: Senior Design Engineer

• LedUSD130millionproductdevelopmentforZTE,a Chinese telecom company

• ManagedUSD150millionchipdesignprojectforstorageandnetworksystems

• Broughtabout30%improvementinturnaroundtimeforaUSD65milliondesign project

ST Microelectronics Pvt. Ltd.: Design Engineer II

• CompletedchipdesignforsettopboxesusedfortelevisionsinFranceandtheUSA

• SuccessfulimplementationofcablecardchipforScientificAtlanta

Centre for Development of Telematics (C-DOT), Delhi: Research Engineer

• Designandverificationfortelecommunicationsystems

Adwitia Chakraborty

English, Hindi, Marwari, Telugu

MS (Electrical and Computer), University of Arizona, Tucson, USA

B.E. (Electrical and Electronics), Chaitanya Bharathi Institute of Technology, Osmania University

6 years of experience in Electronics industry.

NXP Semiconductors: Technical Lead

• Understandingfeasibilityofnewproductideas,theircompetitiveadvantage, feasibility and time-to-market

• Qualitycontrolofalltheperipheralsofallthesettopboxesinthecompany

• Ledateamof4forthequalitycontrolofacomplexmemorycontroller

• InternalconsultantformergingofNXP&Conexant

Intel Corporation: Senior Design Engineer

• Workedonassemblyofa4coreprocessor,featuresspreadacross7teamsat 8 locations

Synopsys (India) Pvt. Ltd.: R&D Engineer

Ajay Jain

English, Hindi, Marathi, Konkani

MS, Loughborough University, UK

B.Com. (Hons.), D G Ruparel College, University of Mumbai

7 years of experience in Financial Services industry.

CommanderAssetManagement(MiddleEast):VicePresident - Business Development & Deputy Money Laundering Reporting Officer

• HeadofinstitutionalsalesandmarketingforCommander’sflagshipIndiafund

• Establishedthedistributionnetworkforthecompany

• ResponsibleforclientrecordmaintenanceandassistedtheComplianceOfficer

KotakMahindra(UK)Ltd.:AVPClientRelations

• BuiltupAUMofnearlyINR600millionacross15-20HNWfamilies

• HelpedtostructureandmarketaShariah-compliantIndiafocusedequityfund

• DevelopedimportantclientrelationshipsinBahrainandSaudiArabiaforKotak’s

offshore funds

Kotak Securities Ltd.: Manager - Client Relations

Akshay Ashok Bhandarkar

English, Hindi

CA, ICAI

B.Com. (Hons.), Shaheed Bhagat Singh College, University of Delhi

7 years 1 month of experience in Trading / Import / Export industry.

Advanced Telemedia Pvt. Ltd.: CEO

• Suppliedimportedaudiovideoproductstoclients(CommonwealthGames,Adlabs, Infosys)

• Marketedanddistributed15productsofglobalOEMsthroughdistributors,system integrators and agents

• KeyAccountmanagement,ClientServicing,Networking&RelationshipBuilding

• GrewthecompanytoINR150millionturnover

CitiFinancial Consumer Finance India Ltd.: Assistant Manager - Credit & Risk

• Responsibleforcreditapprovals,monitoringdelinquenciesandrisk

• Monitoreddelinquencies,approvalratesandturnaroundtimes

• NominatedforYoungManagersLeadershipSeminar

Aman Gupta

English, Hindi, Marathi

MS (Electrical Power Engineering), Rensselaer Polytechnic Institute, Troy, NY

B.E.(ElectricalEngineering),VJTI,UniversityofMumbai

6 years 6 months of experience in Energy industry.

ABB Ltd. (USA): Consulting Engineer

• ConductedFeasibilityandImpactAnalysisofover 5000 MW generation (conventional and renewable)

• LedaninitiativebetweenABB-USAandABB-Indiaconsultinggroups

• ManagedtransmissionplanningprojectsworthmorethanUSD2million

• InvolvedindesigningofthelargestHVDClinkatJinping-EastChina(800KV, 6400 MW)

• Recipientof‘ABBQualitySaluteAward’fortwoconsecutiveyears

• Projectsinvariouscountries:USA,Canada,SaudiArabiaandSyria

Amit Vishnu Kekare

English, Hindi

BS(ElectricalEngineering),NITJamshedpur

6 years 8 months of experience in Energy & Extractive Minerals industry.

Areva T&D (India) Ltd.: Assistant Manager-Projects

• ExceededsalesandcollectiontargetbyINR100&80 millionrespectively;increasinggrossmargin(1.5%)for

HVPNLproject

• WorkedonSaintGobainMexicoproject,MumbaiRailandEssarSteelprojects

Hindustan Zinc Ltd., Udaipur: Engineer

• TeamLead(16workmen)toensurebreakdownfreeoperationof4000tonneper day mill

• Reducedpowerconsumption,savingINR10millionannually

• Workedon154MWcoalbasedthermalpowerplant

• InvolvedinSixSigmaprojects

Amit Kumar

English, Hindi, Punjabi

B.E. (Manufacturing Processes & Automation Engineering), Netaji Subhas Institute of Technology, University of Delhi

6 years 9 months of experience in Automotive industry.

Maruti Suzuki India Ltd.: Deputy Manager - Marketing (North Zone)

• Managingperformanceof13productsin4ROsand5areaofficescovering147 dealers through 41 Brand-Champions

• SavedINR20millionthroughprice-negotiations(Media-buying)

• ConceptualisationandimplementationofBrand-Campaigns

• AsDeputyManager,TerritorySales(NCR),handled10dealers(turnoverINR700 million) and increased market share from 57% to 64% in six months

• AsAssistantManager,SalesPlanning,handledpan-Indiademandforecastingand distribution of vehicles

Amit Raju

English, Hindi

MBA (International Marketing), University School of Management Studies, GGS Indraprastha University

B.Com., Kirori Mal College, University of Delhi

6 years 10 months of experience in Consulting industry.

Accenture Services Pvt. Ltd.: Senior Consultant

• ProvidedconsultinginthefieldofM&A,postmergerintegrationandorganisational effectiveness

• Workedwithseniorleadershiponpre-salessupport

• Programmeandprojectmanagementincludingsupervisionofsixmemberteam across onshore and offshore locations

• LednationalandinternationalCSRprojects

• Wastheyoungestseniorconsultantinthefirm

Evalueserve.com Pvt. Ltd.: Senior Business Analyst

• Financialresearchonequitystructureofseveralcompanies

Anish Jain

Page 16: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

30 31

English, Hindi, Bengali

Diploma in Hotel Mangement, Institute of Hotel Management and Catering Technology, National Council of Hotel Management and Catering Technology

7 years 9 months of experience in ITES/BPO industry.

GE Money Servicing: Assistant Manager

• Managed30judgementalunderwriterslendingto Consumer and Commercial Credit customers for Retail Consumer Finance business of GE Money Americas

• Doubledcreditapprovalratesduringrecession,keepingdelinquencyratesstable

• Developedmeasurementsystemsforunderwritingefficiency,whichwastakenback to stakeholders in USA

• TransitionedHighTicketdealstoIndia,increasingLendingauthorityofIndialenders from USD 10,000 to USD 35,000

Arindam Mohanta

English, Hindi, Bengali

PGDM (Marketing), Symbiosis Center for Management and HRD

B.A. (Hons.) (English), Lady Shri Ram College for Women, University of Delhi

6 years 10 months of experience in ITES/BPO industry.

TCS eServe Ltd. (previously Citigroup Global Services Ltd.): Senior Manager

• Ledthreeriskanalyticsteamswithmultipleclientmanagementresponsibilitiesacross various Citigroup entities and people management responsibility of 11

• Managedmultiplecross-functionalcreditanalyticsprojects(5to55+millionbusiness revenues annually) across a range of consumer finance products and domains

• SixSigmaGreenBeltCertified

• Receivedawardsforprocessexcellence

Genpact (India): Business Analyst

• Deliveredmultiplecustomeracquisitionandretentionstrategiesforprivatelabelcredit cards

Arpita Ghosal

English, Hindi, Punjabi

B.E. (Hons.) (Electronics and Electrical Communication), Punjab Engineering College, Punjab University

7 years 6 months of experience in Diversified Services.

Taj Hotels (Under TAS Leadership Program): Development Manager

• Asbusinessdevelopmentmanager,oversawThailand(residentrepresentativefor two years), China and Tamil Nadu regions

• Deliverablesincludedmarketentrystrategy,productpositioning,optimalbusiness structure, financial feasibility and project management for INR 1.5 billion Coimbatore, Chennai projects and USD 90 million mixed use luxury resort in Phuket

Tata Services Ltd.: Manager (Tata Administrative Services - TAS)

• StintsatthreeTataGroupcompaniesinStrategy,MarketingandBusiness Development

Tata Consultancy Services Ltd.: Systems Engineer

• Handleddevelopmentandclientinteractionsforforexandinterbanklending platforms

Aseem Kohli

English

B.Sc. (Hons.) (Management Sciences), London School of Economics and Political Science

6 years 8 months of experience in Energy and Investment Banking industry.

Avatar Oilfield Services: Co-Promoter

• Startedandseededanewoilfieldservicesbusiness serving Indian oil and gas exploration companies

• Establishedtechnicalpartnershipswithleadingglobalgeophysicalcompanies

Barclays Capital: Associate, Commodities

• Oneyeartradingtheglobalcrudeoilswapsandfuturesbook(oneofthreetraders on NYMEX and ICE)

• Twoyearsstructuring,marketingandsellingcommodity-linkedstructuredderivatives

British Army: Second Lieutenant (Troop Commander)

• Led60soldiers,servedasapeacekeeperwithNATOinBosnia

Atma Shivalanka

English, Hindi

CA, ICAI

B.Com. (Hons.), Shaheed Bhagat Singh College, University of Delhi

6 years 9 months of experience in Financial Services industry.

Ernst & Young Pvt. Ltd.: Senior Associate

• PerformedfinancialduediligenceforPrivateEquityFundsandstrategicinvestors

• Workedacrosssectors-realestate,power,education,oil&gas,iron&steeland hospitality

• Workedonfinancialmodels

• TeamLead(4members)forcertainstrategicassignments

BSR & Co (member firm of KPMG): Senior

• Performedstatutory,groupandtaxauditsforlistedandunlistedcompaniesacross sectors

• Ledauditteamsindependently

• Partoftheinternaltrainingtaskforce

Bharat Mehra

English, Hindi, Chinese

B.Tech. (Electronics Engineering), Military College of ElectronicsandMechanicalEngineers,JawaharlalNehruUniversity

6 years 5 months of experience in Defence Services.

Indian Army, Corps of Electronics and Mechanical Engineers (EME): Major - Second in Command

• HeadedastrategicIndianArmyUnit,providing360°engineeringsupporttohigh technology equipment worth INR 5 billion

• AchievedOperationalTargetswhileleading150resourcesinsuboptimaland insurgency environment in Kashmir

• Streamlinedandoptimisedoperationallogisticsfor2000troopsthroughcreative problem solving while simultaneously managing 40 key client units

• Ledacoreteamresponsiblefortechnologyinduction/transition

• Awarded4servicemedalsforleadershipexcellence

Chaitanya Pandey

English, Hindi

Ph.D. (Development Communication), GB Pant University of Agriculture and Technology, Pantnagar

M.Sc.(Agriculture-ExtensionEdu.),JawaharlalNehruKrishiVishwavidyalaya,Jabalpur

B.Sc. (Agriculture), GB Pant University of Agriculture and Technology, Pantnagar

6 years 8 months of experience in Banking industry.

Reserve Bank of India: Assistant General Manager

• DirectorintheBoardoftwoRegionalRuralBanks

• HeadingRRBSection,performedallregulatoryfunctionsfor12RRBs

• LeadDistrictOfficerandmemberofDistrictCoordinationCommitteeoffivedistricts, having total planned credit outlay of INR 16.9 billion

• Extensiveexperienceininspectionofpublic,privateandforeignbanks

• Ledvariousteams(size20-25)inCurrencyManagementfunction

Oriental Bank of Commerce: Agriculture Officer

• Appraisedcreditproposals

• Managedbankbranchoperations

Chandra Prakash Joshi

English, Hindi, Punjabi

B.Sc. (Hons.) (Zoology), SGTB Khalsa College, University of Delhi

6 years 1 month of experience in Education industry.

Sapient Corporation: Senior Associate, Learning & Development

• Ledsoftskillslearningmodulesforretailandmedia consultants

• CustomerInterfaceforallprojects

InfoPro India Pvt. Ltd.: Team Leader - Instructional Design

• CapturedclientrequirementsanddefinedscopeforOracleUniversity

• Createdinstructionallysoundtrainingmaterialtomeetlearningobjectivesoftheclient

• CertificationfromInfoProIDcenterofexcellence

Innodata India (P) Ltd.: Associate

• Createdabstracts,keyphrasesforonlinecontent

• Reviewedclientdeliverablesforqualityandcommunicatedwiththeclientfor deliverable acceptance

Daljeet Kaur

English, Tamil

MS (Computer Science), University of Illinois, Chicago

B.E.(ComputerScience),SriVenkateswaraCollegeofEngineering, University of Madras

6 years of experience in Operations and IT Consulting industry.

Manhattan Associates: Principal

• ProjectManagementandClientEngagementatseniormanagementlevels

• ConsultingservicestoseveralindustryleadingU.S.firmsacrossdifferentverticals

• SupplyChainsolutionsimplementationledtocostsavingsofUSD23.4million, 8% increase in inventory shipped and 70% decrease in missed shipments for grocery retailing chain

• Quickcareerprogression,twopromotionsinfirstthreeyears

United Toll Systems: Software Engineer/ Analyst

• Clientengagement,customersupport,issueresolution

• Handledenterprisereportingmodule

Deepak Natarajan

English, Hindi

MCA, Ch. Charan Singh University, Meerut

B.Sc. (Hons.) (Mathematics), Kirori Mal College, University of Delhi

6 years 9 months of experience in IT (Services) industry.

Tata Consultancy Services Ltd.: IT Analyst

• ManagedandimprovedClaimProcessingITlandscapeofanInsurancegiantinpost acquisition scenario

• Re-engineeredapplicationportfolioofHRapplicationsofapharmacompany resulting in 63% reduction in TCO

• ManagedcustomersupportprocessonHRapplicationforaCPGmajor

• UnitlevelappreciationforoutstandingperformanceatPfizer

• Recommendationforout-of-turn(early)promotion(2005-06)

Divya Singh

English, Hindi

B.Tech. (Aerospace Engineering), IIT Kanpur

7 years 5 months of experience in IT (Services) industry.

Times Internet Ltd.: Chief Manager, Technology

• Helpeddevelopthefutureroadmapforevolutionof EconomicTimes.com

• Ledthetechnicalrolloutofthe2010UnionBudgetcoverageonET.com

Sapient Corporation: Manager, Technology

• Ledprojectteamsof25-40peopleacrossgeographies/cultures

• DeliveredUSD2-5millionenterpriseITprojectsforFortune500clients

• Facilitatedkeyclientmeetingsandworkshops

• ActiveparticipationinhiringandLearning&Developmentactivities;formally mentored several junior associates

Gaurav Ganeriwal

English, Hindi, German

M.Tech. (Control and Instrumentation), IIT Delhi

B.E. (Instrumentation and Control), Shri Shantilal Shah Engineering College, Bhavnagar University

7 years 3 months of experience in Automotive industry.

Robert Bosch Engineering and Business Solutions Ltd.: System Project Manager - Active Safety

• DomainexpertinActiveSafetyproductdevelopmentandprojectmanagement

• Ledsoftwaredevelopmentteamsforemergingmarketprojectswithdevelopment cost in the range of millions of Euros

• EstablishedandledtheoffshoredeliveryteamforBoschengineeringcentres(40 engineers, 4 geographies) as Technical Lead (Offshore)

• FormulatedengineeringinitiativesformarketingAnti-lockBrakingSystemsinIndia

Lurgi India Ltd.: Instrumentation Design Engineer (Petrochemicals)

Kartikeya Joshi

Page 17: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

32 33

English,Japanese

B.A.(Philosophy),Japan,UniversityofTokyo

7 years of experience in Religion.

Komyoji Temple: Manager

• RevitalisedthetemplebylaunchingYoungBuddhist Association

• Enhancedthequalityofservicesbyoperational improvements

• Marketedandincreasedawarenessofthetemplethroughwritingsandspeeches

Keisuke Matsumoto

English, Hindi

B.Tech.(ChemicalEngineering),HBTI,ChhatrapatiSahuJiMaharaj Kanpur University

7 years 8 months of experience in Diversified Services.

Anindus Consultants Pvt. Ltd.: Technical Manager

• PatentConsultantandIndianPatentAgentfor software, hardware and automotive industry

• Managerofateamof15patentconsultants,responsibleforrecruitment,trainingand mentorship

TIFAC, Department of Science and Technology: WOS-C Scholarship Trainee

• ReceivedIntellectualPropertyRightslawsandprocesstraining,among30selected countrywide

Hindustan Unilever Ltd.: Research Associate

• ResearchAssociateinDetergentsDivision

• Partofrunner-upteamforbestresearchprojectteamin2002

• Oneamong12SafetywardensinHULR&Ddivision

Konpal Rae

English, Hindi, Marathi, Tamil

Post Graduate Diploma in Hospitality Management, Les Roches, Switzerland

B.Com., SIES College of Commerce & Economics, University of Mumbai

7 years 11 months of experience in ITES & BPO industry.

Hutchison 3 Globalservices Pvt. Ltd.: Process Leader

• LedtheCustomerRetentionsTeamof80for‘3’,aleadingtelecomserviceprovider in UK with customer base of 3.5 million

Convergys (India) Services Pvt. Ltd.: Team Manager

• LedcustomerservicesteamforOptus,aleadingtelecomserviceproviderinAustralia

Firstsource Solutions Ltd. (Formerly, ICICI Onesource): Team Leader

• LedacustomerservicesteamforLloydsTSBBankintheUKfortheirInsurance division

Intelenet Global Services Pvt. Ltd.: Team Leader

• ManagedateamthatprovidedcustomersupporttoHSBC’screditcardcustomersin USA

Lakshminarayan Iyer

English, French

M.Com. (Marketing), University of New South Wales

B.A. (Business Information Management), University of Westminster

7 years of experience in IT (Products) industry.

Dell: Account Executive

• Accountableforgeneratingnewbusinessfrom Fortune 500 organisations

• SecuredoverAUD30millionofserver,storageandsoftwarelicensingcontractswith organisationslikeTalent2,VerizonandSungardin2009

• Manageddesignatedinternalsalessupportstaff

• Awarded‘TopGun’DellSalesAward

Novell: Partner Account Manager

• Providedtraining,presentationsandassistedwithbusinessplanstochannelpartners and distributors

Optima Technology Solutions: Account Manager

• AdvisedandsuppliedtheEducationandGovernmentmarketswithOptimaPCand Networking hardware

Luxsho Logan

English, Hindi, Punjabi

MBBS, Netaji Subhash Chandra Bose Medical College, RaniDurgavatiVishwavidyalaya

6 years 1 month of experience in Defence Services and Healthcare industry.

Indian Navy: Medical Officer

• ManagedEmergencyRoomsandFamilyWelfare Centres at 3 Naval stations

• Trainingofficerforateamof40medicalassistants

• Organisedseminarson‘CommunicationneedsinaHospital’

• Awarded‘WomanoftheYear2008’byRotaryClub,Gujaratfororganising3blood donation camps

• UpgradedthemedicaldepartmentatDaman-addedafunctionalLab(for12,000 personnel) and ensured a well stocked pharmacy

GovernmentMedicalCollege,Chandigarh:JuniorResident

Manjot Kaur

English, Hindi, Telugu, Kannada

MS (Computer Science and Engineering), University of Washington, Seattle

BS (Computer Science), University of Texas - Austin

6 years 6 months of experience in IT (Products) industry.

Tummala Electronics Pvt. Ltd.: CTO

• Establishedwebpresenceforthecompanydealingintelecomequipment

• LedR&Ddivisioninestablishingembeddedsystemsdesignteam

• Providedtelecomequipmenttorailways’operations

Microsoft Corporation: Senior Program Manager

• Responsibleforscopingfeaturesandarchitecturaldesignsofreportingandbusiness intelligence subsystems in Microsoft Dynamics AX 2009

• Managedplanning,execution,anddeliveryoffeaturesacrossteamsinUS,Denmark and India

• Filed5patentsinbusinessintelligencespace

Microsoft Corporation: Software Design Engineer

Manoj Nuthakki

English, Hindi, Gujarati, Marathi

Doctor of Medicine, Topiwala National Medical College, University of Mumbai

MBBS, RA Education Society, University of Mumbai

6 years 2 months of experience in Healthcare industry.

United Nations Children’s Fund (UNICEF)/Mumbai Districts AIDSControlSociety(MDACS):Consultant,PediatricHIV

• Ledateamof100healthcareworkersprovidingmedicalandholisticsupportto HIVpatients

• StrategisedHIVcareprogrammetoincreasethefollowupandtestingrateby3%

• Managementofsupplychain,finance,logisticsandoperationsforHIVprogramme

• ManagedbudgetofoverINR20million

Municipal Corporation of Greater Mumbai (MCGM): Resident Medical Officer

• Implementationofnationalhealthprogrammesinurbanandruralareas

• Teamleaderformedicalreliefanddisastermanagement

Maulek Desai

English, Hindi

EMBA(GeneralManagement),SPJainInstituteofManagement & Research

B.E. (Hons.) (Electrical Engineering), NIT Bhopal

6 years 9 months of experience in Engineering industry.

Larsen & Toubro Ltd.: Manager (Strategic Initiatives)

• Formulated5yearStrategicPlanforSBUsinPowerT&Dspace

• SpearheadedimplementationofStrategicInitiativesbyidentificationofleadership bandwidth, efficient resource allocation and re-alignment of organisational structure

• Planning,co-ordinationandmonitoringofturnkeyelectricalinfrastructureprojects. Clients Included: PGCIL, KPTCL, BESCOM, TNEB etc

• BusinessdevelopmentandpreparationofbiddocumentsforpowerT&Dprojects

• IdentifiedasTop-TalentunderManagementLeadershipProgramme

Mayank Rajvaidya

English, Hindi

BS (Mechanical Engineering), California State Polytechnic University, Pomona

6 years 2 months of experience in Manufacturing industry.

Bevel Gears India Pvt. Ltd.: Executive - Engineering

• Integralroleinshapingcompanystrategyandgrowth map for next 5 years specifically in areas of technical expertise and capital equipment acquisition

• Bevelgearspecialistequipment-joballocation

• Liaisedwithtargetinternationalcustomersincludingsalescallsandcustomervisits

• WorkedwithclientsinUSA,Germany,Italy,Thailand,Japan,UK,Australia,New Zealand to assess their technical requirements and allocate company resources

Mico Bosch: Technical Graduate Trainee

• Completedrecord51pilotordersin6months

Mushtaq Jamal

English, Hindi

B.A. (Hons.) (Economics), Ramjas College, University of Delhi

6 years 7 months of experience in Marketing & Advertising industry.

FireflyeVentures(anHTMediaCompany):SeniorBrandManager

• ManagedbrandmarketingandcommunicationwithbudgetofUSD2.5millionfor Shine.com India’s fourth largest jobsite

• Improvedprocessesandcommunication,therebyreducingcandidatedrop-outs by 10%

Pratham (India’s largest NGO working in the education sector): Consultant

• Providedplanningsupportforeducationalprogrammescovering20,000primary schools and 1.6 million students

Equus Red Cell (A WPP Group Company): Group Account Director

• HelpeddevelopVLCC’smarketingstrategyresultinginrecordgrowthof22% in 2006-07

• Grewagencyrevenuesby20%byadding5newbusinesses

Nadeesh Ramachandran

English, Hindi

B.E. (Computer Science), Sinhgad College of Engineering, University of Pune

6 years 9 months of experience in IT (Services) industry.

Persistent Systems Ltd.: Project manager

• ‘EmployeeoftheQuarter’AwardforbuildingWells Fargo bank into a USD 5 million customer

• Handledteamof60onvariousenterpriseaccounts

• ‘EmployeeoftheBusinessUnit’AwardforCoca-Colaaccountmanagement

• EstablishedTechnologyCompetencyGroupandwonaccounts-USD750,000

• Managedfinancialandlegalaspectsoftheprojects-projectestimates,cost monitoring, statement of work, service agreements, invoicing

Namita Pant

English, Hindi, Tamil, Kannada, French

B.E. (Hons.) (Electrical and Electronics), BITS Pilani

6 years 9 months of experience in Electronics industry.

Cisco Systems Inc.: Software Engineer

• Designed,developed,testedanddeployed telecommunication IP networking systems

• Identifiedandevaluatednewstrategicallianceopportunitiesforsmartconnected networking solutions

• Completedaone-yearGlobalLeadershipProgramme

• Filedtwopatentsforinnovationsinqualityofserviceforinternetbackbone

Tata Elxsi Ltd.: Design and Development Engineer

• DevelopedsupportformultimediaonSmartPhoneoperatingsystem

• Createdasoftwarelifecycleinfrastructurethatwasusedacrossprojectsinthe company

Narendra Kumar

Page 18: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

34 35

English, Hindi, Marathi, Telugu

B.E. (Electronics and Telecommunications), Maharashtra Institute of Technology, University of Pune

6 years 4 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Technology Lead

• Businessintelligenceleadwithexperienceintheretail and logistics sectors

• Regularinteractionwithclientsonbusinessandtechnicalissues

• ExecutedmultipleprojectsatclientlocationsintheUSA

• Mentoredteamontechnicalandfunctionalcompetenciesandprovidedfeedbackto manage performance

• Involvedinestimation,staffingandpre-salesactivitiesinordertoplanforrequired budget and resources

Neelakash Murty

English, Hindi

PG Diploma in Advertising and Marketing, Xavier Institute of Communications, Mumbai University

B.A.(Psychology),JaiHindCollegeandBasantsinghInstituteofScienceandJTLalwaniCollegeofCommerce,University of Mumbai

6 years of experience in Consumer Products industry.

Mount Everest Mineral Water Ltd.: Brand Manager

• RepositioningofHimalayanwater,developmentandexecutionofacross-the-board mass media and on-ground activation programmes

• Focusmarketsselection,consumersegmentation,tradechannelsdevelopment for 200% increase in retail penetration, market research modules for brand, pricing decisions

Lowe Lintas (India) Pvt. Ltd.: Senior Brand Services Manager

• Brandconceptualisation,communicationstrategyfornewTataF&Bproducts

• Advertisingcampaignmanagement;insightminingfornewbusinesspitches

Tata Tea Life: Marketing Deputation

• Executionoflaunchsalesandmarketinginitiatives

Pritish Nandy Communications Ltd.: Assistant to Executive Producer

• Productionco-ordination,in-filmbranding

Neha Mansukhani

English, Hindi, Marathi

B.E. (Electronics and Telecommunications), Army Institute of Technology, University of Pune

6 years 4 months of experience in Telecommunications industry.

Idea Cellular Ltd.: Manager

• CircleLaunchTeamresponsibleforvalueadded services in terms of product development and pricing plans for East hub

Reliance Communications Ltd.: Manager

• Responsiblefor3GMobileTVproductdevelopment

• Rolledoutpan-IndiaMobileTVservicesacrossCDMAandGSMnetworks

Reliance Next Link Pvt. Ltd.: Manager

• ResponsiblefordeployingsecurityautomationsolutionsfortheRelianceGroup

• LedtheSmartCardrolloutfortheentireRelianceADAGroup(23+companies; 60000+employees)

Neil Ashok Taskar

English, Hindi

Project Management Professional, PMI

B.E. (Computer Science), Ramrao Adik Institute of Technology, University of Mumbai

7 years 8 months of experience in IT (Products) industry.

NeubergerBermanLLC.:AssistantVicePresident

• BusinessAnalystinPortfolioManagementverticalofanassetmanagementcompany

• MigratedoperationstoBroadridgeFinancialSolutionsfollowingLehman’s bankruptcy filing

• Executedafundsdisbursementsystemimprovingefficiencyby35%

• Co-ordinatedmigrationofPMS(USD2million)tonewertechnologies

eYork Consulting Inc.: Senior Software Consultant

• DesignedandimplementedaPointofSalessystem(retailclient)optimisingcustomer handling time by 32%

Infosys Technologies Ltd.: Software Engineer (Logistics)

• Teamlead(10developers)forDHL-Airborneintegration

• APACAwardforExcellence

Nidhi Trehan

English, Hindi, Marathi, Gujarati

CA, ICAI

B.Com., R A Podar College of Commerce and Economics, University of Mumbai

6 years of experience in Consulting industry.

Ernst & Young Pvt. Ltd.: Senior Consultant

• Ledprocessimprovementandbusinessdesign projects in retail, consumer products and manufacturing industries

• AssistedIndia’slargestretailerinsettingupaSSCforitsfinanceprocesses

• DesignedbusinessprocessesforanIndianconglomerateforayinginretailoperations

• Suggestedcostreductionmeasuresandpluggedrevenueleakagesatseveralclients

• ConsistentlyledprojectsworthINR10millionandwonadditionalprojectsfrom 80% of my clients

Nihar Thanawala

English, Hindi

M.A. (Economics), Delhi School of Economics, University of Delhi

B.A. (Hons.) (Economics), Miranda House, University of Delhi

6 years 5 months of experience in Financial Services industry.

GE Money Servicing: Assistant Manager

• LedConsumerFinanceRetailAnalyticsteamtocreateanalyticalsolutionsfor optimising portfolio profitability

• Developedanend-to-endretailbankingcrosssellstrategythatgenerated USD 1 million in net income

Deloitte Support Services Pvt. Ltd.: Analyst

• GeneratedcompetitivelandscapereportsfortheFinancialAdvisoryServicesmarket

American Express India Pvt. Ltd.: Business Analyst

• Achieveda10%improvementincustomeracquisitionthroughfinancialand statistical models

• Optimisedcreditcardoffersfora10%incrementalROI

Little Flower School: Administrator

• Managedadministrationoftheschool

Nirajana Mishra

English, Hindi, Tamil, Kannada

Masters In Public Affairs, Public Finance and Policy Analysis, Indiana University, Bloomington

M.A. (Economics), University of Mumbai

B.A. (Hons.) (Economics), St. Xavier’s College, University of Mumbai

6 years 11 months of experience in Consulting industry.

International City/County Management Association: Senior Associate

• Leadconsultantforgovernmentperformancemeasurementsystems,inclient governments

• Developedadvancedreporting/analysisframeworkforclients:broughtinadditional USD 50,000 in revenues

• Leadmonitoring/evaluationspecialistforICMAdevelopmentprojectsinEthiopia, Afghanistan and India

• WorkedwithUSVicePresident’sOfficeinmeasurementoftheRecoveryAct

Public Affairs Centre: Research Analyst

• Conductedresearch/analysisforKarnatakaandOrissaintheareaoflocal governance

Institute of Public Administration and Budgeting: Analyst

• Createdrevenueforecasts/summariesfordistrictsinKarnataka

Nischinth Keshav

English, Hindi

B.E. (Polymer Science and Chemical Technology), Delhi College of Engineering, University of Delhi

6 years 3 months of experience in IT (Services) industry.

Headstrong Services India Pvt. Ltd.: Consultant

• WorkedonprojectsinBFSIdomainforUSbank majors, including investment banks

• ‘CauseforApplause’awardforcontributiontoa3-yearcontract(riskmanagement domain - USD 875,000)

• Workedacrossgeographies-US,UK,GermanyandAfrica

• CertificateofAppreciationfromClaytonHoldingsfordeliveryofmortgagesolutions

Infosys Technologies Ltd.: Software Engineer

• TeamoftheyearawardforDHLpricingproject

• Modulelead(logisticsdomain)within2years

Nishant Gogia

English, Hindi, Portuguese

ME (Computer Engineering), University of Maryland

BE (Electrical Engineering and Computer Science), University of Maryland

6 years 9 months of experience in IT (Services) industry.

Universal Service Administration Company: Systems Manager

• SavedUSD4millionincostforcompanybyin-sourcingfinancialapplication

• CreatedOperationsDivisionlinkingInformationTechnologywithBusiness Development

HSNJLLC.:FounderandCEO

• Managedoperational,financialandHRrelatedprojectsinandaround Washington DC

• ClientsincludedVerizon,FreddieMacandFannieMae

Freddie Mac: Senior Business Analyst

• Reducedtimetopreparefinancialstatementsfrom66to48days

• Receivedthehighestratingamong530employeesinApplicationDevelopment Centre

Nitesh Batra

English, Hindi, Kannada

B.E. (Computer Science and Engineering), National InstituteofEngineering,VisvesvarayaTechnologicalUniversity

6 years 9 months of experience in IT (Products) industry.

Intel Technology India: Technical Marketing Program Lead

• LednewtechnicalmarketingteamacrossIndia,TaiwanandJapanforlow-cost segment products

• EnabledBlu-rayDiscsupportonIntelplatformsatlaunchbyinfluencingvendorsand PC makers

• Definedplatformsoftwarefeaturesandcustomerengagementplansforthree products

• EvangelisedInteltechnologiesandproductsatindustryevents

• Resolvedhigh-impactproblems,enablingcustomers’launchestomarketontime

SLK Software Pvt. Ltd.: Associate Engineer - Software

• SoftwaredevelopmentforAmericanAgricultureResearchCompany

Nithin B Ramachandra

English, Hindi

BS (Computer Engineering), Purdue University

6 years 8 months of experience in IT (Services) industry.

Capgemini US LLC.: Manager

• Experienceindiversesectorsincludingrailways, utilities, media & entertainment, and automobiles

• SpearheadednewbusinessdevelopmentataUSD30billionrailwaysclientselling4 consulting projects worth USD 4 million

• Managed10consultants,scalingasolutionfrom35,000to7millioncustomersfora utility client in 2.5 years

• Awardedforperformance,oneoftheyoungestemployeespromotedtoManagerin North American practice at Capgemini

Nitin Harish Jethanandani

English, Hindi

B.Tech. (Chemical), NIT Tiruchirapalli

7 years 8 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Project Manager (BFSI domain)

• WorkedonsolutionsdeliveryinRiskandCompliance areas for banks

• Managedthedeliveryofthebiggestfixed-bidprojectforInfosys-BankofAmerica account

• Ledandmentoredteamsspreadacrossgeographies-US,Mexico,LatinAmerica, China and India

• ReceivedSPIRITawardfromChairman,BankofAmerica

• SPOTawardfromInfosysformanagingchallengingprojectsituations

• Workedwithpre-salesteamforproposals

Nitin Raj

Page 19: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

36 37

English, Hindi, Gujarati, Nepali, Telugu

B.Tech. (Mechanical Engineering), NIT Warangal

6 years 7 months of experience in FMCG and Oil & Gas industry.

ITC Ltd.: Assistant Manager - Technical

• FactoryManagerofITC’sfoodprocessingunitat Bangalore

• TurnedaroundalossmakingBiscuitManufacturingunit

• ImplementedSixSigmatoolsresultingin3%totalcostreduction

• CertifiedSixSigmaBlackBelt

Hindustan Petroleum Corporation Ltd.: Project Engineer

• ResponsibleforFullProjectCyclesofseveralsuccessfulsub-projects(>500million) for an oil refinery

• Recognisedforaccomplishingcomplex,high-risktaskswithinaPSUset-up

• PMPcertified

Nitin Umanath Dubey

English, Hindi

Graduate Diploma in Apparel Marketing and Merchandising Management, NIFT, Hyderabad

B.A. (Hons.) (Economics), University of Delhi

7 years 9 months of experience in Retail & Wholesale industry.

ITC Ltd.: Assistant Manager

• Developedprivatelabelarchitectureforhypermarkets

• Developedapparelproductqualityprotocol

• Reducedinventoryandimprovedretailmargins

Wal-Mart Inc.: Merchandiser

• Increasedsourcingbusinessby100%forWal-MartMexicoin15months

• DiversifiedASDA(UK)sourcingandstrengthenedvendormatrix

• Managedoneofthelargestaccounts,worthUSD40millionatWal-MartGlobal Procurement India

Taffles Exports Pvt. Ltd.: Merchandiser

• DevelopedMumbaiofficeandstreamlinedoperations

Shahi Export House: Management Trainee

• WorkedwithmajorUSbuyersandsourcingagencies

Parthsarthi

English, Hindi, Nepali, Maithili

B.Tech. (Mechanical Engineering), NIT Warangal

6 years 6 months of experience in Automobile industry.

Bajaj Auto Ltd.: Assistant Manager

• DesignedoptimisedHVACsystem

• Designednovellowcostheatinganddemisting/ defrosting system

Maruti Suzuki India Ltd.: Deputy Manager

• ImplementedchangesinHVACunitofRitztomakeitcompatibleforIndia

• Initiated28costreductionproposalsandachievedcostreductionofINR30million

• Atservicedivision,established17workshopsin12months

Subros Ltd.: Senior Engineer

• VA-VEofHVACassemblytosaveINR219perkit

• Solvedcriticalproblembyre-designingcompressormountingbracket

Prasoon Pallav

English, Hindi

B.A. (ASPM), Delhi College of Arts & Commerce, University of Delhi

7 years 8 months of experience in Financial Services and Hospitality industry.

HSBC Data Processing India Pvt. Ltd.: Manager Operations

• Ledteamsdeliveringcustomer-servicetoUK&USinMortgage-serviceandCredit- card processes

• ManagedMortgage-processmigrationsfromHSBCUK&US

• RecognisedbyHSBCasaHigh-Potentialmanager

HSBC Data Processing India Pvt. Ltd.: Assistant Manager Learning & Development

• Conceptualisedanddeliveredcustomisedworkshopsasperoperational requirements

• LaunchedanonlinelearninginitiativefortheNorth-Americanprocesses

ITC Ltd.: Assistant Manager Food & Beverage

• Memberofpre-openingteamfortwoluxuryproperties

• Devisedsixsuccessfulfood-promotions

• Managedthemanpower-schedulingforF&Boperations

Rajat Sud

English, Hindi, Tamil, Malayalam

MBA (Marketing), Bharathiar University, Tamil Nadu

Bachelor of Corporate Secretaryship, PSG College of Arts & Science, Bharathiar University

7 years 11 months of experience in Commercial Banking and FMCG industry.

Citibank NA: Senior CitiGold Relationship Manager

• WonCountryBusinessManager’scoveted‘Bravo’awardforincreasingassetsunder management by 15 times for a particular customer account and for customer retention

• Handled30%ofBranchAssetsunderManagement

ICICI Bank Ltd.: Regional Marketing Manager, Small Enterprises Group

• Spearheadedmulti-productbusinessgenerationforSMEGroupinTamilNaduand Kerala

ITC Ltd.: Area Executive - Foods

• Territorygrewby122%inconfectionaryand300%inbiscuitsYoY

Hindustan Coca-Cola Beverages Pvt. Ltd.: Excel Trainee - Sales & Distribution

• HighestgrowthachievedintheTirupurmarketYoY-oneofthehighestinTamil Nadu

PepsiCo (India) Pvt. Ltd.: Sales Trainee

Ramachandran A V

English, Hindi, French

B.Tech. (Mechanical Engineering), IIT Delhi

6 years 9 months of experience in Consulting industry.

GRAIL Research: Project Manager

• Managedresearchconsultingprojectsfortelecomand hi-tech clients

• Salessupportforproposaldevelopment

• Developedtrainingprogrammes

• Winner,OutstandingClientServiceAward

UnitedLex:AssociateVicePresident

• PursuedsalesopportunitiesforLPOservices

• DesignedIPProduct/Services

• Developedaclientservicingandanalyticsdashboard

• Won3clientrelationships

Evalueserve: Senior Manager

• Ledagroupof40+MBAsengineers

• Businessdevelopmentanddeliveryplanning

• KeynotespeakerinIPconferences

• Winner-BestPerformer,BestTeam

Rohan Dayal

English, Hindi, Telugu, Kannada

MS (Computer Science), Main Campus, Western Michigan University

B.E. (Computer Science), Main Campus, Bangalore University

7 years 8 months of experience in IT (Services) industry.

GCE / Prime Solutions Inc.: Business Analyst

• Led5memberERPsystemteamliaisingfieldunits,operationsandIT

• End-to-endprocessimprovementinVendorManagementSystem;reduced procurement delays by 30% and payment penalties by 25%

• LedQAautomation,improvingdeliverytimeby20%

• BaggedmaintenancecontractofUSD500,000withUSCoastGuard

Digital Harbor Inc.: QA / Technical Support Specialist

• InstrumentalinQualitycontroltowardsproductsfirstcommercialversion

• LedTechSupportteam,retainingcriticalfundingfromUSDoD

Satyam Computer Services Ltd.: Software Engineer

HCL Perot Systems Ltd.: Software Engineer

Roopa Datla

English, Hindi, Punjabi

B.E. (Civil Engineering), Thapar Institute of Engineering and Technology, Patiala

6 years 5 months of experience in Power Sector

Lanco Infratech Ltd.: Manager

• Executedtwopowerprojectsof1200MWeach

• Achieved25%reductioninengineeringtimeforAnpara C project

• ResolvedissueswithDongfangElectricCorporation(Chinesesupplier)

• SavedINR310millioninprojectcosts

NTPC Ltd.: Senior Engineer

• ImplementedconstructionpackagesworthmorethanUSD100million

• TenderedandawardedpowerprojectpackagesworthmorethanUSD232million

• ObtainedGovernmentbodyclearancesforprojects

Sanjeev Sharma

English, Hindi, Marathi, Malayalam

B.E. (Electronics), D Y Patil College of Engineering & Technology, Shivaji University

7 years 3 months of experience in Marketing & Advertising industry.

Ogilvy & Mather Pvt. Ltd.: Group Account Manager

• ManagedkeyclientssuchasUnilever,Cadbury,Bank of India and IPL

• Partofteamsthatre-launchedbrandslikeCadburyPerk,Cadbury5Star,Closeup, Bank of India and Rajasthan Royals

• PartofO&M’s‘YoungTigers’programme,aninitiativethatidentifiespotentialfuture leaders within the Agency

• FinalistinAdvertisingClubofMumbai’s‘YoungAchiever2008’,anawardthat recognises talented young marketers

Millennium Broadcast Pvt. Ltd.: Assistant Station Engineer

Santosh Narayanan Kutty

English, Hindi, Kannada, Tamil, French

B.E. (Electrical & Electronics), College of Engineering, Guindy, Anna University

6 years 9 months of experience in Education and Automotive industry.

Knowledge Bricks Management and Education Services Pvt. Ltd.: Director

• Propelled80%ofourstudentstoachieveGMATscoreintop2%

• Achieved500%growthratewithin10monthsofoperation

Noesis Education and Management Services (Management Training Institute): Director

• RevenuesofUSD1millionwithin3yearsofoperation

• Grewfromonecitytoeightand500Studentsto3000,withinfirst18months

TVSMotorCompanyPvt.Ltd.:Member-R&D(ProjectLead,TVSPatrolProject)

• DevelopedIndia’sfirstPolicePatrolvehicle

• DesignedIndia’sfirsthybrid2-wheeler;awarded‘ConceptBikeoftheYear,2008’by Overdrive

Santosh Narasimhan Panambur

English, Hindi

MS (Electrical and Computer Engineering), The Ohio State University, Columbus

B.Tech. (Electrical Engineering), IIT Delhi

6 years 5 months of experience in IT (Products) industry.

The Mathworks: Senior Software Engineer

• Executedandmanagedfullsoftwaredevelopmentlife-cycleforcoreMatlab/Image Processing Toolbox projects

• Plannedandexecutednew/incrementalfeaturestosupportscientificandimagefile formats

Pixia Corp: Engineer

• Design,anddevelopmentworkaffiliatedwiththeproprietarytechnologyforlarge image storage

• Ledtheend-to-endWebMapServer(WMS)productdevelopmentanddelivery

British Telecom (R&D): Research Intern

• Conceptualisedanddevelopedaprototypeforamulti-modaldatasharingplatform (Internet/ WAP/ Telephone/ IM/ SMS)

Sun Microsystems (India) Pvt. Ltd.: Engineer

• SoftwareDevelopmentandQualityAssurance

Saurabh Sood

English, Hindi

B.E. (Electrical Engineering), NIT Allahabad

7 years 9 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Technology Lead

• Ledthetechnicalteamanchoringthetakeover and integration of the USD 38 million acquisition of

McCamish Systems by Infosys

• Enabledtop-managementreportingbyconsultingformulti-milliondollarenterprise initiatives for a top US Insurance (Health) major

• Anchoredpre-salesandprojectmanagementactivitiesworthUSD10million (Healthcare vertical)

• Ledcriticalpilotprojectsonthebusinesspipeline

• Received‘InfosysExcellenceAward’fordeliveryexcellence

Sheetal Singh

Page 20: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

38 39

Siddhartha Chatterji

English, Hindi, Punjabi

B.E. (Manufacturing & Automation), Netaji Subhas Institute of Technology, University of Delhi

7 years 8 months of experience in IT (Products) industry.

Stryker Global Technology Center: Project Lead

• Conceptualisedanddesignedawebapplicationfor anewmedicaldevice;led10memberteamforUSD4millionproject,awarded ‘Innovation Award’

• Extensiveexperienceinmanagingmultipleprojects,compliancerequirementsand co-ordination with marketing and surgeon panels

Compro Technologies Pvt. Ltd.: Associate Project Manager

• ManagedaUSD2millionLearningManagementSystemdevelopmentinitiativefor Thomson Learning

Conexant (India) Pvt. Ltd.: Technical Lead

• LedmultipleWi-FiApplicationdevelopmentinitiativesforDellandHuawei

Compro Technologies Pvt. Ltd.: Module Lead

• Designedanddevelopede-learningsuitemodules

Simerjeet Singh

English, Hindi, Telugu, Tamil

MS (Civil Engineering), North Carolina State University

B.Tech. (Civil Engineering), IIT Madras

6 years 5 months of experience in Telecommunications industry.

AT&T Mobility: Senior Technical Architect

• Leddelivery,oversightandsupportinretailsales application,serving3500AT&TStores,achannelworthUSD3+billionofrevenues each year

• Responsiblefordesignandarchitecturaloversight

• Ledinitiativesonmobileplatformapplication

• CIOAwardforiPhoneactivationprocessinnovation

MDI Inc.: Senior Analyst

• Workedonallaspectsfromproductionsupport,applicationdevelopmenttodesign

Sivakumar Venkata Pabolu

English, Hindi, Punjabi

B.Tech. (Computer Science), NIT Warangal

6 years 8 months of experience in IT (Services) industry.

Trilogy E-Business Software (India) Pvt. Ltd.: Project Delivery Manager

• Managedend-to-endconsultingprojectdeliveryfor Fortune 100 Insurance Company (USD 4 million annual engagement)

• Developed‘MarketResponseModel’forautomotivegiant,savingUSD4millionby inventory mix planning

• AwardfromVPSalesforbestproductinterfaceenhancementsthathelpedwina multi million deal

• AwardedapatentinUS-Improvingtheeffectivenessofdemandsensingand prediction

MindTree Consulting Ltd.: Programmer Analyst

• DevelopedpensionplannerforGovernmentofHollandforretirementplanning

Sourabh Kukreja

English, Hindi, Kannada, Tamil

AICWA, ICWAI

B.Com.,RamakrishnaMissionVivekanandaCollege,University of Madras

7 years of experience in the Financial Research KPO industry.

Irevna Ltd., UK: Senior Research Analyst

• Performedbusinessanalystandprojectmanagerroleinatopinvestmentbankin London

Irevna - A Division of CRISIL: Senior Research Analyst

• Workedonanalysisofcorporategovernancedisclosuresofcompaniesinthe Americas, Europe and Asia

• Workedonfinancialresearchprojects

• Involvedinprojectmanagement

Hewlett-Packard Global eBusiness Operations Pvt. Ltd.: Senior Process Associate

• Process expert

• Involvedintraining,projectmanagementandclientinteraction

Srinivas Goutham Ramkumar

English, Hindi

B.Com., M E S College of Arts, Science and Commerce, Bangalore University

7 years 6 months of experience in ITES & BPO industry.

Convergys (India) Services Pvt.Ltd.: Manager - Command Center

• Supplyplanning,operationsmanagementandclientrelationsformultipleclients

• Selection,training,development,performancemanagementof60directreports

Dell International Services: Senior Operations Analyst

• LeadingworkforceoptimisationfunctionforUScustomertechsupport

• Capacityplanning,forecastingresourcerequirementforbusinessgrowth

Genpact: Process Developer

• InvolvedwithMIS,automationofreports,anddashboards

Sudarshan Dujari

English, Hindi, Telugu, Oriya

CFA, Cleared Level II, CFA Institute, USA

B.E. (Computer Science), Orissa Engineering College, Utkal University

7 years 1 month of experience in IT (Services) industry.

Infosys Technologies Ltd.: Technology Lead

• Programmemanagedthedevelopmentoftechnologysolutionsforriskmanagement at the Private Wealth Management department of Goldman Sachs

• BuiltandimplementedathoroughportfolioallocationmodelforHNIsusing proprietary Goldman Sachs models

• Clientandoffshoreco-ordinatorforaUSD50millionrevenueprogramme

• EarnedBestTeamPlayerAwardin2007

• WonMostValuablePlayer(MVP)nominationsin2004and2005

Sudhir Aray

English, Hindi

MS (Microelectronics), Nanyang Technological University

B.E. (Electronics), Shah and Anchor Kutchi Engineering College, University of Mumbai

6 years 9 months of experience in Electronics industry.

Nanyang Technological University: Research Associate

• Ledteamresearchingprintedelectronics,providedexpertiseincircuitdesign

• Productdevelopment/operationsleaderforNanyangTechnologicalUniversity- incubated company (energy storage)

• Teachingpolytechnic,undergraduateandgraduatestudentsonvariousprojects

Chartered Semiconductors Manufacturing Ltd.: Senior Process Integration Engineer

• Ledcross-functionalteamstoachieveorganisationalgoals

• Resolvedcustomerissuecausedbydesignproblems,enabledUSD20million revenue

Labline Instruments: General Manager / Partner

• Increasedrevenuesby75%in3years,andconvertedbusinessfromlossesinto profitability of 20%

Suraj Kamath

English, Hindi, Marathi

B.Sc. (Computers), International College for Girls, University of Rajasthan

6 years 1 month of experience in Financial Services industry.

Kotak Mahindra Bank Ltd.: Manager

• Faceofthecompanytobuildanddeepenrelationships with existing customers

• Handledapproximately250customers,eachwithrelationshipvaluebetweenINR 150,000 and INR 2.5 million

• Tappedthein-housecustomersofdifferentbankingverticalslikeassets,tradeand wealth management customers

• Metrevenueandbranchtargetsbyaggressiveacquisitionofnewcustomers

• Wasrecognisedforcontributionashighestrevenueearnerfortheentireregion

Surbhi Sachin Sawant

English, Hindi, Bengali, Marathi

MS (Computer Science), Wadham College, University of Oxford

B.Tech. (Information Technology), SNDT Women’s University, Bombay

6 years 2 months of experience in IT (Products) industry.

AOL India Pvt. Ltd.: Product Manager - Strategy & BD

• Presentedbusinesscasesforstrategicacquisitionsandpartnershipsforvideo,radio, SHOUTcast and Winamp products

• Completed100smalland4largedeals(BBC,SonyBMG,HMV,NDTV)

Procter & Gamble, UK: Product Manager - SAP Implementation - EMEA

• LedtheUSD8millionupgradeoftheEMEAwideSAPfinancialaccountingsystems

Oracle India Pvt. Ltd.: Member Technical Staff

• DevelopedSLAcompliancesmonitoringsoftwareforOracleEnterpriseManager

Tata Consultancy Services: Assistant Systems Engineer

• DevelopedtradingalgorithmsforthestocktradingportaloftheBombayStock Exchange

Tanushree Jana

English, Hindi, Punjabi, French

Master of Social Sciences, National University of Singapore, Singapore

BachelorofJournalism,LadyShriRamCollegeforWomen, University of Delhi

6 years 6 months of experience in Telecommunications and Research & Consulting industry.

Nokia India: Manager, Consumer and Customer Insights

• Awarded‘GlobalLeadershipAward’forMarketingExcellence

• AwardedforsettingupfirstofitskindRetailAuditProgramme

The Nielsen Company: Manager, Client Solutions Customised Research

• Won‘NielsenArtAward’forexceedingrevenuetargetby35%in2007

• BidandsetupAirtelRelationshipCentreAuditProgramme

IMRB International: Research Executive

• ManagedPizzaHut’sMysteryShoppingProgrammeandBrandTrack

Euromonitor International: Research Analyst

• IndependentlyformulatedtwoIndiaspecificreports-Travel&Tourism’05and Consumer Food Services’05

Tara Anand

English, Kannada, Tamil

M.E. (Industrial Engineering), Texas A&M University

B.E. (Production), PSG College of Technology, Coimbatore, Bharathiar University

6 years 9 months of experience in Financial Services industry.

Capital One Financial Services: Senior Business Analyst

• Developedanoptimalfeewaiverpolicy(creditcards)leadingtoa10%decreasein retention and 15% reduction in calls

• Redesignedinternetmediaefficiencyframework,increasingspendefficiencyby15% (USD2millionannualNPV)

• Delivered10%gaininleadconversionratethroughcreativeandfunctional improvements on the website

• Reducedmarginaloperationscost(creditcardaccounts)leadingtoaUSD20million gain through incremental customer acquisitions

Venkatesh Channaraj

English, Hindi, Bengali

M.A. (Economics), Delhi School of Economics, University of Delhi

B.A. (Economics), St. Stephen’s College, University of Delhi

7 years 11 months of experience in Financial Services industry.

Standard Chartered Bank: Risk Manager, Unsecured Lending

• PortfoliomanagementforSingaporeandMalaysia

• MemberofBaselIIteam

• Quantitativeriskappetiteassessment

American Express India Pvt. Ltd.: Assistant Manager

• Acquisitionstrategyforconsumer/smallbusinessprospects

• USpatentedinventor

• PlatinumRingofRewardforPerformance

Tata Energy Research Institute: Research Associate

• Energysystemmodeling

• MemberofIndiandelegationtoIAEAconference

Page 21: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

40 41

English, Tamil

B.E. (Electronics & Communications), College of Engineering, Anna University

6 years 6 months of experience in IT (Services) industry.

Tata Consultancy Services Ltd.: Information Technology Analyst

• ProjectManager-responsiblefordelivery,strategyandcommunicationfora35 member team. Saved USD 14 million with performance and process tuning initiatives

• ReviewerandpromoterforProcessInnovationfora140memberrelationship

• ITconsultantforIntegrationofamajoracquisitionbyBB&T

• MostValuablePlayerforBB&T-TCSrelationship

• AppreciationandrecognitionfromclientsandTCSmanagementconsistently

Yoganand Sundararajan

Page 22: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

42 43

4 TO 6 YEARS

Page 23: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

44 45

English,Hindi,Marathi,Japanese

B.E. (Electronics and Telecommunication), Sinhgad College of Engineering, University of Pune

4 years 3 months of experience in Electronics and IT (Services) industry.

KPIT Cummins Infosystems Ltd.: Senior Embedded Software Engineer

• ‘Cheers’awardforleadingafirmwareprojectatTokyoforatopJapanese semiconductor company

• ExpandedthescopeoftheprojectforamajorJapaneseclient

• ‘Wow’awardforoutstandingworkin2007

• Published3technicalreports(nowintellectualpropertyoftheclient)

Cognizant Technology Solutions: Programmer Analyst

• WorkedinBFSIdomainoncorporateinvestmentbankingprojectsforaUSbank

Abhijeet Anant Joshi

English, Hindi

M.Sc. (Economics), London School of Economics

M.A. (Economics), Delhi School of Economics, University of Delhi

B.A. (Hons.) (Economics), Ramjas College, University of Delhi

5 years 6 months of experience in Financial Services industry.

American Express: Manager, Decision Sciences and Risk Management

• PortfolioRiskManagementAdvisoryforpartnerbanksinEurope

• ExperienceinleadingandtrainingstaffinRussia,Romania,Greece,Latvia,UKand Hungary

• PatentawardholderfordevelopingportfolioacquisitionstrategiesfortheUSmarket

• Backgroundinportfoliomanagementstrategiesforconsumercreditproductswithan emphasis on quantitative modelling techniques

Abhinav Kala

English, Hindi, Bengali

B.E.(TelecomEngineering),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity

4 years 9 months of experience in IT (Products) industry.

National Instruments Corporation: Project Manager

• Manageddevelopmentofcommunications/RF products;(Teamsize-10to15engineers)

• Releasedsixproductsin2yearsontimeandwithinbudget

• Singlepointforpre-salessupportforIndia,ASEAN,Russia,Arabia,andAustralia

• Evangelisedcommunications/RFproducts

• Awarded‘ProofofConceptMachine’forbuildingPoCsresultinginUSD5million revenue

• AsApplicationsEngineer,received‘OutstandingPerformance’award

Abhishek Nag

English, Hindi, Gujarati

CFA Charterholder, CFA Institute, USA

CA, ICAI

B.Com., Sydenham College of Commerce & Economics, University of Mumbai

4 years 1 month of experience in Financial Services industry.

Deloitte Corporate Finance Services India Pvt. Ltd.: Deputy Manager - Transaction Services

• Perfomedfinancialduediligenceonacquisitioncompanies

• Identifiedsignificantdealissuespertainingtogrossmarginsandrevenuesaffecting valuation

• AssistedanIndianITcompanyinaUSD500millionacquisitionofBPOarmofaUS bank

• Managedteamsonmid-sizedtransactionsuptoUSD100million

• Developedjuniorstaffthroughon-the-jobtraining;mentoredtwosubordinates

Abhishek Satishkumar Rathi

English, Hindi

B.Tech. (Information Technology), NIT Allahabad

4 years 10 months of experience in IT (Products) industry.

Decho Technology India Pvt. Ltd.: Software Test Lead

• Madeauthorisationserverscalablefrom10,000to 1 million users

• Ledquickresponseteamandhelpedinimprovingcustomersatisfactionmetricsby over 30%

• HeadedMozymobileteam,releasedfirsteverversionofAndroidapplicationforthe product

Microsoft India R&D Pvt. Ltd.: Software Design Engineer in Test

• ReceivedanawardforcontributionsmadetowardsreleaseofVisualStudio2005

• LedsustainedengineeringforeVC++,aproductfordevelopingmobilephonebased applications

Achal Gupta

English, Hindi, Kannada, Tamil

B.E. (Electrical & Electronics), National Institute of Engineering,Mysore,VisvesvarayaTechnologicalUniversity

4 years 8 months of experience in Engineering industry.

Techmek Engineers Pvt. Ltd., Bangalore: Regional Head (Chennai)

• Managedfamilybusinessengagedinexecutionofwatersupplyandsanitary installation works

• StartedoperationsinChennaiandachievedINR45millionturnoverin3years

• OversawoperationsoftheBangaloreunit(120members)

Aditya Atreya

English, Hindi, Kashmiri

MS (Computer Engineering), L C Smith College of Engineering, Syracuse University

B.E. (Electronics & Telecommunications), Modern Education Society’s College of Engineering, University of Pune

4 years 9 months of experience in Manufacturing and IT (Products) industry.

Unitherm Engineers Ltd.: Business Development Manager

• AspartoftheCorporateManagementTeam,ledthestrategicplanningandbusiness development activities of the four companies within our Business Group

• Facilitatedgrowthinsalesby105%and165%fortwocompaniesoverthreequarters

Microsoft Corporation: Product Manager

• ManagedateamofProductManagerstoexecutepricing/licensingpoliciesfor product launches across the globe

• ConsultedwithBusinessGroupswithinMicrosofton117products/services launched

Aditya Bakshi

English, Hindi, Gujarati

MS (Computer Science), State University of New York, Stony Brook

B.E. (Computers), Thadomal Shahani Engineering College, University of Mumbai

4 years 2 months of experience in Investment Banking industry.

Goldman Sachs, New York: Analyst Developer

• DevelopedsoftwarecriticaltoGoldmanSachsproprietarytradingdeskformanaging risk and P&L in real-time

• Workedactivelywithtradersandportfoliomanagerstohelpthemmanageequity, credit, and interest rate exposures

• Implementedefficienttradeprocessingforimprovedpositionandriskmanagement

• Rated‘exceedingexpectations’foreachofthe4years,puttingmeinthetopbracket of my peer group

Aditya Shailesh Shah

English, Hindi, Marathi

B.E. (Electronics), Kavi Kulguru Institute of Technology & Science, Nagpur University

4 years 3 months of experience in Energy industry.

Kalki Communication Technologies: Assistant Manager

• BusinessDevelopmentleadforIndianUtilitiesand Public Sector companies

• AsBusinessDevelopmentlead,generatedsalesworthINR40millionforenterprise level energy software

• DevelopedsalesteamforINR500billioninitiativebyIndiangovernmentinpower sector

Areva T&D (India) Ltd.: Engineer - Software

• CommisioningEnergyManagementSystemforGeneralElectricCompanyofLibya, across the country

• TrainingcustomersinsoftwaretoolsatParisheadoffice

Aditya Sohony

English, Hindi

B.E. (Computer Technology), Yeshwantrao Chavan College of Engineering, Nagpur University

4 years 9 months of experience in IT (Products) industry.

Rhythm & Hues Studios India Ltd.: Lead Pipeline Support

• LedsoftwaredevelopmentteamsinIndiaandMalaysia

• Handledtechnologyrecruitmentandoutreachactivities.Invitedtospeakatanumber of Open Source and technology events across India

• Conductedsessionstopromoteawarenessoftechnologyinvisualeffectsamongst students and faculty members of various institutes

• DesignedseveralbusinesscriticalITsolutionsandsystems

• ExtensiveexperiencewithOpenSourcesoftware

Aditya Wasudeo

English, Hindi, French

B.E. (Hons.), Electronics and Instrumentation, BITS Pilani

5 years 9 months of experience in High Technology industry.

Texas Instruments (India) Pvt. Ltd.: Lead Engineer

• Youngestinthebusinessunittoleadateamand deliver an industry-leading wireless IP for European

mobile giants

• Mentoredagroupofengineersandbuiltamulti-functionalteamfordesigning customer critical components of a USD 100 million product

• Awardedcertificatesofexcellenceforbeatingcustomerstandardsofquality

• Createdanautomatedsystemenablinga10%powerefficiencyincreasein multimedia components of wireless devices

Aishwarya Singh

English, Hindi

B.A. (Economics), Kirori Mal College, University of Delhi

4 years 11 months of experience in Consulting industry.

McKinsey Knowledge Centre: Senior Research Analyst

• WorkedinMcKinseyclientteamsforPEand conglomerate clients on strategic due diligence

projects

• Ledanalystteamsonclientprojectsacrossdomains

• Managedanalystdevelopmentprogrammesfortheteam

• Workedwithtwostart-upteamsfocussedoncorporatefinanceandPEresearch

Akash Maheshwari

Page 24: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

46 47

English, Hindi, Tamil, Kannada, Urdu, French

B.E.(ElectricalandElectronics),SriVenkateswaraCollegeof Engineering, Anna University, Chennai

4 years 9 months of experience in Communications industry.

Sasken Communications Technologies Ltd.: Assistant Manager

• InternalandCorporateCommunications-GlobalStrategyandExecution

• Workedonemployeehistoryandcareerplanningsystem-‘TheGenePool’

• Changedmanagementcommunications-internalERPtransitionfromPeopleSoftto SAP

• Setupreal-timeorganisation‘Mood’meterandglobalrecognition‘VirtualMarbles’ tool

• ProfiledbyNASSCOM-CSRchamp-‘MakeaDifference’

• ProfiledbyEconomicTimes-‘GivingRaptheNativeTouch’

Al Ameen Sherfuddeen

English, Hindi, Telugu

MS (Electrical Engineering), University of Cincinnati

B.E. (Electronics), Walchand Institute of Technology, Shivaji University

5 years 2 months of experience in Electronics industry.

Emag Technologies, Inc.: Senior Research Engineer

• Designed,fabricatedandtestedMEMSandRadioFrequencycomponentsonsilicon and PCB

• PartofteamthatdevelopedcompactradarsystemforBoeinginunder6months

• ResponsibleforVendordevelopmentprogramme

Oerlikon USA: Applications Engineer

• Developedandoptimisedplasma-basedetchinganddepositionprocessesfor semiconductor materials

• UsedDesignofExperimentstoreducecustomers’costsby25%

Siloam Biosciences: Fabrication Engineer

• AwardedPatentforbloodseparationdeviceforlabonachip

Alok Jain

English, Hindi

B.A. (Hons.) (Economics), Hansraj College, University of Delhi

4 years 7 months of experience in Consulting industry.

S. R. Batliboi & Co. (member firm of Ernst & Young): Consultant

• Providedconsultingadvicetovariousmultinational clients on their global organisation structure from a tax efficiency and transfer pricing perspective

• Defendedclients’taxpracticesinfrontoftheIndianRevenueAuthorities;amount involved INR 2 billion

• ManagedthelargestGlobalTransferPricingprojectinIndiaspanningover 15 countries

AIESEC,India:VicePresident-Finance

• ResponsibleforplanningandallocatingannualbudgetofoverINR50million

• Ledteamsof14localoffices

• Institutedconsolidatedexternalauditpracticeforall14offices

Aman Raza Khan

English, Hindi

B.E. (Computer Science), Delhi College of Engineering, University of Delhi

4 years 9 months of experience in High Technology industry.

Mentor Graphics: Lead Member Technical Staff

• LedIndianteamtosupportnewHardwareDescription Language in ModelSim, a USD 150 million product

• Responsibilitiesincludeddefiningroadmaps,softwaredevelopmentandclient communication

• Developedanautomatedframeworkwhichimprovedteam’sproductivityby1.5x

UTStarcom India Telecom Pvt. Ltd.: Hardware Design Engineer

• Single-handedlymanageddevice-driverdevelopmentforHardwareTeam

Axiom Softech: Co-founder

• InnovatedResidentialWelfareAssociationManagementSystemandcreated advertising opportunities for local businesses by integrating SMS

• Developedfinancialandproductstrategiesforventure

Amit Dhingra

English, Hindi, Tamil

CFA, Cleared Level III, CFA Institute, USA

CA, ICAI

B.Com., University of Madras

4 years 2 months of experience in Financial Services industry.

Deloitte & Touche (M.E.): Audit Senior

• Ledteamsforduediligenceandbusinessplanreviewsacrosssectorsonbehalfof strategic clients

• AuditandanalysisoffinancialstatementsunderIFRS&USGAAP

• Co-editorofthemonthlynewsletter

• MemberofInjaz-amentorshipprogrammeforyoungArabentrepreneurs

Ernst & Young: Engagement Auditor

• Performedstatutoryandotherauditsandadvisedclientsoninternalcontrolissues

Anand Krishnakumar

English, Tamil

B.E. (Electrical and Electronics), PSG College of Technology, Bharathiar University

4 years 9 months of experience in IT (Products) industry.

Robert Bosch Engineering and Business Solutions Ltd.: Senior Software Engineer

• Createddesigncompetencyintheteamforelectroniccontrolofautomobiles resulting in revenue growth

• Improvedtheoperationalefficiencyoftheteam,indevelopmentofelectronic controls, by 80%

• YoungesttraineratElectronicEngineControlsBusinessUnit(600associates)

• Awarded‘OutstandingPerformer’twice,awardedtotop4%

Infosys Technologies Ltd.: Software Engineer

• Topperofthetrainingbatch

Anand Ramani

English, Hindi, Marathi

Master of Management Studies, MET Institute of Mangement, University of Mumbai

B.Com., R A Podar College of Commerce and Economics, University of Mumbai

5 years 4 months of experience in Marketing & Advertising industry.

Asian Paints (India) Ltd.: Media Manager

• ReducedConsumerActivationprojectcostsby30%byintroducingcompetitive bidding among vendors

• Conceptualiseda6-cityradiocampaignwithaimofcreatingbuzzamongconsumers

Mindshare: Activation Planner

• Manageda5-cityproducteffectivenessdemonstrationexerciseforDomex,across multiple consumer touch points

FCB Ulka Advertising Pvt. Ltd.: Senior Media Executive

• ImprovedcostefficienciesofTVplansby20%foratelecomclient

• TrainednewrecruitsinservicinganFMCGclientattheBangaloreoffice

Anil Ananth Prabhu

English, Kannada, Tamil

B.E. (Chemical Engineering), B M S College of Engineering Bangalore,VisvesvarayaTechnologicalUniversity

4 years 6 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Senior Systems Engineer

• Providedend-to-endcustomersupportforapplications in Insurance and Commodity trading

• Spearheadedthecreationofknowledgerepositoriesandextensivetrainingmodules for customer applications

• Performedclientliaison,managementreportingandapplicationcustomisation

• Conferredwith‘OutstandingPerformance’award

Anisha Krishnan

English, Hindi, Spanish

MS (Computer Science), Centre for Advanced Computer Studies, University of Louisiana - Lafayette

B.E. (Mechanical Engineering), Regional Engineering College, Silchar

5 years 9 months of experience in Investment Banking industry.

Morgan Stanley: Associate, Equity Derivatives Division

• Ledateamtoprovideriskmanagementcapabilityforequityderivativestrading teams globally

• Interfacedwithglobalbusinessunitsanddevelopedprojectroadmapsbycollating diverse requirements

• Developedanimpactmonitoringapplicationforfirm’smarketpositionsunderhigh volatility

Fidelity National Information Services: Developer Analyst II

• Ledateamtoprovideinternetbankingsolutiontobank’scustomersglobally

• Developedandmaintainedanti-moneylaunderingapplicationincollaborationwith the auditors

Anjani Bansal

English, Hindi, Gujarati

CFA, Cleared Level III, CFA Institute, USA

CA, ICAI India

B.Com., H R College of Commerce & Economics, University of Mumbai

5 years 2 months of experience in Investment Banking industry.

PrimeSecuritiesLtd.:VP-CorporateFinance

• IndependentlyoriginatedandexecutedtransactionsintheCorporateFinance domain

• WorkedacrossverticalssuchasPE,M&A,ECM,andDebtSyndication

• RaisedINR330billiondebtforaCDRcompany

• JointlyclosedoutaPEtransactionraisingUSD225millionforaclientintheTextile Space

B.V.Patel&Co.Taxconsultants:Associate

• Auditingofcompaniesintheprivateandlistedspace

• RepresentedclientsinappellatemattersbeforeITOs

Ankit Bharat Patel

English, Hindi, Punjabi, Gujarati

CFA, Cleared Level II, CFA Institute, USA

BS (High Hons.) (Biotechnology), Cook College, New Brunswick, Rutgers University

4 years 6 months of experience in Healthcare industry.

AIM Human Health Services: Manager

• Managedworkingcapital,payables/receivables,reduceddaysinreceivable

• Preparedquarterlyandannualfinancialstatementsanalysis

• Ledmaximumawarded3-yearCARF(CouncilonAccreditationofRehabFacilities) Accreditation, electronic medical record implementation reducing costs 10%, Medicaid non-billable hours 85%

eClinicalworks, LLC.: Implementation Consultant

• ImplementedEMRatphysicians’officesandhospitalsacrosstheU.S.,improving revenue management, efficiency, streamlining processes

Adecco Employment Services: Research Assistant

• Scientificexperimentsandtrendanalysesfortoothpasteproductdevelopmentat Colgate-Palmolive

Ankit Gupta

English, Hindi

Dual Degree - B.Tech. and M.Tech. (Electrical Engineering, Signal Processing), IIT Bombay

4 years 7 months of experience in IT (Products) industry.

Adobe Systems India Pvt. Ltd.: Computer Scientist

• Revampedadefunctteamintoproductteamthatis expected to save USD 10 million annually

• Developedproprietarymediacontainerformatstandard

• Createdactiveclientengagementprocesstosecureandanalyseregularclient feedback

• Transformteamculturefromadhoc,internalgoalsdriventocustomerbased management

• Conferredwith‘SPOT’awardforexceptionalinitiatives

Nvidia Graphics Pvt. Ltd.: Software Engineer

• Developednewcross-functionalalgorithmimprovingvideoperformanceon multimedia products by 10%

Ankit Kumar Mehra

Page 25: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

48 49

English, Hindi

BBS, Shaheed Sukhdev College of Business Studies, University of Delhi

4 years 10 months of experience in Investment Banking industry.

Indcap Advisors Pvt. Ltd.: Senior Associate

• Assistedindealorigination,dealexecutionand negotiations

• Preparedpitchbooks,informationmemorandaandfinancialmodels

Evalueserve.com Pvt. Ltd.: Senior Business Analyst

• Financialmodelingandvaluationusingrelativevaluation,DCFandSOTP

• Preparedresearchnotesforsellsideclients(Telecom&Media)

• ManagedapilotprojectandwonUSD250,000contract

• Received‘Quality&Productivity’award

P.N.VijayFinancialServicesPvt.Ltd.:AssistantManager

• Assistedinportfoliomonitoring

• Identifiednewstocksandmonitoredexistingstocks

Ankur Gulati

English, Hindi

B.E.(Mechanical),SriVenkateswaraCollegeofEngineering, Anna University

4 years 9 months of experience in Manufacturing industry.

Gypcrete Building India Ltd.: Director (Operations)

• CommercialisedanAustralianGreenBuilding Technology in India

• Businessdevelopmenteffortscontributing30%ofthefirm’srevenues

• Ledacross-functionalteamof35tosetupaUSD6millionplant

• WorkedwithgypsumindustryleaderstodevelopproductsfortheSpecialPlasters market

• Developednewlowcostwallingproductstotargetaffordablehousingmarket

Caterpillar Power India Pvt. Ltd.: Manufacturing Specialist

• 6Sigmaprojectlead

• DeploymentofCaterpillarProductionSystemacrossfunctions

Ankur Gupta

English, Hindi, Malayalam, Tamil

B.E. (Electrical and Electronics), Amrita School of Engineering, Coimbatore, Anna University

4 years 7 months of experience in IT (Services) industry.

Mercedes Benz R&D India (MBRDI): Senior Analyst

• InformationSecurityConsultingforallinternalDaimler units across the globe

• SetupandmanagedbusinessforApplicationSecurityandEthicalHacking

• ResponsibleforIndiadivisionroll-outofApplicationSecurityinSoftwareDevelopment Life-Cycle of Daimler

Wipro Technologies: Associate Consultant

• ApplicationsecurityconsultingandteamleadforaBFSImajor

• BusinessDevelopmentactivitiesthroughpre-sales

• ProgressedfromProjectEngineertoSpecialistfurthertoAssociateConsultantin 3.5 years (faster than peers)

Anoop Gopikumar

English, Hindi

B.Com. (Hons.), Hansraj College, University of Delhi

4 years 9 months of experience in Management Research industry.

A T Kearney: Team Leader

• Managedateamwhichcateredtoinformation requirements for communication and hi-tech projects,

conducting market analysis and competitive intelligence

• Identifiedpotentialopportunitiesinknowledgeprocessoutsourcing,eventually shared with the top management for strategic decision-making

Copal Partners: Senior Associate

• Ledateamof12analysts,managingprojectsforclientsininvestmentbankingand equity research

• Won3pilotsaddingUSD1.5milliontorevenue

• Salvagedprojectswhichwereexperiencingqualityissues

Anshul Sachdev

English, Hindi

B.Tech. (Electronics & Communication), NIT Hamirpur

5 years 6 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Technology Lead

• LedtheteamintheimplementationofDrilling& Measurement project for Schlumberger

• AwardedwithexcellenceawardforQ2-2009

Merrill Lynch (India) Technology Services: Associate Consultant

• Instrumentalinautomatingtheworkflowofloanservicingdepartment

• MigratedoldlegacySuperRapidFundingsolutiontonewdistributableweb framework

• Awardedwiththe‘OutstandingIndividualAchievementAward’forQ1-2008

Polaris Software Labs: Technology Engineer

• DevelopedLiquidityMonitoringSystem,aweb-basedsolution

Anurag Sambyal

English, Hindi

B.E. (Hons.) (Chemical), Department of Chemical Engineering & Technology, Panjab University

4 years 9 months of experience in Energy industry.

Baker Hughes Singapore Pte (Baker Atlas): Field Engineer

• Planningandexecutionofwellsitewirelineoperations; responsibleforcrewandequipment(valueUSD>2

million)

• LeadEngineer&‘On-location’focalpointforclients(Shell,Petronas,Reliance,Cairn, NAMCOR & ONGC)

• Workedacrossgeographiesinremotelocations-Malaysia,AfricaandIndia

• CoreValueawardforcontributiontocriticalfieldoperations

• Optimisedrigtimeutilisationtoexpediteoperations(received‘Lettersof Appreciation’ from client)

Anveshan Chaudhary

English, Hindi, Kannada, Telugu

MS (Electrical Engineering), Louisiana Tech University, USA

B.E. (Electronics and Communications), S D M College of Engineering,VisvesvarayaTechnologicalUniversity

4 years 5 months of experience in Telecommunications industry.

QualComm Inc.: Engineer

• Developedanenhancementforvideostreamingapplication

• Broughtdownbugcountleveltozeroinapplicationsforclients

Advanced Micro Devices (AMD): Software Engineer Level 2

• GotpatentsapprovedforChannelZappinginMobileTVTechnology

• Createdanintegratedhardwareandsoftwareplatformformobilehandsets

Wipro Technologies: Project Engineer

• CreatedaCentreofExcellenceforDigitalSignalProcessing-Commgroupand developed Intellectual Property for Wimax Technology

Polycom: Consultant - Software Engineer

• DevelopedUserInterfacefunctionalitiesforteleconferencingproducts

Apoorva Kakkeri

English, Hindi, French, Italian

CFA, Level I, CFA Institute, USA

B.E. (Information Technology), BIT Mesra

4 years 9 months of experience in IT (Products) industry.

Oracle India Pvt. Ltd.: Project Lead (ERP Development)

• Ledateamofsixanddevelopedthetwomost extensively used features of Oracle Financials applications for Fusion ERP

• FusionfeaturesdemonstratedtopotentialcustomersatOracleOpenWorld2008

• LedReceivablesdevelopmentteaminsupportingsixgoldcustomerswiththeir Oracle Release 12 ERP implementations

• AwardedCertificateofExcellencebyGroupVicePresident

• Developedprocessesforreverseengineering;logisticsforpatentfilingunderreview

Arnab Kumar

English, Hindi, Elementary Chinese

B.E. (Electronics & Communications), Manipal Institute of Technology, Manipal Academy of Higher Education

4 years 7 months of experience in Construction and Semiconductor industry.

Sangeeta Exzim Pvt. Ltd.: Director

• Startedmyentrepreneurialventureinconstruction industry

• Tappednewmarketsforsoil-stabilisingpolymertoexceedthesalestargetby50%

• NegotiatedanorderworthUSD200,000fromReliance-ADAG

• ConvincedtheMinistryofSurfaceTransporttoexpediteourproductsapproval process

STMicroelectronics Pvt. Ltd.: Design Engineer - I (FTM/ R&D)

• Innovatedawaytodesignschematics,saving33%design-time

• Co-ordinatedbetweenteamstoreducethebug-resolutiontimeby10%

• Streamlinedthegroupsprojectmanagementpractices

Arpit Goyal

English, Hindi

BBS, Shaheed Sukhdev College of Business Studies, University of Delhi

4 years 9 months of experience in Real Estate industry.

JonesLangLasallePropertyConsultants(India)Pvt.Ltd.:Assistant Manager (Markets & Corporate Solutions)

• Managedglobalandregionalaccounts(Accenture,BankAM,SunMicrosystems)of the firm

• StrategisedpanIndiarealestateportfoliosofcompanies(Microsoft)

• Workedwithrealestatedevelopers(DIAL)toraisefundsfortherealestateprojects

• WorkedwithrealestatePEfundsoninvestments

• Hadwonafewaccounts(STMicroelectronics,Capital)

Capital IQ Inc.: Research Analyst

• Trackingandevaluatingalltheprivateequitytransactionsconcludedglobally

Arun Kawatra

English, Hindi, Tamil, Malay

MS (Manufacturing Systems), Nanyang Technological University

M.E. (Mechanical Engineering), National University of Singapore

B.E. (Mechanical Engineering), National University of Singapore

4 years 8 months of experience in Electronics industry.

Siltronics Samsung Wafer Pte Ltd.: Senior Engineer

• PartofthepioneeringteamtoestablishthenewUSD1billionwafermanufacturing facility

• Implementedandmanagedthemostcomplexandbottleneckprocessofthehigh volume wafer production plant

Micron Semiconductor Asia Pte Ltd.: Process Engineer

• Responsibleforprocesscontrolof3processesnamelyPCBAsingulation,BGAX-ray and PCBA rework

Ashiqul Hameed Rawther

English, Hindi

B.Tech. (Computer Science), MMM Engineering College, Uttar Pradesh Technical University

5 years 6 months of experience in IT (Services) industry.

NASSCOM Foundation: Project Officer

• Conceived,designedandimplementedConnectIT programme

• E-governanceprojectforGOM

apnaIT (incubated by Deshpande Foundation): Social Entrepreneur (CEO)

• Ledateamof22,providingsolutionstononprofits,schoolsandcolleges

• PartneredwithGoogleCSRtoinfluencemorethan80nonprofitorganisations adopt IT

• TaughtITskillsto60socialentrepreneurs

• LedanRTImovement;authoredabookonRTI

Tata Consultancy Services Ltd.: Quality Assurance Lead (Enterprise storage)

• Ledqualityassuranceteam

• SuggestionsoninternalrestructuringimplementedbyCTO

Ashutosh Pratap Singh

Page 26: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

50 51

English, Hindi

B.A. (Economics), St. Xavier’s College, University of Mumbai

5 years 2 months of experience in Financial Services industry.

Yrals: Business Head/ Partner

• Partneredastartupandinitiatedstrategiesthat generated revenue worth INR 3 million in a short span

Mecklai Financial and Commercial Services: Senior Analyst

• AssistedcompaniesinmanagingtheirtreasuryoperationsworthoverUSD400 million

• Advisedcompaniesonforexderivativesandcomplextradingstrategies

• HelpedclientsmanagetheirECBandFCCBportfolio

Citibank NA: Executive

• ManagedequityinvestmentsforHNIclients

Man Financials: Analyst

• TradedinForexandcommoditiesforIndianandAsianclients

MatrixClothing:JuniorExecutive

• CreatedresearchreportsonentryintoEuropeanmarkets

Ashutosh Singh

English, Hindi, Kannada, Telugu

B.E. (Information Science), National Institute of Engineering,Mysore,VisvesvarayaTechnologicalUniversity

4 years 9 months of experience in Non-Profit & NGO industry.

Divyadeepa Trust: Director Strategy and Fund Raising

• Builtandmanagedacoreteamof6

• Conceptualisedsustainablemodelforvolunteering,developedpartnershipswith various colleges. Also Involved in media campaigns

• EventManagerforMysooruUnplugged(http://mysooruunplugged.info)

• FoundedTeesForChange(http://teesforchange.info),asocialventuretosustain non-profits

• RaisedINR10million

JuniperNetworksFoundationFund:SocialEntrepreneur

• Ledateamof3toimplementCSRprojects

• ManagedUSD600,000funding

Ashwin Gopala Krishna Shetty

English, Hindi

CA, ICAI

B.Com. (Hons.), St. Xavier’s College, University of Calcutta

4 years 4 months of experience in Financial Services industry.

Kotak Securities Ltd.: Financial Analyst

• WorkedasanEquityResearchAnalyst(diversified mid-caps) covering more than ten companies across sectors

• Presentedinvestmentanalysistoleadingglobalinstitutionalinvestors

• Responsibleforindependentlyauthoringresearchreportsinjust1.5years,against industry average of 3-4 years

Morgan Stanley Advantage Services Pvt. Ltd.: Associate

• WorkedaspartoftheBasicMaterialGroup(InvestmentBankingDivision)

• Supportedglobalteamsinmakingpitchbooks,valuationmodelsandindustry analysis

Augustya Keshav Somani

English, Hindi, Bhojpuri

B.Tech. (Petroleum Engineering), ISM Dhanbad

4 years 9 months of experience in Energy industry.

Cairn India Ltd.: Senior Petroleum Engineer

• IncreasedthepotentialofKGgasfieldsatelliteby15%, got an out-of-turn promotion for the same

• Deliveredthefirstphaseofdigitaloilfieldprojectin Rajasthan

• Implementedaprocessincreasingtheproductionofanoilfieldby15%

• Preparedproductionforecastsforbusinessplan

Reliance Industries Ltd. (Petroleum Business): Reservoir Engineer

• MonitoredJVactivitiesforBlock-9assetinYemen

• PartofdelegationvisitingYemenforbusinessdevelopment

Avinash Kumar

English, Hindi, Bengali

B.E. (Electronics & Communications), CMR Institute of Technology,VisvesvarayaTechnologicalUniversity

4 years 5 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Technical Analyst

• Involvedinpre-salestobagaUSD150,000project

• Leada10memberteamacross3continentsforaglobalapplication

• BusinessIntegrationprojectforKraftbymigratingtheirnativeapplicationsintoSAP ERP

• AsKManchor,developedaknowledgeportal

• CertificateofAppreciationbyKraftCIOforimplementationin68countries

• WinnerofBestProjectAwardandconsistenthighfeedbackratingsfromclients

Avishek Chandra

English, Hindi, Telugu

B.Tech. (Electronics and Communications), Indur Institute ofEngineeringandTechnology,JNTUHyderabad

4 years 2 months of experience in IT (Products) industry.

Honeywell Technology Solutions Pvt. Ltd.: Senior Engineer

• ExtensiveexperienceinIntellectualProperty Management

• EstablishedanewbusinessdomainforAircraftCabinManagementSystemsinIndia

• OnsiteCo-ordinatoratPhoenix,USAforAircraftDiagnosticsandMaintenance Systems portfolio for the world’s largest aircraft manufacturer

• Ledteamsresponsibleforimprovingrealtimesystemperformancemeasurement accuracy in aircarft

• Won‘PartnerAward’and‘IndividualExcellenceAward’forperformanceexcellence

Bharath Bhushan Aitha

English, Tamil

CWA, ICWAI

B.Com.,SrimathiDNBhattVaishnavCollegeforWomen,University of Madras

4 years 3 months of experience in FMCG and IT (Services) industry.

ITC Ltd.: Assistant Manager - Finance

• ResourcemanagementandvendormanagementforsupplychainworthINR400 million

• Productcosting,contributionmanagementandcorememberof‘Planningand Budgeting’ team

• IndependentvendorauditorforbusinessworthINR250million

• Assistedailingmicroenterprisesturnaround,resultinginemploymentgenerationfor rural women

Tata Consultancy Services Ltd.: Trainee - Process Associate

• Co-ordinatorformonthlymanagementpresentationofbusinessverticals

• Responsibleforteam’squalityassurance

• Laiddowndocumentmanagementsystems

Bhargavi V

English, Spanish, Italian, French

M.E. (Computer Science), Universidad of Zaragoza, Spain

B.E. (Computer Science), Universidad of Zaragoza, Spain

4 years 3 months of experience in Aerospace industry.

Indra Sistemas Madrid (Spain): International Consultant - Air Traffic Management (ATM)

• CompilationandinterpretationofCompetitiveIntelligenceDatafortheATMmarket

• Highinvolvementinpricingproceduresofprojects

• ParticipationinthedesignofthemarketingcampaignandmerchandiseforATM products worldwide

Embassy of Spain Tel Aviv (Israel): Associate

• Workedfor1yearintheEconomicandCommercialOfficethroughanICEX scholarship (Spanish Government Foreign Trade Agency)

Carlos Albert

English, Hindi

BMS, H R College of Commerce & Economics, University of Mumbai

4 years 1 month of experience in Investment Banking and Private Equity industry.

AavishkaarVentureManagementServices:ProjectAssociate

• Createdthepitchforinvestorsforsecondmicrofinancefund

• Evaluatedthesocialandenvironmentalperformanceofthemicroequityfund

• Completedaninvestmentinastartupmicrofinanceinstitution

JPMorganChase:Analyst

• Createdamodelforaccountinganalysisintheconsumerandretailspace

• Publishedthreecreditratiohandbooks,ahighyieldcreditreportandservices handbook

• Thesectorteamwasranked#1by‘InstitutionalInvestor,EMEA2008’

Chandini Hundalani

English, Hindi, Tamil

MS (Mechanical Engineering), University of California, Santa Barbara

B.Tech. (Mechanical Engineering), IIT Madras

4 years 5 months of experience in Electronics industry.

GE India Technology Centre Pvt. Ltd.: Research Engineer

• Experienceininitiatingandleadingshort-termandlong-termresearchprogrammes

• Ledamulti-disciplinaryresearchteamtowardsdevelopingnextgeneration locomotive engine control systems - a USD 300,000 research programme

• Twopatentsfiledintheareaofmagneticrefrigeration-newcompressorfree technology

• Wonthebestrookieawardforoverallperformance

• Writtenforleadingscientificandindustryjournals

Chandrasekhar Samiappan

English, Hindi, Bengali, Punjabi

The International Economy and Business, Harvard University

PGPM (Finance & Marketing), Goa Insititute of Management

B.Com., Sydenham College of Commerce & Economics, University of Mumbai

5 years 5 months of experience in Corporate Banking industry.

Unitus Capital Pvt. Ltd.: Consultant

• StrategyandCapitalRaiseConsultingtomaximisesocialimpactacrossAsia

• ConductedscopestudyonmicrofinanceinChinaandadvisedoptimalentrystrategy

INGVysyaBankLtd.:AssistantVicePresident

• ConducteddetailedcreditanalysisforRiskapprovalsandensuredsmoothexecution

• ImplementedING’slargesttransaction(2008)withinchallengingdeadlines

• LedateamtobagandexecuteAsia-Pacific’s‘DealoftheMonth’

• Chosenforfast-trackgrowthandpromotedtoING’syoungestAVP

Charulata Singal

English, Hindi

B.Tech. (Chemical Engineering), IIT Bombay

4 years 11 months of experience in Consumer Products industry.

Cadbury India Ltd.: Manager - Process

• Schedulingandensuringtimelycompletionof‘Cadbury Silk’ and ‘Perk Glucose’ launch activities

• Designedandcommissionedmanufacturingprocessesfornewproducts

• Evaluatedoftechnologyoptionsthroughexperimentationandvendorinteraction

• Increasedcrumbproductioncapacityby40%throughinnovation

Asian Paints (India) Ltd.: Manager Production

• Ledateamofover50peopleinresin(paintintermediate)productionunit

• Highestproductionofresintomeetmarketdemand

• ImplementedLeanmanufacturingprocesses

Chinmay Joshi

Page 27: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

52 53

English, Hindi

BBA, Birla Institute of Technology, Noida Campus

4 years 6 months of experience in Marketing & Advertising industry.

Genesis Colors Pvt. Ltd.: Manager - Marketing & Corporate Communications

• Formulatedandimplementedmarketingplansfor7 brandsincludingCanali,JimmyChooandPaulSmith

• Managedsalesandbrandpromotionactivities

• OversawCRM,creativedesigningandbrandcollateralteams

• Partofthecoreluxurymarketingmanagementteam

Perfect Relations Pvt. Ltd.: Associate Image Manager

• Handledmediacommunicationof8accounts

• Createdmarcomplans

• Businessdevelopmentfornewclients

• PartofteamselectednationallytomanageInternationalFilmFestivalofIndia-2006

Chirag Rakshit

English

BS (Biological Engineering), Cornell University

4 years of experience in Engineering industry.

MWH Americas, Inc.: Professional Environmental Engineer

• WroteaHydroelectricFeasibilityStudyforUSA’s largest supplier of treated water for 16 different sites and recommended 4 sites to be designed based on

client’s 15 year break-even limit

• DesignedtwoRecycledWaterPreliminaryDesignReports,saving25%ofcostsand serving 2,000 households

• Spokeatthe2009BreckenridgeConferenceonthetopicofdeliveringsolarenergy into a conventional project

Christopher Devon Garnic

English, Hindi, Marathi

CA, ICAI

B.Com., M L Dahanukar College of Commerce, University of Mumbai

5 years 2 months of experience in Consulting industry.

Mindspring Advisors Pvt. Ltd.: Consultant

• M&AAdvisoryforSMEclientsacrosssectors

Ernst & Young India Pvt. Ltd.: Senior Associate

• TransactionAdvisoryservicesacrosssectors;dealsuptoUSD600million

• TeamLeadfor2duediligence(FacilityManagementServices&RoadProjects)for ICICIVentures

PricewaterhouseCoopers: Senior Associate

• M&AAdvisoryservicestoleadingglobal/Indianclientsincludingstrategicbuyers and private equity

• Workedoncrossborderdeals(reviewofaEuropeanchemicalcompanyfor acquisition by Indian company)

Deepa Prakash Kelkar

English, Hindi, Punjabi

B.E. (Computer Science), Thapar University

5 years 8 months of experience in IT (Products) industry.

Aricent: Senior Software Engineer

• Ledateamof5forintegration,testinganddeployment of Aricent Proprietary Test Tools

• DesignedandDevelopedsoftwaresolutionsforvoiceappliancesandVSATterminal devices

• HandledQualityAssuranceofsoftwaresolutions

• ReceivedBestCustomerSatisfactionRatingatHughesNetworkSystems

Siemens Information Systems Ltd.: Senior Systems Engineer

• Designedanddevelopedvalueaddedservicesformobileoperators

• Implementedandtestedsoftwaresolutions

• Receivedmeritrewardforsuccessfulimplementationofaflagshipproject

Deepti Gupta

English, Hindi, Bengali, Russian

B.Tech. (Electronics and Communication), Guru Tegh Bahadur Institute of Technology, Guru Gobind Singh Indraprastha University, Delhi

5 years 9 months of experience in IT (Services) industry.

Column Technologies: Business Analyst - Business Development

• HandlednorthIndiaregionforsales,technicalconsultingandnewbusiness development

• Closeddealson2accountsworthUSD200,000

• Representedthecompanyatindustryforumsandmarketingevents

• Representedcompanyasspeakeringlobal‘UserWorld’meetinSydney,Australia February 2009

Wipro Technologies: Technical Trainer - Remedy

• Certifiedtrainerin5modules,conductingtrainingacross8countries

Hewitt Associates: Senior Support Engineer

• WorkedincoreProductDevelopmentteam

Deepti Sen

English, Hindi, Gujarati

B.E. (Electronics & Communications), Dharmsinh Desai Institute of Technology, Dharmsinh Desai University

4 years 9 months of experience in Telecommunications industry.

Agilent Technologies: Application Engineer

• Conductedpapersontechnologyandsolutionsat strategic marketing seminars to leverage sales

• Consultancyforbestpracticesandsolutionsfortestingwirelessdevices

• Collectedmarketintelligencefromcustomersandprovidedfeedbacktotheproduct R&D team

Nokia India: Transmission Planning Engineer

• Improvedtransmissionnetworkavailabilityby12.5%in2months

• SpecialAwardforrelief-workduringSuratfloodsin2006

Fascel Ltd. (Hutch): Graduate Engineer Trainee

• DevelopedSiteFolderApplicationformonitoringBSSNetworkElements

Dhaval Shah

English, Hindi, Bengali, Italian

BBA, Bocconi University

4 years 6 months of experience in Sports industry.

IOS Sports & Entertainment: Manager, Business Development

• Led negotiations for a stake sale to PE companies

Katha: Manager, Funding & Business Development

• Managed payroll giving programmes with Unilever and IBM

• Managed the Teach India campaign

D. E. Shaw & Co.: Associate, Resource Development

• Headed a project to analyse PE firms in the Middle East

IOS Sports & Entertainment: Manager, Marketing & Business Development

• Forged a strategic partnership with OSIAN’s for acquiring and managing a football club

• Negotiated a strategic partnership with Adidas

• Marketed the Women’s Boxing World Cup 2006

Dipra Mukhopadhyay

English, Hindi, Sindhi

B.Com. (Hons.), Shaheed Bhagat Singh College, University of Delhi

4 years 6 months of experience in Consulting industry.

Hewitt Associates: Associate

• ResponsibleforexecutionofHRconsultingprojects in space of Manpower Planning, Total Rewards and

Compensation Benchmarking

• BusinessdevelopmentinMiddle-EastforHRconsultingservices

• ResponsiblefordesignandimplementationofExpressionofInterest(EoI)based staffing system

• Consistentaboveaverageperformanceratinginallevaluations

• AttainedthelevelofaJuniorConsultantwithinoneyearofservice

Divya Gianchandani

English, Hindi

B.Tech. (Civil), IIT Roorkee

4 years 9 months of experience in KPO industry.

Evalueserve.com Pvt. Ltd.: Manager

• RegisteredPatentAgentwithIndianPatentOffice

• Ledateamof20professionals,byprovidingtechnical and legal guidance in Intellectual Property

• Managedtrainingplanandorganisedtrainingsessionsforteammembersandnew recruits

• Received‘BestEmployee’certificateinIP(2006)fromtheglobalCOO

• Won‘BestTeam’awardinIP(2008)

• WonFirstprizeinacompany-wideonlineIP-LegalQuiz(2009)

Eaishvarya Sharma

English, Hindi

B.A. (Hons.) (Economics), Delhi College of Arts & Commerce, University of Delhi

5 years 3 months of experience in Marketing & Advertising industry.

Draft FCB Ulka Advertising Pvt. Ltd.: Senior Account Executive

• HandledWhirlpoolaccount-corporateandrefrigerator;ranDiwalicampaigns (4 years) and DC refrigerator campaigns (2 years)

• Conceptualisedandexecutedaleadgenerationcampaignforaspecifictarget segment(marriedwomen>25years)

Membrane Creative Pvt. Ltd.: Partner Director

• AcquiredthecontractfromTulipsoftware(INR0.3million)

• FirstyearturnoverINR1.5million

DentsuMarcomPvt.Ltd.:JuniorAccountExecutive

• HandledthelaunchcampaignofHondaUnicorn(worthINR120million)

• Competitivemotorcyclemarketanalysis

Gaurabh Gulshan

English, Hindi

Master of Public Health, School of Public Health, Boston University

MBBS, R N T Medical College, University of Rajasthan

4 years of experience in Pharmaceuticals and Healthcare industry.

Torrent Pharmaceuticals Ltd.: Manager-1

• DesignedandconductedclinicaltrialsforPhase1andPhase2ofdrugdiscovery

• Assessedmarketpotentialandtherapeuticpositioningofnewmolecules

Boston University, School of Public Health: Research Assistant

• AppliedhealthoutcomesresearchfundamentalsinQualityofcarestudy

• DesignedQuestionnairesforQualityofcarestudyforepilepsypatients

• ConductedresearchstudiesonHIVpatientsandPublicHealthintheUSA

All India Institute of Medical Sciences: Physician

• ManagedOPDsandwardsforMedicine,PaediatricsandGynaecology

Gaurav Chaturvedi

English, Hindi

CA, ICAI

B.Com. (Hons.), Shri Ram College of Commerce, University of Delhi

4 years of experience in Accounting industry.

BSR & Co (member firm of KPMG): Assistant Manager

• Diversedomains(power,telecom,advertising,luxury brand retailing, FMCG, software)

• DealingwithIFRS,USGAAP,UKGAAP,SOX

• SecondedtoKPMGLLP,UK;workedintheirFinancialServicesdivision(Towergate Insurance, HBoS, Prudential Group)

• Diverseclients(manufacturing,service,privateequity,trading,banks,insurance)

• Ledauditteams(4to15members);workedonprocessanalysisandriskassessments

• IPOworkasperSEBIguidelines

Gaurav Nayyar

Page 28: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

54 55

English, Hindi, Punjabi

Master of Technological Design, (Mechanical Engineering) National University of Singapore

B.E. (Mechanical Engineering), Osmania University, Hyderabad

5 years 5 months of experience in Engineering industry.

Hewlett-Packard (Singapore) Pvt. Ltd.: Specialist Manufacturing Development Engineer

• AsProgramLead,managedakeynewproductintroductionproject

• KeycontributortoHP’soverallmanufacturingstrategyforlarge-formatprinter manufacturing in Asia

• Leddesignactivitiesforvariousmanufacturingsystems

Mikrotools Pvt. Ltd.: Product Engineer

• ManagedProductDevelopmentformicro-machiningtools

• Createdcompany’sfirstproductlineup

• Achieved10%manufacturingcost-reduction

• ContributedtoUSD100,000sales

Gurpreet Singh Bedi

English, Hindi, Punjabi

B.Tech. (Hons.) (Electrical), Guru Nanak Dev Engineering College, Punjab Technical University

4 years 8 months of experience in Energy industry.

NTPC Ltd.: Senior Engineer

• ResponsibleforElectricaldivision(40members)ofthe power plant (USD 1.5 billion)

• Supply-chainrestructuring,planningofsparesandservicesworthINR20million

• Techno-commercialprojectappraisalandmanagementformultimillionrenovation projects

• Processowner-ERP,CDM,QMS;Riskevaluationandprioritisation

• LedprocessimprovementandenergyefficiencyprojectsEnergyManagement System reduced APC by 0.5%

• PowerMinisterAward-BestTraineeoutof570

Harpreet Kaur

English, Hindi, Marathi, Bengali

B.E.(ComputerScience),BharatiVidyapeeth’sCollegeofEngineering, University of Pune

5 years 6 months of experience in IT (Products and Services) industry.

Sumtotal Systems India Pvt. Ltd.: Senior Software Design Engineer

• Ledateamof5toconceptualise,developandlaunchanewtalentmanagementtool targeting SMEs

• LedR&DSustenanceEngineeringGroupforcustomerissuemanagement

• Won2customerawardsforexcellenceinachievingcustomerdelight

Infosys Technologies Ltd.: Programmer Analyst

• Delivered3marketingprojectsworthUSD1.2millionasanOnsiteConsultantfor USA’s largest shoe-retailer

• Partofpre-salesteamforEuropeanretailers

• PresidentofDot-NetCoEatHyderabad

Harshika Sarbajna

English, Hindi, Gujarati, Urdu

CFA, Cleared Level I, CFA Institute, USA

B.Tech. (Engineering Physics), IIT Delhi

4 years 10 months of experience in Manufacturing and Service industry.

GE India Technology Centre Pvt. Ltd.: Research Intellectual Property Professional

• Identifiedopportunities(USD10million)anddevelopedprogrammesfor commercialisation of GE’s technology portfolios

• AwardedthricebyGELeadershipfor‘Excellence’and‘Expertise’

• ProcessimprovementeffortsthroughSixSigmaandLeanmethodologies

Pangea3 LLC.: Assistant Manager, Intellectual Property

• Added10+clients,recruitedandmentored15+Specialists,improvedproject profitabilityby~30%.

• Managedprofitabilitymetrics,resourceplanningandperformanceevaluationforthe IPdivision(70+employees)

XL Dynamics (India) Pvt. Ltd.: Associate Business Analyst (Mortgage products)

• SelectedfortheManagementDevelopmentProgramme

Hozefa Abbas

English, Hindi, Punjabi, Tamil, Gujarati

PGDM, Kirloskar Institute of Advanced Management Studies

BBA (Hons.), Madras School of Management Sciences, University of Lincoln

5 years 11 months of experience in Consulting, Education and IT industries.

Triumphant Institute of Management Education: Senior Manager

• Identifybusinessopportunitiesanddevelopbusinessplans

• Conceivedandimplementedthebranding/marketingplansfortheSchool’sventure

• Developeda‘pay-for-performance’modelforthePublicRelationsAgency

• Overhauledcoursewareandmethodologiesforthecourse

• Designedprogrammes/modulesforcustomisedtraining

Equitor Management Consulting Pvt. Ltd.: Associate

• Planningandexecutionofclientengagementsfrombriefingtodelivery

• AccountsworkedonincludeTitanandDORMAGmbH

Jaideep Singh Chowdhary

English, Hindi, Punjabi, Konkani

B.Tech. (Information Technology), NIT Allahabad

4 years 9 months of experience in IT (Services) industry.

Cognizant Technology Solutions: Associate

• Ledandimplementedbusinessstrategyandpre-sales at Cognizant and client organisations

• StrategisedanddesignedaUSD10milliondatawarehouseforaleadingfinancialfirm

• Ledateamof40memberstoimplementaUSD4millionreportingsystem

• Received‘AssociateoftheYear’&‘DWDON’awardforsuccessfuldeliveryofa flagship project

• WorkedinmultiplegeographiesinIndia,SingaporeandtheUSA

Jasdeep Singh Soni

English, Hindi, Tamil

B.E. (Hons.) (Electrical and Electronics), BITS Pilani

4 years 6 months of experience in Consulting and IT (Services) industry.

Frost & Sullivan (India) Pvt. Ltd.: Research Analyst

• Analysedsemiconductorindustrydynamicsand produced research reports

• Consultedforglobalsemiconductormanufacturersandaidedtheirstrategicdecision making process

• Authoredmarketinsightsonthesemiconductorindustryforleadingpublications

• Activelyinvolvedinproposalwritingandmeetingclientsfornewbusiness development

Wipro Technologies: Project Engineer

• SignificantlycontributedtothemaintenanceandtestingofSystemManagement application running on large enterprise servers

Jayalakshmi Janakiraman

English, Hindi, Telugu, Oriya, Marathi

B.Com., Brihan Maharashtra College of Commerce, University of Pune

4 years of experience in Marketing & Advertising industry.

Pinstorm Technologies: Assistant Manager

• Workedondigitaladvertisingstrategyforlargeglobal clients selecting channels and advertising

• BuiltandtrackeddigitaladvertisingforICICIBankandShell

Bluegrass Studios: Consultant

• SetupcustomeracquisitionandretentionteamforBluegrass’digitalmedia marketing business

Conscience Compass: Head, Business Operations

• CreatedCSRmatrixforcorporatestomeasuretheirCSRandcarbonfootprints

Google India Pvt. Ltd.: Account Associate

• WorkedasAccountAssociateforGoogleAdWordscustomersinEurope

• Twopromotionswithinayear

Jinu Peyeti

English, Tamil, French

B.E. (Mechanical Engineering), MIET Engineering College, Bharathidasan University

5 years 9 months of experience in IT (Services) industry.

Infosys Technologies Ltd. (Airbus UK): Engineering Lead

• Pre-salessupport,businessdevelopmentinEuropean Aerospace Industry, handling Airbus UK and vendors

• HandledclientinterfacingandproposalpreparationforUSD2.8millionmulti-year Airbus aerospace outsourcing project

• EngineeringLeadandNumericalSimulationModelIntegratoratAirbusUK

• AircraftModelacceptanceanddeliveriescoordinatorforAirbus’GlobalDesignTeam with Aerospace vendors

• Implementedprocessesthatreduceddesigncycletimeby20%

Kaja Ahmed Nawaz Mohamed Yusoof

English, Hindi

B.Tech. (Hons.) (Computer Science), MMM Engineering College, Uttar Pradesh Technical University

5 years 9 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Consultant (Finacle)

• Ledpre-salesactivitiesofFinacleforbankslike Cooperative Financial Services (CFS), National Australia Group Europe in UK and KotakMahindra,INGVysyainIndia

• InstrumentalinwinningthestrategiccontractinEuropeworthUSD100million

• Pioneeredtheintroductionofnewfeatureswithintheproductforcorporatebanksin the UK

• AwardedInfosysCertificateofExcellenceforcontributiontotheorganisation

Kanika Pandey

English, Hindi

M.Sc., (Mathematics), IIT Delhi

B.Sc.,Mathematics(Hons.),SriVenkateswaraCollege,University of Delhi

4 years 9 months of experience in IT (Services) industry.

Inforte India Pvt. Ltd.: Lead Consultant

• Designedanddevelopedon-premiseandon-demandCRMsolutions(Siebel& SalesForce.com)

• StartedtheOracleLifeSciencespractiseatIndiaoffice

• Conductedtrainingsbothtechnicalandnon-technicalforemployees&clients

• WastheModuleleadforthefirstcloudcomputingimplementationatInforte (SalesForce.com CRM)

• WasawardedStarPerformerinMarch‘07

• AnalysisandselectionofCRMvendorsforclients

Kapila Monga

English, Hindi, Telugu

B.A. (Hons.) (Economics), SRCC, University of Delhi

4 years 7 months of experience in Consulting industry.

Intellectual Capital Advisory Services: Associate Consultant

• Studiedtheimpactoffoodinflationandmonetary policy on microfinance institutions in Pakistan. Provided

recommendations to the State Bank of Pakistan on possible interventions

Erudite Educational Centre: Marketing Manager

• Initiated,developedandmaintainedstrongbusinessrelationswithprospectiveclients in Singapore for a new educational content outsourcing initiative

KPMG India: Analyst

• StudiedHRprocessesofaGovernmentoilcompany.Presentedvarious recommendations which were adopted by its Board

Karan Sabharwal

Page 29: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

56 57

English, Hindi, Kannada

CFA, Cleared Level III, CFA Institute, USA

CA, ICAI

B.Com., BHS First Grade College, Bangalore University

4 years 10 months of experience in Financial Services industry.

Ishwar and Co (Brokerage firm): Senior Manager

• Advisingclients/proprietarydeskontactical/fundamentalinvestmentideas

• Expandedfirmsclientbaseby7%;increasedtradingvolumesby10%

Goldman Sachs (India) Securities Pvt. Ltd.: Associate, Equity Research

• MemberoftoprankedAsian/IndianEnergyresearchteam

• Publishedover100researchreportsonIndianenergystocks

• CreatedaregionaloilservicesindexforclientsseekingtoinvestinAsianOilServices sector

• Chosentoattendthefirst‘GSStockPickingCollege’inNYinJan08

Karthik Bhat

English, Hindi, Tamil

B.E.(Electronics),VidyalankarInstituteofTechnology,University of Mumbai

4 years 3 months of experience in Engineering industry.

Larsen & Toubro Infotech Ltd.: Alliance Executive

• Responsibleforoneofthetopthreekeyaccounts- Cisco;jointlywonmulti-croreprojects

• Prequalifiedprospects&generated11keyleads(vizLG,Dolby)

• Createdmarketingcollateralsfortheworldwidesalesteam

• LedamobilehandsettestingprojectfromFlorida,USA(teamsize-6)

• Bestteamperformanceaward,2007fordesignanddevelopmentofacoremobile phone application

• TrackedmobiledevicemarkettrendstodriveR&Dinitiatives

Karthik Lakshminarayanan

English, Hindi, Bengali, Urdu

CFA, Level II, CFA Institute, USA

B.Tech. (Electrical Engineering), IIT Kanpur

4 years 7 months of experience in Financial Services industry.

Protiviti Member Firm (Bahrain) SPC: Assistant Manager

• ManagedriskconsultingprojectsatIslamicBanksin Middle East

Edelweiss Capital Ltd.: Manager

• DevelopedCreditRiskModelforcorporateproposals

• DevelopedCollateralManagementFrameworkforcorporateclientsforlending against securities

Deutsche Bank (Global Markets Center): Senior Analyst

• Setupwaterfall/ratingsanalysismodelsforCDOs

• AssetManagementModels(Buy/Sell/Holdenablermodel)

• WorkedinLondonfor9months

Goldman Sachs Services Pvt. Ltd.: Analyst

• LedPrivateWealthManagementandEndofDayteams

• WorkedinUSfor6months

Kaushik Dasgupta

English

B.A. (Communication), University of Washington

4 years 6 months of experience in Financial Services industry.

Expeditors International of Washington, Inc.: Insurance Department Representative

• Managedover100cargoinsuranceaccountsinten countries

Option One Mortgage Corporation (I) Pvt. Ltd.: Mortgage Underwriter

• AuthorisedresidentialmortgageloansuptoUSD750,000

• Analysedcreditreports,titles,appraisals,andincomedocuments

• ChairedCultureCommittee

• TravelledtoIndiatwicetotrainandmentornewunderwriters

Alpine Mortgage Service, Inc.: Loan Processor/ Personal Assistant

• Submittedloanstolendersandtrackedloanprocess

• Updated/standardisedmarketingdatabaseformortgageofficer(800+clients)

Kimberly Anderson Warriah

English, Hindi, Sindhi

B.E. (Hons.) (Computers), MCET, University of Rajasthan

4 years 6 months of experience in IT (Products) industry.

Oracle India Pvt. Ltd.: Senior Application Engineer

• DevelopedtechnicalarchitectureforOracleFusion Patching Infrastructure

• Reviewedpeercode,providedprojectcompletionestimatesandmentoredjuniors

• Designed/implementedenhancementsforFusionandMiddlewarepatching architecture

• ContributedtoQAautomationprocessreducingtestcycleby2days

Larsen & Toubro Infotech Ltd.: Software Engineer

• ConceptualisedserversideframeworkforDigitalHomeportal

• DevelopedtheWebinterfaceandUPNPlibrariesfortheportal

• Significantlycontributedtofinishtheproject15daysaheadofdeadline

Komal Gurnani

English, Hindi, Telugu, Oriya

CA, ICAI

B.Com., Osmania University

5 years 10 months of experience in IT (Products) industry.

World Health Organization-Regional Office for Africa: Budget & Finance Officer

• LeadforbudgetandfinanceareasinGlobalManagementSystem(OracleERP)

• Responsibleforbudgetingandbuildingcapacityfor48countryoffices

• Memberofteamtoreview2-yearpositionbudgetsfor48countryoffices

• Traveledto12countriesinEMEA

Satyam Computer Services Ltd.: Associate Consultant

• LeadconsultantforOracleProjectssuiteandimplementedthesameinWHO Project, Geneva

• ProjectLeadforPRMimplementationatTemenos,Geneva/Chennai

• AwardedSTARperformer

Kota Ravi Chandra

English, Hindi

Bachelor of Nautical Sciences, Training Ship Chanakya College, University of Mumbai

5 years 3 months of experience in Shipping industry.

Seaarland Shipping Management: Second Officer

• Multinationalleadershipandmanagementexperiencein 40 countries across six continents

• Clearedsurveys,auditsandinspectionsconductedbystatutorybodies

• In-chargeofvoyageplanning,logisticsandcargohandling,chartsoutfit,life-saving, fire-fighting, radio and navigational equipment

• Improvedtrainingandsafeworkingprocedureonboard,whichwasreplicatedonall ships of the company

• Teamleaderforco-ordinatingactivitiesduringemergencies

Kumar Sunny Raja

English, Hindi, Telugu

B.Tech.(ComputerScience),VelloreInstituteofTechnology,Vellore

4 years 10 months of experience in Real Estate and IT (Services) industry.

Krisals Infra Pvt. Ltd.: Co founder

• ExpandedourstartupventuretoanINR30million business

• Managecashflowandco-ordinateplanning,procurementandengineeringdivisions

• Identifypotentiallocationsforrealestatedevelopment

Progress Communications Pvt. Ltd.: Wholetime Director

• Progressleadershipandstrategicguidance

• PlayedpivotalroleinexpansionfromINR100milliontoINR170million

• Madeourcompany#1inadvertisingagrobasedproductsinAndhraPradesh

Cognizant Technology Solutions: Programmer Analyst

• WorkedinintegrationtestingservicesforAT&T

Lakshmi Srikanth Koduri

English, Hindi

B.Tech.(ElectricalEngineering),NITJaipur

4 years 6 months of experience in IT (Services)industry.

Tata Consultancy Services Ltd.: Assistant System Engineer

• AnalysedandworkedonCisco’sGlobalSales Platform

• PresentedbusinesssolutionstoimproveCisco’scustomerservice

• WorkedonCisco’sPartnerRelationshipManagementapplications

• Clientappreciationforoutstandingperformanceandlastingcontribution

• LedmanyprojectstosuccessfulcompletionasaLeadQualityAnalyst

Lekha Ojha

English, Hindi, Tamil

B.E. (Hons.) (Electrical & Electronics Engineering), Nanyang Technological University

5 years 6 months of experience in Aerospace and IT Services industry.

Tata Consultancy Services Ltd.: IT Analyst

• Handledend-to-endpre-salesactivitiesforprimarily auto sector projects

• MarketingTCS’capabilitiesandsolutionstoprospectivecustomers

• SecuredprojectswithcombinedrevenuesofmorethanUSD12million

• Alphaproductreleaseforanend-to-endautomotivesolutiondeliveryforNissanthat registered 86% satisfaction index from dealers worldwide

Nanyang Technological University (collab. with Defence of Singapore): Research and Development Engineer

• DevelopmentofSingapore’sfirstsatellite

• PublishedTechnicalPaperonSystemsDesignforAsianSpaceConference

Madhusudanan Narayanan

English, Hindi, Tamil, Marathi, French

MS (Computer Engineering), University of Cincinnati, Ohio

B.E. (Hons.), Electronics and Communication Engineering, Sri Ramasamy Memorial Engineering College, University of Madras

4 years 3 months of experience in Electronics industry.

QualComm Inc.: Senior Engineer

• Helpedarchitectanddesignnextgenerationcellphonechipscomingintothemarket 3-5 years in the future

• Introduced,developedanddeployedhardwaredevelopmentprocessesthatsaved several man months of redesign time

• Enableddesignteamstoadoptemergingindustrystandards.WonQualcomm outstanding achievement award for the same

• Enabledsoftwaredevelopmentpriortohardwareavailabilitytoreducechipdelivery time to market

Mahesh Sridharan

English, Hindi, Gujarati

BMS, Narsee Monjee College of Commerce and Economics, Mumbai University

4 years 8 months of experience in Retail industry.

Athena Optics Inc.: Founder and CEO

• GrewclientbaseandmarketshareinUSA,marketing of house brands like Oxford, Hilton and Senator range

of eyewear

• Brandssoldin200retailoutlets

• BusinessearnedUSD200,000inFY09,FY09salesgrowthwas50%

• Developedahighlyprofitablevintageline,comprisingover10%ofsales

Google Inc, USA: SQA Tester

• Automationsoftwaresaved20manhoursoftestingperrelease

Conti-Optics/Hilton Eyewear Ltd., UK: Intern

• Identifiedkeymarketingopportunities

Manas Sharad Lodhavia

Page 30: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

58 59

English, Hindi

Master of International Business, Delhi School of Economics, University of Delhi

B.Com. (Hons.), Goswami Ganesh Dutta S D College, Panjab University

4 years 11 months of experience in Insurance industry.

ICICI Prudential Life Insurance Ltd.: Associate Regional Manager

• LedNorthandEastregion,drivinglifeinsurancesalesinICICIBankAssetssegment

• Partnerrelationship-managementatzonalleveltojointlyachievecross-selltargets

• Initiatednewbusinessavenuesthroughnewtie-ups/corporateprogrammes

• MemberofICICIEmployee-Talent-Poolbasedonleadershipskillsandconsistent performance

• AwardforSpecialContributioninsettingupCreditAssureproductvertical

• AwardforHighestInsurancePremiumValueContributionacrossallzones2008-09

Manasvi Vedhera

English, Hindi

B.Tech. (Metallurgy), IIT Madras

5 years 10 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Technical Lead

• Strongknowledgeoftheprivateandinvestment banking domains

• BuiltManagementInformationSystemsforafortune50financialmajor

• Wonaccoladesfromseniorclientmanagersforleadingdevelopmentofanefficient information architecture that made processes 20% faster

• Overthreeyearsexperienceofworkingatclientlocationbuildingrelationshipswith clients to foster partnerships

• Awardedfordeliveringamissioncriticalprojectontime

Mandeep

English, Hindi

MS (Mechanical Engineering), Texas A&M University

B.Tech. (Mechanical Engineering), IIT Kanpur

4 years 2 months of experience in Electronics industry.

AirTight Networks: Lead, Applications Engineering

• Responsibleforpre-salesofAirTight’sWirelessSecurity Product in multiple countries (directly or through resellers)

• Ledteamof5forworldwideproductdeploymentandpost-salesservices

• Collaboratedwithchannelpartnerstodevelopsalesfunnel

• HelpedAirTightsalestosignresellers

Pathway Technologies: Project Research Engineer

• DevelopedcontrollertoregulateunderhoodtemperatureinSUVsadding5%to mileage

• Providedresearchinputandwroteproposalsforsecuringnewprojectsand customers

Manik Chandra

English, Hindi

B.A.(Economics),MCMDAVCollege,Chandigarh,PunjabUniversity

4 years 6 months of experience in Food & Beverage and Media industry.

PepsiCo International: Assistant Manager, Sales Development

• Executedthirdpartymerchandising,contributingto13%sharegaininretail

• Acquiredmultiplexesandrestaurants,increasingmarketshareinthischannelby5%

• Implementedmarketingcalendarsforinstitutionalcustomersdelivering60%sales growth YoY

The Times of India: Senior Officer, Response Development

• DoubledtheshareofadvertisingrevenuesofTimesofChandigarhin1.5years

• ConceptualisedandlaunchedETAutoManiaresultinginamarketshareof80%in the auto advertising category

Manika Sahni

English, Hindi

M.A. (Economics), Delhi School of Economics, University of Delhi

B.A. (Economics), Kirori Mal College, University of Delhi

4 years 9 months of experience in Consulting industry.

Inductis Pvt. Ltd. (Consulting Division): Project Manager

• AnalyticsandmanagementconsultingtoFortune500firmsinfinancial,insurance and utility domains

• Workedacrossgeographies-US,SoutheastAsiaandIndia

• RiskAnalyticsforSME(SoutheastAsia)operationsforabankingmajor

• Createdmarketingstrategyfortheworld’sleadingInformationbureau,generating USD 50 million

• Devisedcostavoidanceplanforaninsurancemajor,savingUSD15million

• 1strankinKnowledgeDataDiscovery,DirectMarketingChallenge

Mansi Khanna

English, Hindi, Gujarati

M.Sc.andB.Sc.(InformationTechnology),J.P.DawerInstituteofInformationScience&Tech,VeerNarmadSouth Gujarat University

4 years 11 months of experience in Financial Services industry.

Goldman Sachs Services Pvt. Ltd.: Associate

• Establishednewteam(8members)fordevelopmentandqualityassuranceprojects

• Manageddevelopmentteamtoimplementbusinessneedsforinvoiceprocessing, accrual calculation

• Managedqualityteamforimplementingend-to-endqualitychecks

• Chosenasmentorforthenewrecruitsandfor10KWomenatISB

• ReportedtoGlobalHead(controllers)inNewYork

Meha Raman Grover

English

B.A. (Economics), State University of New York, University of Stony Brook

5 years 7 months of experience in Food & Beverage industry.

Pernod Ricard India Pvt. Ltd.: Key Accounts Manager

• TrackedsalesandrevenuesacrossallDutyFree operators in India

• InchargeofallpromotionactivitiesandinstorebrandingacrossWestIndia

• Builtallinternalforecastsacrossallbrandsinallmarkets

• Builtbusinessplansforallmajorclients

Diageo India Pvt. Ltd.: Assistant Brand Manager

• AssistedinlaunchofSmirnoffBlackinIndia

• DevelopedindustryreportonINR500Segment

DiageoVenezuela:FinancialAnalyst

• Financialplanningandreporting-evaluatingpromotions

• Trackingcompanyoverheads

Mihir Deepak Bhojwani

English, Hindi, Sanskrit

Dual Degree - B.Tech. and M.Tech. (Electrical Engineering), IIT Mumbai

4 years 9 months of experience in Healthcare industry.

Soni Hospitals Pvt. Ltd.: Executive Director

• Achieved30%revenuegrowthYoYinFY09,08,07

• Accreditedorganisationwith60agencies.Grewcredit-salesby62timesover24 months

• ReducedAverageLengthofStayforpatientsfrom5.0daysto4.0days;increased occupancy from 80 to 120 patients per day

Nvidia Graphics Pvt. Ltd.: Hardware Design Engineer

• DesignedandimplementedPCIE-AdvancedErrorReporting(AER)developmentin MCP 65 chip

• HelpedboostMCP65chipsalesinserversegment

Mohit Soni

English, Hindi, Gujarati, Arabic

B.E. (Electrical), Sardar Patel College of Engineering, University of Mumbai

4 years 9 months of experience in Engineering industry.

Siemens Ltd., India: Senior Executive - Projects and proposal management / Deputy Project Manager

• Co-ledprojectexecutionteam(20members)onPowerGridproject(INR120million)

• TeamLeadofaFocusGrouphand-pickedbymanagementtointroducePMU technology in India

• DeputedtoSiemensAG,Germany(3years)toleadaninternationalteamonaT&D project (Euro 160 million) in Libya

• AwardofExcellence&SpecialMeritAward

• Head(Sales&BusinessDevelopment-EnergyAutomationsSolutions)forWestern India

Monil Rameshchandra Ruparel

English, Hindi

Bachelor of Nautical Sciences, Training Ship Chanakya, University of Mumbai

4 years 3 months of experience in Shipping industry.

Seaarland Shipping Management: Second Officer

• Ledmultinationalteamswhilemanagingshipboardand cargo operations

• Officer-in-chargeofnavigation,lifesaving,andhospitalequipments

• Handledship’sdeliveryfromshipyard;costofshipwasUSD85million

• Improvedship’sinventorymanagementsystem,cutinventorycostsby15%

• Chalkedoutandexecutedsafetydrills/trainings

• Handledcargooperationat40portsacross5continents

Mitsui OSK Lines: Deck Cadet

• Completeddrydockmaintenanceofacontainership

Mrityunjay Singh

English, Hindi

B.Tech. (Mechanical Engineering), IT-BHU

5 years 9 months of experience in Energy industry.

Bharat Petroleum Corporation Ltd.: Assistant Manager - Retail Sales

• Increasedfuel/non-fuelrevenuesfromINR1.8billionto INR 5.1 billion in five years

• Achievedsecondhighestpremium-fuelconversionalloverIndia

• Triplednon-fuelrevenueswithinayear(2008-09)

• ConductedPersonalityDevelopmentProgrammesforover1000salesmenand workshops for over 70 officers, including seniors

• ‘LettersofAppreciation’fromGM-NorthIndiaandGovernmentofUttarPradesh

• Co-ordinatedmarketinginitiativefor‘PureforSure’across213cities

Nalin Kumar Sharma

English, Hindi

B.E. (Computer Science), Thapar Institute of Engineering and Technology

4 years 5 months of experience in IT (Services) industry.

Sapient Corporation: SAP Senior Consultant L1

• LeadforSAPPortalandSAPHRteam

• DevelopedteamthatwonbidforaUSD4millionSAPPortalprojectfromUS pharma client

• ResponsibleforhandlingRequestforProposals,EstimationandResourceplanning for Sap Portal and SAP HR projects

• Consistentlygot‘AboveExpectation’rating

IBM India Pvt. Ltd.: Associate system engineer

• PartofcoreteamresponsibleforsettingupSAPPortalpractice

• YoungestresourceincompanytogetSAPPortalcertification

Namit Bhandari

Page 31: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

60 61

English, Telugu

B.Tech. (Mechanical Engineering), K L College of Engineering,Vijayawada,NagarjunaUniversity

4 years 9 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Technology Analyst

• ArchitectediProwe-webaccessibilityassessmentand remediation product

• Filed2patentsinthedomainsofwebaccessibilityandusability

• ReceivedInfosysExcellenceAwardsasateamof5forInnovationInitiatives

Infotech Enterprises Ltd.: Assistant Design Engineer

• Computermodeling,designanddraftingofaeronauticalenginecomponents

• Ledpilotprojectsinvolvingtechnicalwritingandreverseengineering

• ResponsibleforteamlevelqualitymaintenanceintheroleofACEpilot

Navin Kasa

English, Hindi

B.E. (Computer Science), Army Institute of Technology, University of Pune

4 years 7 months of experience in IT (Services) industry.

Amdocs: Senior Subject Matter Expert

• Developedasystemtestingtoolthatreducedtesting time by 10%

• Monitoredtheend-to-endtestingofsystemsinthetelecomdomain

• Workedonsystemtesting,gainedexperienceonallcyclesofbillingintelecom

Infosys Technologies Ltd.: Software Engineer

• Workedinthedesign,developmentandtestingoftheenrolmentapplicationfora health insurance client

• Prepareddesignspecificationdocuments,unittestplansandreleasedocuments

• Involvedinconfigurationmanagementactivities

Neha Wadhawan

English, Hindi

B.E. (Electronics and Communications), BIT Ranchi

4 years 6 months of experience in High Technology industry.

Wipro Technologies: Senior Project Engineer - Team Lead

• Responsibleformigratingfromaclosedtoopensource design environment for a major US Semi Conductor

vendor

• HandleddesignanddevelopmentofcustomcellsforaJapaneseelectronicsmajor

• AwardedBestPaperforpaperpresentedatBusinessUnitLevelTechnicaleventin 2009

Niharika Kishore

English, Hindi, Bengali, Punjabi

PGDBM (Finance and Marketing), Fore School of Management, New Delhi

B.Com. (Hons.), St. Xavier’s College, University of Calcutta

5 years 9 months of experience in Commercial Banking industry.

CitibankNA:AssistantVicePresident-SalesHead

• LedtheLiabilitiesteamof10CitiGoldWealthManagers

• Recruitedteammembers,mentoredandsetannualtargets

• WontheShootingStarawardin2008asthebestCitigoldBusinessRelationship Manager

• Won3awardsin2009asSalesHead

ICICI Bank Ltd.: Relationship Manager - Auto Finance

• MaintainingandstrengtheningrelationshipswithDealershipsandDSAs

• Led‘LoanonPhone’campaignforEast

• FeaturedinICICI’stalentpoolforfasttrackcareergrowth

Nikhil Mehta

English, Hindi

B.Tech. (Electronics & Communication), Amity School of Engineering, Guru Gobind Singh Indraprastha University

4 years 9 months of experience in IT (Services) industry.

Honeywell Technology Solutions Pvt. Ltd.: Senior Engineer

• HandledpostsalesfunctionsforclientsinAerospace domain;gatherednewrequirementsandperiodicfeedbackfromclients

• Awardedindividualandteamexcellenceawardsforhandlingonshore-offshore support activities

• TransitionedsupportofcrucialITapplicationfromanexternalvendortocompany

Accenture Services Ltd.: Software Engineer (Healthcare Domain)

• Workedontwoprojectsinhealthinsurancedomain(forUSandIrelandclients)

• ReceivedJSEAchiever,TeamAchieverandBestPerformerinTrainingAwards

Nikhil Verma

English, Hindi, Bengali

CA, ICAI

M.Com., University of Calcutta

B.Com., Prafulla Chandra College, University of Calcutta

5 years 5 months of experience in Consulting and Automotive industry.

PricewaterhouseCoopers: Assistant Manager

• Processimprovementconsulting

• SAPRiskManagementreviewsinManufacturing,FMCG,Energy,Electronics,IT, Banking industries

• LedSAPservicesdeliveryanddataanalyticsinIndia,Ledinternationalteamson Forensic analytics

Tata Motors Ltd.: Senior officer

• MISreporting,pricing,budgeting,productintroductionanalysis,businessanalyst, SOX implementation

• AchievedcostreductionofINR31million;Ledfinanceandproductionintegration

Tata Services Ltd.: Group CA Trainee

• Costing,CAPEXanalysis,auditcompliance

• EVAandSAP-BIWimplementation,developedcostanalysismodels

Niloy Sadhu

English, Hindi, Tamil

B.Tech. (Computer Science), NIT Trichy

4 years 9 months of experience in IT (Products) industry.

Microsoft R&D Pvt. Ltd.: Software Development Engineer in Test II

• Ledateamof10testerstoachieve100%test automation

• RecognisedasGoldStarofOfficeBusinessPlatformGroup,arecognitiongivento top 5% of employees

VerizonDataServicesPvt.Ltd.:SoftwareEngineer

• Ledteamtoachievemigrationof100,000salesorderswith99.95%accuracy

• Recipientof‘SpotAward’forachievingCMMilevel5compliance

• Among10%incompanytobeawardedforexceptionalperformance

Nithin Srinivasan

English, Hindi, Tamil

M.Sc. (Economics), Madras School of Economics, Anna University

B.Com., Stella Maris College (Autonomous), University of Madras

5 years 10 months of experience in Commercial Banking industry.

LatentViewAnalyticsPvt.Ltd.:Manager

• Ledsolutiondeliveryandclientengagement

• Businessdevelopmentandsalesactivities

• Researchnewanalyticdevelopments

Scope International Pvt. Ltd.: Manager - Portfolio Analytics

• Establishedoff-shoreanalyticteamasasinglestopshopforallanalyticactivities

• IdentifiednewrevenueopportunitiesandCRMstrategy

Citibank NA: Assistant Manager

• Predictivemodeldevelopmentandimplementation

• Establishedtheoff-shoreengagementmodel

• Analyticssupportfornewproductintroductionandbusinessstrategy

GECIS-Analytics: Marketing Analyst

• Developedcustomeracquisitionmodels

• Portfolioprofitabilityanalysis-RFM,LTVModels

Padmasini Renga Bashyam

English, Hindi

B.Tech. (Information Technology), NIT Allahabad

5 years 8 months of experience in IT (Products) industry.

Tata Consultancy Services Ltd.: IT Analyst

• Co-ordinated3projectsforBaseStationsolutions generating revenue of USD 2 million

• LedteamsacrossUSA,UK,KoreaandIndiafordesignandtestingWimaxBase Station Test Simulator

• DemonstratedWimaxTestSimulatorproducttovendors,resultingin3buy-ins

• AsLearningandDevelopmentco-ordinatorfortheaccount,trainedandmentored 70 people

Aricent Technologies: Software Engineer

• Designed3GAccessPointSolutionsforclientsinEurope

Pallavi Gupta

English, Hindi, Marathi

MS (Electrical Engineering), Texas A&M University

B.E. (Electrical Engineering), Govt. College of Engineering, University of Pune

5 years 8 months of experience in Consulting industry.

Deloitte Consulting LLP Boston: Consultant

• Setupprojectplansandgovernancestructures,andfacilitateddecisionmakingfor enterprise transformation projects at large health plans, hospital systems and diagnostic testing companies

• LedinterdisciplinaryclientandvendorteamsinPoland,Australia,andtheUSto setup and interface medical devices at a large diagnostic testing company

Tata Technologies Ltd.: Graduate Trainee Engineer

• Ledtherequirementsanalysis,design,anddevelopmentofanequipment maintenance system for a large auto-manufacturer

Parikshit Deshpande

English, Hindi

B.Tech. (Mechanical Engineering), IIT Mumbai

4 years 9 months of experience in Investment Banking industry.

Barclays Capital, New York: Analyst

• USD123millionIPOandUSD65millionfollow-onfor LogMeIn, a remote connectivity software provider

• USD550millioninHighYieldfinancingforIronMountain(datastoragecompany)in the US

• USD1.8billionmergerofAsiaInfoHoldingswithLinkageTechnologies(ITservices domain)

Lehman Brothers Ltd., India: Analyst

• Coreteammember,initiatingLehman’soff-shoreanalyticsteam

• Recipientof‘LehmanInnovatorsAnnualAward’

BA Continuum Solutions (Bank of America), India: Analyst

• Analysisofcapitalisationstructure,HighYieldissuances,bankloanfacilitiesand comparable companies

Parshav Mathur

English, Hindi

B.Tech. (Information and Communication Technology), Dhirubhai Ambani Institute of Information and Communication Technology, Gujarat

4 years 9 months of experience in IT (Products) industry.

Amdocs: Senior Subject Matter Expert

• Leddesign,developmentandprocessestransformationsfortelecomprojects- USD 75 million each

• WorkedondeliveryofcustomerexperiencesolutionsacrossCRM,orderingand billing products

• Reduceddefectsinthesolutionby50%,leadingtocostreductionsofUSD750,000

• LedimplementationforintegrationofAmdocsproductsforAstro,aMalaysian satellite service provider

Tech Mahindra: Technical Associate

• Developedandsupportedsolutionsforamission-criticalbillinggatewayofBritish Telecom

Parth Awasthi

Page 32: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

62 63

English, Hindi, Tamil

B.Com., Loyola College (Autonomous), University of Madras

5 years 2 months of experience in Private Equity & Hedge Fund industry.

VentureIntelligence:Head-Operations

• Ledtheresearchteamfocusedonprivateequity/ venture capital research

• Memberofbusinessdevelopmentteam,thatincreasedfirm’srevenuesby 400% over 3 years

• Designed,andsoldnewresearchofferings

• Extensiveinteractionwithstartups,investors,andintermediariesinthePE/VC ecosystem

D. E. Shaw & Co.: Associate

• Builtcompetitiveintelligencebytrackingrivalhedgefundsacrossinvestmentstrategies

• Devisedinnovativewaysforgathering,classifyingandanalysinginformationabout competitors

Pawan Kumar

English, Hindi, Marathi

MBA, Sinhgad Technical Education Society’s Institute of Management, University of Pune

B.E. (Mechanical), All India Shri Shivaji Memorial Society College of Engineering, University of Pune

5 years 9 months of experience in Manufacturing industry.

Tata Steel Processing and Distribution Ltd.: Senior Branch Manager - Sales (West)

• Functionalresponsibilityfortoplineandbottomline;consistentlyachievedtargets; increased share of business with key customers from 35% to 47%

• ‘StarManager’Awardforlastthreeconsecutiveyears

• Reducedinventorylevelsduringrecessionfrom60daysto30days

• Representedtheleadershipteamat‘BuildingonExcellence’TSDPL’sBusiness Conference at Guangzhou, China

• Playedkeyroleinbaggingnationallevel‘BestSteeliumDistributor’Award

Piyush Deepak Nahar

English, Hindi

B.E. (Electrical Engineering), SPCE, University of Mumbai

5 years of experience in IT (Products) industry.

Hewlett-Packard India Sales Pvt. Ltd.: Storage Sales Specialist

• SalesspecialistforstoragesolutionstoclientslikeL&T, Bajaj Auto, RBI and Crest

• Achieved162%ofUSD4millionannualsalestarget

• Re-acquiredlongstandingcompetitiveaccounts

Larsen & Toubro Infotech Ltd.: Business Development Executive - Europe

• PitchedtheoffshoremodeladvantagetoEuropeanclientslikeBMW,Volvoetc.

• Securedincreasedrevenuefromexistingclients

Larsen & Toubro Ltd.: Account Executive

• Accountmanagementfortelecomclients,achieved133%ofINR30milliontarget

• SuccessfulbidtopartnerBSNLwithL&T

Prachee Dubey

English, Hindi, Malayalam

BBS, College of Business Studies, University of Delhi

4 years 10 months of experience in Consulting industry.

A.T.Kearney:TeamLead(RetailVertical)

• Ledtheretailresearchpracticefortheglobalservice centre

• Ledresearchonglobalflagshipstudy‘GlobalRetailDevelopmentIndex2010’and ‘India Luxury Market 2007’

• Providedvalueaddedresearchtoconsultantsgloballyforclientengagementsand proposals

• CreatedandcapturedintellectualcapitalfortheConsumerIndustriesandRetail practice

Pramod Menon

English, Hindi, Kannada

CFP, FPSB, Mumbai

CFA, ICFAI, Hyderabad

CWA, ICWAI

B.Com., MGM College, Mangalore University

5 years 11 months of experience in Financial Services industry.

AEGON Religare Life Insurance Co. Ltd.: Regional Manager - Training

• Conductedfinancialplanningsessionsforhighnet-worthclientsandrendered investment advice

• Managedthesouthregiontrainingteam

• ProcuredINR10millionofbusinesseveninrecessionarymarketof2008

ICICI Prudential Life Insurance Ltd.: Area Manager - Content Development

• Developedtrainingmodulesforentirecompanyonfinancialmarkets,financial planning and taxation

• Designedtoolsandtechniquestoovercomecustomerobjectionsandfacilitatesales

• Updatedthesalesteamsregularlyonmarketevents

Prasanna Tantri Laxminarayana

English, Hindi, Tamil

MS (Information Networking), Carnegie Mellon University

B.Tech.(InformationTechnology),SVCE,UniversityofMadras

5 years 5 months of experience in IT (Products) and Automobile industry.

Indee.tv: Co-founder and Chief Technology Officer

• Createdcontentdistributionplatformforindependentfilms

• Createdandsoldcontentsubmissionandmanagementplatformforafilmfestival

General Motors Technical Centre - (India): Senior Researcher

• Conceptualised,managedandimplementedseveralresearchprojectsforin-vehicle communication and safety

• Authored4internationalresearchpapers,filed3patents(2granted)and3internal tool inventions

• Servedassinglepointinterfacewithsuppliers,internalpurchaseandITtosupport prototype development

Prasanna Vignesh V Ganesan

English, Hindi

MSE (Telecom & Networking), University of Pennsylvania

B.E. (Electronics & Telecommunications), Smt Indira Gandhi Engineering College, University of Mumbai

5 years 8 months of experience in Consulting industry.

KPMG: Assistant Manager

• IdentifiedopportunityworthUSD22millionfora software publisher on lost revenue due to IPR violations

• BestPerformerAwardforIPcomplianceandinfrastructureoptimisationproject

• Processconsultingforgameshows

• PeopleInitiativeideaselectedforKPMGIdeaInitiative

Wipro Infotech Ltd.: Consultant

• Saved15%byoptimisinginfrastructureforaclient

• ManagedgovernanceforaNYSElistedIndianBPO

• Certificateofappreciationfromclient

Mahindra Special Services Group: Consultant (Information Risk Management)

• Conceptualisedbusinessimpactwargames

Prashant Singh Sankhla

English, Hindi, Tamil

B.E.(MechanicalEngineering),SriVenkateswaraCollegeof Engineering, Anna University

4 years 9 months of experience in Manufacturing and Service industry.

Eaton Corporation: Senior Business Development Executive

• Developedacquisitionstrategyandpipelinefortwoproducts(salesUSD3billion)in APAC

• WorkedonidentifyingUSD20millioncross-sellingopportunitiesinrenewableenergy

• MemberofglobaltaskforcetocapitaliseonstimulusopportunitiesinUSAandChina

Frost & Sullivan Pvt. Ltd.: Senior Research Analyst

• Advisedclientsinautomotive,energyandautomationverticalsonmarketentryand product strategy

• Handledpre-salesandsolutionsfortwoFortune50accounts

• Trainednewrecruitsonengagingclients

Prashanth Venkatesh

English, Hindi, French

B.E. (Electronics & Communications), Manipal Institute of Technology

5 years 10 months of experience in IT (Products) industry.

Motorola (India) Pvt. Ltd.: Senior Software Specialist

• Ledmarketrequirementanalysis,designedtest architecture and scenarios for Mobility Services Platform

• Workedontestprojectplanningfor250,000deviceoperationsforWalmart

• Designedprocessforend-to-endco-ordinationbetweeninternationalengineering and marketing groups

• LedWomens’BusinessCouncilIndiachapter

Alcatel-Lucent India Ltd.: Software Engineer

• Designedtestarchitecture,usecasestoensureproductscalabilityforSprint

VelankaniSoftwarePvt.Ltd.:MemberofTechnicalStaff

• Designedandmanagedtest-bedsetupforOccamNetworks

• WonexcellentcontributorawardfromOccam

Prerna Jain

English, Hindi

B.A. (Economics), University of Texas - Austin

4 years 3 months of experience in Consulting industry.

Hewitt Associates (India) Pvt. Ltd.: Associate

• Performancemeasurementandemployeeengagement projects

• WonaWorldBankprojectforIT/ITESdevelopmentinanAfricannation

• HewittAmbassadorAward(2008)

• WorkedonHRProcessconsolidationprojectforaGermanautomajorinChina

• Workedon‘EmployeeListening’projectcovering7000+employeesforalargeretail conglomerate in the Middle East

• HelpedstrategiseoutsourcingdecisionsforalargeelectronicscompanyinUS

Pritika Idnani

English, Hindi

B.Tech. (Chemical Engineering), IIT Mumbai

5 years 6 months of experience in Consulting & FMCG industry.

Accenture India Pvt. Ltd.: Consultant

• Globalmanufacturingstrategyandcapacityplanning for a big oil field services player

• StrategicsourcingofautoancillariesfromIndiaandChinaforaglobalfreightand logistics leader

• Inventoryoptimisationandsupplychainplanningprocessesoutsourcingfora healthcare hi-tech major

Procter&Gamble,Japan,K.K:Scientist

• Ledthetechnicalandfinancialfeasibilityanalysisfornewproductlaunch

• Marketandconsumerresearchtoidentifytargetsegmentsformulti-tierbrand proposition

Puneet Jain

English, Hindi, Punjabi

M.Com., Lala Lajpatrai College of Commerce & Economics, University of Mumbai

BMS, Narsee Monjee College of Commerce & Economics, University of Mumbai

4 years 8 months of experience in Financial Services industry.

Bloomberg L.P.: Sales Specialist

• SalesandproductdevelopmentandTrainingforfinancialinstitutions/corporates across Middle East and South Asia

• ResponsibleformanagingannualrevenuesofUSD7million-largestindividual responsibility in MESA

• Teamachievedthehighestnetsalesgrowth(globally)of4%in2009-10

• Awarded‘Sales-MostInnovative’2009

• Increasedbusinessataleadingpublicsectorbankby300%

• Bestperformergloballyinanalyticsdepartment-2006

Puneet Makkad

Page 33: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

64 65

English, Hindi

B.Tech. (Ocean Engineering & Naval Architecture), IIT Chennai

5 years 9 months of experience in Consulting industry.

Aqua Management Consulting Group: Consultant

• Saved12%indistributioncostthroughre-designof distribution network for a consumer goods company

• Implemented10%reductioninprocurementcostofMROitemsforasteelcompany

• Effected8%reductioninlogisticsspendforanautoancillarycompany

IBM Global Business Services (GBS): Business Transformation Consultant - Supply Chain Strategy

• Achieved5%reductioninoperatingcostofanaircargocompanythroughre-design of business processes

• Formulatedoperatingprocessesforastartupexpressdeliverycompany

i2 Technologies (India) Pvt. Ltd.: Consultant (Supply Chain Management)

Infosys Technologies Ltd.: Software Engineer (Transportation & Services)

Rachit Rungta

English, Hindi

B.Tech. (Textile Technology), IIT Delhi

4 years 7 months of experience in Private Equity industry.

FIRE Capital Fund Pvt. Ltd.: Investment Associate

• Workedon4privateequitytransactionsintheReal Estate sector

• Evaluatedover50dealsspanningresidential,commercialandindustrialrealestate

Strategic Decisions Group: Business Analyst (Associate Consultant)

• HelpedanIndianinfrastructuremajortoincreasetheprofitabilityofitsairport

• Strategicduediligenceofafinancialservicescompanyforaleadingprivateequity fund

ICF Consulting, India: Analyst

• HelpedaglobalenergygianttoassessthedemandforNaturalgasintheIndian power sector

Raghav Bahl

English, Hindi, Tulu, Kannada, Tamil, Telugu, German, BasicJapanese

M.Sc., (Hons.) (Chemistry), BITS Pilani

B.E., (Hons.) (Mechanical Engineering), BITS Pilani

4 years 9 months of experience in Process Consulting - Automotive industry.

Mercedes Benz Research & Development India: Senior Lead Engineer

• StarTeamAward2009winnerforexcellenceincustomersatisfactionratings

• ConsultedDaimlerforimprovingMercedesBenzvehicletestingprocesses

Altair Engineering (India) Pvt. Ltd.: Technical Analyst

• AltairIndiaBestEmployeeawardin2007

• ConsultedHonda,Japanandreducedthevehiclesimulationtimeby75%

• PublishedadesigncasestudyinanEngineeringTextbook

Raghavendra D

English, Hindi, Malayalam, Tamil

B.Sc.(MechanicalEngineering),RIT,Jamshedpur

5 years 6 months of experience in Manufacturing industry.

Ashok Leyland Ltd.: Deputy Manager

• CoreteammemberforValueEngineeringandField Failure Engineering Designs which led to annual

savings of INR 270 million

• Singlepointcontactforengineeringdesignmodificationinsourcing

• DevelopedMachining,ForgingandCastingcomponents

• Meetingwithsuppliersforlowercost,betterqualityandtimelydelivery

• FormedqualitycirclewinningameritawardatNationalLevelPresentation

• TeammemberforimplementationofProductLifeCyclemanagement

Rahul Justin

English, Hindi, Tamil

B.E. (Electrical & Electronics), Sri Ramasamy Memorial Engineering College, University of Madras

5 years 6 months of experience in IT Products industry.

VerizonDataServicesPvt.Ltd.:ModuleLead

• Systemarchitecturesdesign,ResourceManagement

• Ledtheintegration,testing,deploymentandsupportforcross-functionalteams

• ‘OntheSpot’Awardfor3consecutiveyears

• DevelopedandlaunchedthefirstwirelessproductfromVerizonIndia

Siemens Ltd.: Graduate Trainee Engineer

• Customerservicedirectlyorthroughvendors;VendorManagement

• Customerinteractionandfeedbackanalysis

Rahul Rajappa

English, Hindi

B.A. (Economics), Delhi College of Arts & Commerce, University of Delhi

5 years 3 months of experience in Financial Services industry.

iVenturesCapitalPvt.Ltd.:VicePresident-Sales&Distribution/Trader

• ManagedportfolioofINR120millionDirectEquity,INR50millionNIFTYOPTIONS, INR 80 million MF

• RaisedcapitalforNSEmembership

• Diversifiedintobroking,builtnewdistributionchannelsandexpandedbranch network resulting in 4 fold increase in profits

Deutsche Bank: Relationship Manager - Private Banking

• AcquiredandManagedINR200millionforHNIsandcorporates

• Outperformedtargetsfor8outof8quarters

DSP Merrill Lynch: Management Trainee

• Managed150distributors,3nonbankandHDFCBankrelationships

• Increasedupcountrybusinessby20%

Rajat Sehrawat

English, Hindi, Bengali

B.Tech. (Mining Engineering), ISM Dhanbad

5 years 9 months of experience in Extractive Minerals industry.

Orica Mining Services - Indian Explosives Ltd.: Business Development Manager

• ManagedproductportfolioworthUSD60million

• LaunchedaRevolutionaryExcavationTechnology(EBS)inIndia,increasing bottomline by 5% in 2007

• AsRegionalManager,achievedgrowthof15%incustomerbaseand22%inannual revenue for an SBU worth USD 8 million

• Globalappreciationaward‘DeliverthePromise’forstrengtheningthenascent consulting division in India.

• CertifiedCommercialNegotiatorforOrica

Rajesh Daruka

English, Hindi

B.Tech.(ElectricalEngineering),NITJaipur

5 years 7 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Technology Lead

• Managedclientrelationshipsandprojectdevelopment for a USD 15 million investment bank client

• Automatedstockloanandstockborrowclaimsprocessing.Savingof30person- hours per week

• FirstconsultanttobeappointedasDomainExpertbytheinvestmentbankingclient

• Re-engineeredassetservicingtechnologydrivenprocesses.Businessrevenuegain: USD 320,000

• HandledclientinmultiplegeographiesacrossIndia,JapanandtheUK

Rajiv Baheti

English, Hindi, Punjabi

B.Tech. (Hons.) (Electronics and Communication), Giani Zail Singh College of Engineering & Technology, Punjab Technical University

5 years 6 months of experience in Consulting industry.

Nokia Siemens Networks Pvt. Ltd.: Senior R&D Engineer

• FeatureManagerforUSD1.5billion3GprojectforVerizonandFranceTelecom

• LedfirsteverproductdemoforPTTTelecom

Wipro Technologies: Module Lead

• ModuleleadinUSD12million3GItaltelproject

Penta Consulting, UK: NGN Engineer

• Handledmigrationof100,000subscriberstonewtechnology

Huawei TeleCommunications (India) Co. Pvt. Ltd.: Switch and NGN Engineer

• HandledUSD70millionproject

Green Commandos (founded in 2008, Bangalore and Mumbai): Founder

• Broughtcountry’stopprofessionalsinGoverningCouncil

• Currentfocusareas:Brandbuilding,marketing,fund-raising,wxpansioninother cities, strategising for existing chapters

Ravi Agnihotri

English, Hindi

Bachelor of Financial & Investment Analysis, College of Business Studies, University of Delhi

4 years 2 months of experience in Education industry.

MindValleyLLC.:ProjectManager

• LeadingtheOnlineLaunchofDomainAdvantageEarly Education Products globally

AIESECInternational:VicePresidentExternalRelations

• Leadingmulticulturalteamstoexpandglobalpartnershipsinemergingmarkets

• AchievedrevenuesofUSD1.2millionandsignedlargestpartnershipwithaglobal bank

AIESEC in India: President of AIESEC in India

• LeadingstrategicgrowthandexpansionofAIESECinIndiato14citiesand 900 members

• LeadingthecreationofAIESECIndiavision2010document

Rishabh Chopra

English, Hindi

B.E. (Hons.) (Mechanical), Delhi College of Engineering, University of Delhi

4 years of experience in Consulting and Manufacturing industry.

Accenture Management Consulting: Consultant, Supply Chain Management

• Categoryprofiling,industryanalysis,spendanalysisandnegotiationstrategy development for a financial services client: Achieved cost savings of USD 3 million

• Low-cost-countrystrategicsourcingengagementforanautomotiveclient:Market AssessmentandVendorManagement

• PivotalindevelopingGlobalOfferinginSourcingandProcurementpractice

Maruti Suzuki India Ltd.: Assistant Manager

• Projectmanagement:Designingprocessesandsystemsforinboundsupplychain activities and sales and dispatch operations

Rishi Suri

English, Hindi, Punjabi

B.Tech. and M.Tech (Bio Chemical Engineering and Bio Technology), IIT Delhi

5 years 9 months of experience in Pharmaceuticals industry.

Biocon Ltd.: Deputy Manager

• ProductionManagerforfiveproductionunits generating annual revenue of USD 22 million

• CompletedcertificationsforregulatoryauditsbyUSFDAandEuropeanMedical Agency (EMEA)

• Ledacross-functionalteamtooptimizefermentationprocessfortwoproducts resulting in annual savings of USD 2.8 million

• LedtwofacilityexpansionprojectswithcombinedCAPEXofUSD5.75million

• ReducedenergyconsumptionresultinginannualsavingsofUSD180,000

Ritesh Kumar Sharma

Page 34: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

66 67

English, Hindi , German

B.Sc. (Hons.) (Computer Science and Management Studies), University of Nottingham, UK

4 years 6 months of experience in Private Equity industry.

MKT Securities Pvt. Ltd.: Director

• Co-founderofwealthmanagementfirmhandling portfolios of HNIs

Dubai International Capital (DIC): Analyst

• Sourcedandevaluatedinvestmentopportunitiesinemergingmarkets

• Developedportfoliocompaniesthroughbusinessexpansionstrategies

• KeymemberofIndiafocusteam

Citigroup: Relationship Manager

• Managedaportfolioof30firmsforcommercialcorporatebanking

• ProjectLeadforRealEstateCreditProgrammeforCitiUAE

• SelectedforManagementAssociateProgramme,aGlobalLeadershipProgramme within the corporate banking division

Rohaan Kapoor

English, Hindi

B.Com. (Hons.), Shaheed Bhagat Singh College, University of Delhi

4 years 9 months of experience in Consulting industry.

Grant Thornton: Consultant

• LedateamforBusinessPlanManagement,Project Planning, and client interface

• Evaluatedbusinessopportunities,firmedupbusinessvaluepropositions

• WasinvolvedinStrategicAdvisoryandFinancialModeling.AlsoexperiencedinHR advisory which included Manpower Planning

Ernst & Young Pvt. Ltd.: Trainee

• IndustryAnalysis&ResearchandTransactionSupport

Rohit Bahadur

English, Hindi, Punjabi

B.Tech. (Electronics and Communications), Dr. B. R. AmbedkarNationalInstituteofTechnology,Jalandhar

5 years 9 months of experience in Electronics and IT (Services) industry.

Freescale Semiconductors: Design Engineer II

• HandledIndiaDesignCenter’sactivitiesrelatedto verification of multi-core networking chip

• CoordinatedwithteamsfromCanada,US,Israelandexternalvendors

• Providedtrainingtoteamsinnetworkingdepartment

Wipro Technologies: Senior Project Engineer

• LeddesignteamoffiveinVLSIdomain;interfacedwithNewLogicteaminFrance

• ReceivedExcellenceaward‘Trailblazer’,March2006,forBestProjectdelivery

• Improvedproductivityby20%andreducedpowerconsumptionofIPby7%

Roopan Aulakh

English, Hindi, Marathi, Konkani, French

CA, ICAI

B.Com., R A Podar College of Commerce and Economics, Mumbai University

4 years 2 months of experience in Investment Management industry.

Deutsche Asset Management (India) Pvt. Ltd.: Manager

• WasinstrumentalinsettingupthecompletebackofficeprocessforthePMS Business

• WasuptodatewiththePMSRegulationsandensuredcompliance

• PlayedanimportantroleinsettingupfirstnondiscretionaryPMSProductformutual fund investments

ICICI Prudential AMC Ltd.: Assistant Manager

• Haveahandsonexperienceoftheentirebackofficeprocesses

• Wasrated‘ExceedsExpectations’inanalyticalthinking,processconsciousnessand initiative

Roshal Dsa

English, Hindi, Tamil, French

B.E. (Computer Science), Manipal Institute of Technology, Manipal Academy of Higher Education

5 years 6 months of experience in Consulting industry.

KPMG - UAE: Consultant

• Advisedclientsonstrategicengagementsfrom business plan development to business process re-engineering

• Co-developedandimplementedstrategyprogrammestogrowfirmsrevenueby37%

• Developedwinningmulti-milliondollarglobalproposalswithKPMGmanagement from 35 global offices

• ExpandedpresenceintheUAEbysettingupanewofficeinanotheremirate

Torry Harris Business Solution: Business Development Executive

• Builtrelationshipswithglobaltechnologyvendors

• Selectedtoset-upoperationsinOman

Roshan Victor Joseph D’Souza

English, Hindi

BS (IT and Finance), Rochester Institute of Technology

5 years 3 months of experience in IT (Services) industry.

Tata Consultancy Services Ltd.: Assistant Systems Engineer

• GapAnalysisforcentralisingCitiFinancials’subprime mortgage lending operations

• ImplementeddistributionchannelforAXAInsurancewhichledtoUSD28millionyield for insurance products

• SecuredTechnicalSupportoffshoringprojectfromCVSPharmacyworth USD 8 million for TCS by submitting a competitive financial and technical proposal

• StreamlinedWalgreen’ssupplychainandlogisticsoperationsacross3000+US branches

Saad Ahmed

English, Hindi, Marathi

B.E. (Computer Science), Sardar Patel College of Engineering, University of Mumbai

4 years 9 months of experience in Publishing & Media and IT (Services) industry.

Thomson Reuters: Sales Specialist

• Identifiedandqualifiednewopportunitiesintreasury and fixed income

• Formulatedsalesplansandexceededtargetby30%fortreasuryandfixedincome products in South Asia

• Preparedandpresentedbusinessproposals.Negotiatedcontracts

• ClosedstrategicdealsworthUSD250,000(annualrecurring)

• NominatedtoHiPo-aprogrammetogroomtop10percentforleadershiproles

Accenture Services Ltd.: Software Engineer

• Designedsolutionbyunderstandingclient’srequirements

• Managedsoftwaremodulesend-to-end

Sachin Kumar Somani

English, Hindi, Telugu

MS (Computer Science), University of North Carolina, Charlotte

B.Tech. (Computer Science & Engineering), Kakatiya Institute of Technology & Science, Warangal, Kakatiya University

4 years 3 months of experience in IT (Products) industry.

EMC Corporation: Technical Lead

• DevelopedandreviewedoneofthemodulesofStorageAreaNetworkmanagement software

• Preparedthescopingdocumentandwrotefunctionalspecification,unittestand integration test plan documents

• Gavetechnicalpresentationstopre-salesandtestingteams

• Awarded‘EMCWhoDoneIt’prizeforresolvingaproblematoneofcompany’s largest clients

August Technologies: Software Consultant

• Fixedbugsinsoftwareandenhancedtheproductforfuturereleases

Sai Swaroop Thota

English, Hindi

B.Sc. and M.Sc. (Mathematics & Computing), IIT Kharagpur

4 years 6 months of experience in Financial Services industry.

Ocwen Financial Services: Practice Manager

• Ledateamof3inconstructingassetpricingmodels, used currently to price assets worth USD 48 billion

• Ledateamof4tobuildpredictivemodelsusedinpricingassetsworthUSD40billion

Futures First Info Services: Derivative Analyst

• Tradedinworld-widecrudemarketsonNYMEXandICEexchangeswithintra-day trading limit of USD 1 million

• Analysedgeo-politicalfactorsaffectingcrudeprices

i2 Technologies: Associate Consultant

Saket Giri

English, Hindi

BS (Computer Science), Georgia Institute of Technology

4 years 7 months of experience in Consulting industry.

Deloitte Consulting: Senior Consultant

• Extensiveexperienceinfullrangeofsourcingand procurement processes including category

management, strategic sourcing, contracts management and supplier enablement as well as enabling technologies

• Deepexperiencewithstreamliningsourcingandcontractsmanagementprocesses, software selection, systems integration, and organisation design

• Helpedorganisationalre-deisgnandmanagedresultingchange

• Workedwithin-houseGeneralCounselstoredesignandimplementcontracts management

• Solee-SourcingconsultantatDeloitteConsulting

Salil Das

English, Hindi, Punjabi

B.E. (Computer Science), Shirdi Sai College of Engineering,VisvesvarayaTechnologicalUniversity

5 years 9 months of experience in IT (Products) industry.

SumTotal Systems India Pvt. Ltd.: Solutions Architect (Intercontinental Sales, APAC Region)

• Pre-salesandconsultingforHumanCapitalManagementSoftwareproductsacross domains

• ExperiencedinSaaSandEnterprisesoftwaredealsinIndiaandSouthEastAsia

• End-to-endproductlifecycledevelopmentandmanagementexperience

• CreatedandlaunchedthebusinessplanforSaaSsalesinIndia

• Created,implementedandmanagedglobalsupportprocessesforallcustomersin Japan

Sameer Mehta

English, Hindi

MS (Computer Science), University of Texas, Arlington

B.E.(Hons.)(ComputerScience),VaishCollegeofEngineering, Maharshi Dayanand University

5 years 11 months of experience in Venture Capital industry.

Riverdale Investments Pvt. Ltd.: Founder

• Startedaseedfund(Riverdale),raisedUSD300,000

• InvestedinFood&BeverageandSaaSfortraveldomaincompanies

• Handledfinanceandpurchasefortheinvesteecompany(F&B),grossingINR50 million in revenues in its first year of operations

HCL Technologies Ltd.: Associate Business Manager

• Bidandwonaccounts(retail,media&entertainment)withUSD50millionannualsales

• LedHCLforayintoE-learningmicro-vertical

Zensar Technologies Ltd.: Business Analyst (BFSI domain)

Tata Consultancy Services Ltd.: Systems Engineer (BFSI domain)

Sandeep Goel

Page 35: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

68 69

English, Hindi, Kannada

B.E.(MechanicalEngineering),GoldenValleyInstituteofTechnology,VisvesvarayaTechnologicalUniversity

5 years 8 months of experience in Manufacturing industry.

Deccan Hydraulics Pvt. Ltd.: Director - Material control

• Establishedanewlogisticscompany,DeccanLogistics

• ImprovedoutputatfactoryproducingVolvochasisby200%

• Increasedproductivityatfactoryproducingfueltanksby50%

• Automatedwarehouseoperationsleadingtoa20%inventoryreduction

• IntegratedSAPacrossallcompanyofficesandfactories

• Taughtstudentsinruralschoolsaspartofourfoundation’sactivities

Deccan Hospital: Engineer

• Implementedhospitalmanagementsoftware

Sandeep Ramakrishnappa

English, Hindi, Bangla

B.Tech. (Hons.) (Instrumentation), IIT Kharagpur

5 years 9 months of experience in IT (Products) industry.

VmokshaTechnologies/RetiveSolutions:AssistantConsultant

• SupervisedenhancementstotheRetailITsuite-70% revenues for USD 1.5 million retail vertical

• TeamLead(6members)fordesignanddevelopmentofretailframework

• Built15-memberteamin8monthsanddeliveredfirstsolutionwithin6months

• Managedintegrationof10applicationsacrossTangs4subsidiaries

• ImplementedUSD500,000merchandisingsolution

VmokshaTechnologies:AssociateSoftwareEngineer(Retaildomain)

• RedesignedRBSmerchandisingsystem,enablingtheclienttoexpandfrom30to 130 stores

Sandip Chaudhuri

English, Hindi, Malayalam, Tamil

B.E.(ComputerScience),SardarVallabhbhaiNationalInstitute of Technology, Surat

4 years 9 months of experience in IT (Services) industry.

CSC India Pvt. Ltd.: Senior Software Engineer

• LedaglobalteaminanenterpriseITintegrationand successfully executed USD 2 million system integration project

• RecepientofSpecialRecognitionAwardfromGlobalPresidentofCSCConsulting

• SixSigmaGreenBeltCertified

• PartofthetaskforcethatdefinedprojectprocessesforCSCIndiaConsultingGroup

• LedaSixSigmaprojecttoimproveproductimplementationandmaintenance processes which reduced defect count by 40%

Sangeeth Aloysius

English, Hindi, Tamil, Sindhi

MBA, ICFAI University, Chennai

B.Com., Loyola College, University of Madras

5 years 1 month of experience in Retail industry.

Foodworld Supermarkets: Area Manager

• Settingbudgetsandmonitoringperformanceof 6 stores in Chennai

• Identifyingsitesforthesettingupofsupermarketstoincreasecompanypresence

• Increasedprofitabilityby7%usingsalespushandreducingcosts

Spencers Retail: Assistant Manager

• ThreefoldincreaseinsalesofapparelcategoryinChennaibyusingnewPlanogram

• Reductioninemployeeturnoverby20%inChennaistores

• Effectedanewtrainingscheduleresultinginreductionofemployeeattrition

Sanjeev A Nichani

English, Hindi, Punjabi

B.Tech. (Electronics and Communication), IIT Roorkee

5 years 9 months of experience in Consulting industry.

Evalueserve: Group Manager

• Managedresearchoncompetitiveandcustomer landscape, investment opportunities and technology evaluation for a Fortune 15 energy major

• Consultedglobalenergyclientsonoptimisingstrategicintelligenceandknowledge management portfolio

• SetupenergyanalystteamsinIndia,ChinaandChile

• Didbusinessdevelopmentin10+countriesacross4continents

• WontheEvalueserveleadershipandbestteamawards

Larsen & Toubro Ltd.: Management Trainee

• Marketandtechnologyidentification

• Preparationofcommercialbids

Sanjeev Bhalla

English, Hindi, Punjabi

B.E. (Mechanical Engineering), Thapar University, Patiala

4 years 8 months of experience in Hospitality industry.

Sunshine Gardens: Managing Partner

• Saved28%projectcostconstructinganeventvenue for 1000 capacity

• Consolidatedeventmanagementserviceswiththevenuetoprovideonestop solution

• Consolidatedeventmanagementpublicitythroughnetworkingandcollaboration

• EstimatedrevenuefromoperationsFY2010-INR6.5million

Sanjit Singh Paul

English, Tamil

B.E. (Computer Science), PES Institute of Technology, VisvesvarayaTechnologicalUniversity

5 years 8 months of experience in IT (Products) industry.

Independent Technology Systems Pvt. Ltd.: Senior Development Consultant

• BSS/OSSSolutionArchitectureandDesignforIPbaseddataservicesforanISP business

• KeyroleindeliveryofBSS/OSSsolutionsforMTNNigeriausinganAgile Development approach

• SolutionEffortEstimationandBusinessImpactAnalysis

Tecnomen Lifetree Corporation: Senior Software Engineer, Delivery

• ManagedprojectdeliveryforvoiceandbroadbandservicesforMTNAfrica

• CMMIapprasialTeamMember,partofimportantCMMIL3SCAMPI

• BestEmployeeAward2004

Santhosh Shankar

English, Hindi, Telugu, Kannada

B.E.(ElectronicsandCommunications),RVCollegeofEngineering,VisvesvarayaTechnonogicalUniversity

4 years 7 months of experience in Electronics industry.

Agilent Technologies India Pvt. Ltd.: Application Engineer

• WorkedwithsalesonRFandMicrowavesolutionsfor Defense, Aerospace and Telecom

• RunnersuppositioninAgilentIndiaInnovationcontest

• ‘QuotabusterAward’and‘TopContributorAward’

National Instruments: Product Specialist

• GrewsalesofmotionandvisionproductsinPharmaandManufacturingsectors

• Identified2channelpartnersfortheseproductlines

• Conductedthefirstevertrainingonmotionandvisionproductsforchannelpartners

Santosh Reddy Nigudagi

English, Hindi, Kannada

Masters in Information Systems Management, Carnegie Mellon University

B.E. (Information Science), BMS College of Engineering, Bangalore,VisvesvarayaTechnologicalUniversity

4 years 8 months of experience in Consulting industry.

Collabera Solutions: Senior Consultant

• Advisedmid-tierUSBankontheenterpriseCRMstrategyandvendorselection

• ManagedanSOAmigrationstrategyandevaluationforelectricitygridregulator

Diamond Management and Technology Consultants: Senior Associate

• ManagedtheoverallprogrammeexecutionofaUSD15millioncustomerexperience initiative at a leading financial services company

• Advisedaninvestmentbankonthelaunchofanationalbank

Deloitte Consulting: Consultant

• Workedwithhealthcareandpublicsectorclientsontechnologyarchitectureand strategy projects

Santosh S Kumar

English, Hindi, Punjabi, French

B.E. (Computer Science), Netaji Subhas Institute of Technology, University of Delhi

4 years 8 months of experience in IT (Products) industry.

Q3Technologies,Inc.:Lead-JavaGroup

• Newprojectappraisals,pricingandstrategicplanning fortheJavadivision

• Nurturingandexpandingthe20memberJavateam

gDev: Team Lead

• SettingupandmanaginggDevsgTeam-agloballydistributedteamofdevelopers

• Trackingteamperformanceandhelpdefineworkflowandserviceguaranteesfor gTeam

Tribal Fusion: Senior Software Engineer

• Designingstrategiestoimproveperformanceof‘LeadGenerationPlatform’

Trilogy E-Business Software (India) Pvt. Ltd.: Technical Associate

• PartofcoreteamthatdesignedFord’s‘BuildandPrice’onlinesolution

Sarabjit Singh Dua

English, Hindi, Malayalam

B.Tech. (Hons.) (Energy Engineering), IIT Kharagpur

4 years 9 months of experience in IT (Products) industry.

Sterling Commerce Solutions India Pvt. Ltd. (An AT&T Company): Delivery Consultant

• Analysingcustomerrequirementsandrecommending customised IT solutions to meet their requirements

• DesignedandDeliveredcustomisedsupplychainITsolutionsforseveralFortune 500 retail majors

• DeployedITsolutionsatcustomerssites

Sarath Chandran

English, Hindi, Kannada, Tamil

B.E. (Electronics and Communication), Bangalore Institute ofTechnology,VisvesvarayaTechnologicalUniversity

4 years 10 months of experience in IT (Products) industry.

Hewlett Packard, India Software Operation Pvt. Ltd.: Software Engineer - (level T2)

• TeamLeadfordesignanddevelopmentofvirtualisationandnetworkingproductsfor Storage and Server division

• PartofVSEevangilisationprogramme

• WorkedonThinkHPFirstfreshtalentrecruitmentteam

• MostValuablePlayerforQ32007fromSeverVirtualisationandI/Olab

• TopPerformer-Ratedinthe‘consistentlyexceedingexpectations’bandof employees for two consecutive years

Satish Kumar Subramani

Page 36: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

70 71

English, Hindi

B.Tech.(InformationTechnology),BharatiVidyapeeth’sCollege of Engineering, GGSIP University

4 years 7 months of experience in Electronics industry.

Freescale Semiconductors: Design Engineer 2

• Workedonpre-packagedchipsetsolutionsfor Automotive and Consumer Durable industry

• Showcasedprototypesolutionsinproductmarketingcycles

• LedateamtowinClustorautomationchipdesignforNano

• Securedonedefensivedisclosureandwrote6technicalpublications

• WonBravoawardsfortwoconsecutiveyears,onepersonselected

Montalvo Computer Systems Pvt. Ltd.: Design Engineer 1

• Moduleleaderformicrocontrollerdesign

Conexant (India) Pvt. Ltd.: Software Engineer

• LedIndiateamtowinUSD5millionworthpowerlinecommunicationdesign

Saurabh Jhamb

English, Hindi

Master in Finance and Control, Dept of Financial Studies, University of Delhi

B.A. (Hons.) (Economics), Shri Ram College of Commerce, University of Delhi

4 years 11 months of experience in ITES/BPO industry.

Genpact Ltd.: Senior Consultant - Catastrophe Pricing

• Estimatedlossandpremiumforreinsurancepoliciescoveringnaturalcatastrophicrisk

• WorkedonCatastropheBonds,insuranceproductsrelatedtoterrorismandState Catastrophe Funds

• Analysedcatastropheexposedbooksforcapacityallocationandprovidedrealtime loss estimates

• Trainedreinsuranceunderwritersofclientoncatastrophepricing

• WonthecrucialbusinessfromtheNewYorkofficeofSwissReinsuranceCorporation

Saurabh Verma

English, Hindi

AFP, International College of Financial Planning, Financial Planning Standards Board, India

B.Sc.(Hons.)(Maths),SriVenkateswaraCollege,Universityof Delhi

4 years 9 months of experience in Education & Financial Services industry.

Bajaj Capital’s International College of Financial Planning: Senior Manager - Strategic Education

• Strategictie-upsforexchangeprogrammesandcorporaterelationsforplacements

• Handledcoursesonpersonalitydevelopmentandcommunicationskills

• 100%placementsofstudentsatpan-Indiacampuses

• LaunchedFuelSourceManpowerSolutions(ExecutiveSearchCompany)forBajaj Capital

Fidelity Business Services India Pvt. Ltd.: Customer Relations Executive and Business Continuity Planner

• HandledescalatedqueriesasperFSAprocedures

• HandlingbreachdepartmentandMIStoseniormanagement

• PlatinumAward-highestindividualaward

• BestNewcomerAward

Saurav Atri

English, Hindi

Bachelor of Applied Sciences (Electrical Engineering), University of Windsor

4 years 3 months of experience in Engineering industry.

Technico Industries Ltd., Bawal, Haryana: Chief Operating Officer

• Setupanewplant(300workmen)formanufactureofautoparts

• StreamlinedthesupplychainandERP(50members)

• Productionplanningforassemblyshop

Leggett and Platt Automative, Windsor, Ontario: Control Systems Engineer

• Retrofitedmajorautomatedlines

• Trainedengineersandskilledtradesonautomation

• Ledthecontinuousimprovementteam-PlantAutomation

Hastech Mfg, Linamar Corporation, Ontario: Manufacturing Controls Engineer

• Programmedrobots,logiccontrollers

• Implemented5Sandleanmethodology

• Improvedoperatorhealthandsafety

Sawan Sethi

English, Hindi, Bengali

CA, ICAI

B.Com. (Hons.), St. Xavier’s College, University of Calcutta

4 years 8 months of experience in Consulting & Banking industry.

PricewaterhouseCoopers: Senior Consultant

• PartofEnergyandPublicEnterpriseReformsgroups under PwCs GRID practice

• Involvedinprojectsondisinvestments;performanceimprovementofelectricity utilities

Citibank NA: Assistant Manager

• AspartofCorporateBank,ledCashManagementSolutionsteaminKolkata

• HandledmigrationofpaymentplatforminKolkatabranch

PricewaterhouseCoopers: Consultant

• Involvedindevelopingrestructuringstrategiesforpublicenterprises

• Involvedinsuccessfulprivatisationof3enterprisesofGovernmentofWestBengal

Sayak Dey

English, Hindi

CA, ICAI

B.Com. (Hons.), Shri Ram College of Commerce, University of Delhi

4 years 7 months of experience in Consulting industry.

PricewaterhouseCoopers: Assistant Manager (Tax & Regulatory Services)

• ProvidedholisticbusinesssolutionsandrepresentationservicestoMNCs(Oil&Gas domain)

• Partofteamimplementingaschemeofmergeranddemergerforalistedcompany (3 stock exchanges)

• InstrumentalinwinningacaseinvolvingdisputeofINR15billionatTribunalLevel

• Co-authouredanarticlepublishedin‘TheHindu’andPetrofedjournal

SR Batliboi & Co. (member Firm of Ernst & Young India): Executive (Taxation)

• TPdocumentation/presentation

GE India Business Services Pvt. Ltd.: Senior Officer

• DesignedanddocumentedTPpoliciesofGEHealthcareentities

Shally Gupta

English, Malayalam

BS (Electrical/ Computer Engineering), Calvin College, Grand Rapids, Michigan

4 years 2 months of experience in Diversified Manufacturing industry.

Emerson Process Management: Principal Engineer

• Createdandconductedtestplans,established timelines and scope, generated reports and recommendations

• Ledprojectstostandardisecustomerinterfacesacrossproductlines

• RestoredBPprojecttoscheduleandcostparametersbyutilisingbestpractices

• DesignedcontrolsystemarchitectureforBPTexasCity

ABB Inc.: Engineer - I

• ImplementedABBsystemforChevronsWestAfricaGasPipeline

• Managedsubcontractorswork,providingtrainingandassigningwork

Sharon Abraham

English, Hindi, Maithili

MS (Transportation), University of Missouri

B.Tech. (Civil), IIT Chennai

5 years 5 months of experience in Engineering industry.

ICON Consultant Group Inc.: Transportation Engineer/Planner

• Performedtechnicalanalysisanddesign

• NegotiatedoverUSD5millioninImpactFeesforUniversityofSouthFlorida

• Preparedproposalsandco-ordinatedwithclients(Public&Private)

• DevelopedefficientdesignandcalculationproceduresfortheTrafficDesignGroup

Post,Buckley,Schuh&Jernigan,Inc.:TransportationEngineer

• Interpretedtrafficdataandforecastfuturetraveldemand(roadsector)

• Performedoperationalanalysisandrecommendedsolutions

• Presentedfindingstoclient(Government)

• Presentedfindingsreviewofstudiesconductedbyotherfirms

Shashi Ketu

English, Hindi

B.Tech. (Information Technology), College of Technology, Govind Ballabh Pant University of Agriculture & Technology, Pantnagar

4 years 6 months of experience in IT (Services) industry.

Tata Consultancy Services Ltd.: Assistant Systems Engineer

• LedateamtomigrateOpenSourceproductsforNonStopenterpriseserversplatform

• ManagedclientrelationshipforHPBenchMarkProductsSuite

• Reducedperformance-footprintofHPflagshipserverby300%in4months

• Wonpitchesfor2developmentprojectsfromHP

• ManagedoperationsofteamworkinginTransactionServicesGroup

BlackBull Investments: Co-founder

• Co-founderofastart-upinretailinvestoreducation

Shivam Gupta

English, Hindi, Gujarati, Marathi

B.E. (Computer Science), Mahavir Education Trust’s Shah Anchor Kutchi Engineering College, University of Mumbai

5 years 7 months of experience in IT (Services) industry.

Dave Shah & Co. Switchgear Pvt. Ltd.: Director

• Startedanewbusinessverticalbyprovidingend-to-end electrical solutions

• DeployedERPtoreduceoperatingcosts,aidday-to-daymanagementandsupport strategic planning

• Inventorymanagementandvendordevelopment

Satyam Computer Services Ltd.: Associate Consultant

• WorkedonERPprojectsacrossdomains

• 100%resolutionofallclientissueswithintheSLAtime

Godrej Infotech Ltd.: Programmer Analyst

• ERPprogrammingandadministration

• TechnicalLeadforERPimplementations

• Involvedin3ERPimplementations

Shivang D Dave

English, Hindi

B.Tech. (Civil), IIT Guwahati

5 years 8 months of experience in IT (Products and Services) industry.

Oracle India Pvt. Ltd.: Project Leader (Supply Chain Planning)

• ManageddevelopmentandreleaseeffortsforDemand Signal Repository product at IDC

• Leddevelopmentteams(6members)formultipleproductsinValueChainPlanning area

• Designedandevaluatedtechnicaldesignsfordatawarehousingandanalytics

• AppreciationforoutstandingcontributioninsuccessfulreleaseofAPCCandDSR products

• Recruitmentpanelistincampusandwalk-inrecruitmentdrives

Tata Consultancy Services Ltd.: Assistant Systems Engineer (Group Insurance)

• Developedsoftwaresupportforpricingdecisionsforaglobalmajor

Shreyans Daga

English, Kannada

B.E.(ComputerScience),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity

4 years 9 months of experience in IT (Products) industry.

Cisco Systems Inc.: Software Engineer

• Leda3memberteamonFaulthandlingforVPN failures

• WorkedonIn-servicesoftwareupgradeproject,reducingboottimeoftherouterfrom 5 minutes to 5 seconds

• Formedandleda6-memberteamoncertificationeffortsforcustomers

• WorkedonIPRANsolutionforMotorola;projectrevenueUSD65millioninthenext one year

• Front-endedMGXIndiateamforcustomerescalation

Shruti Purohit

Page 37: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

72 73

English, Hindi, Bengali

B.Tech. (Computer Science), ISM Dhanbad

5 years 8 months of experience in IT (Products) industry.

ARIENE Inc.: Programmer Analyst (Project Lead)

• Analysedanddesignedglobalsoftwarearchitectureof AIG Life Insurance in close liaison with the CTO

• LedateamatAIGLifeInsurancetodevelopLifeInsurancesoftwaresforbranch offices worldwide

Oracle India Pvt. Ltd.: Member Technical Staff

• ManagedProductOwnershipofOracleBusinessIntelligenceProductsuite

• DevelopedBusinessIntelligencesoftwaresolutions

Infosys Technologies Ltd.: Software Engineer

• DeliveredseveralhighworthprojectsforFortune500clients

• MemberofCenterofExcellenceTeaminContentManagementdivision

Shubhra Maji

English, Hindi, Bengali

B.Tech. (Computer Science), IIT Roorkee

4 years 9 months of experience in IT Products industry.

Oracle India Pvt. Ltd.: Senior Applications Engineer

• Designed,developednewfunctionalitiesforOracle Fusion

• Ledprojectstoenhancesecurity,decreasecustomerupgradedowntime

• Institutionalisedprocessestoincreasedevelopment-teamefficiency

• Implementedmorethan90bugs(67fixes,23features),lowestratioofbugs reopened to bugs fixed

• Reviewed60bugscomparedtoanaverageof25bypeers

Solidcore Systems (McAfee): Software Engineer

• Developed,testednewfeaturesofproductinhighlychargedentrepreneurial environment

Shukti Das

English, Hindi, Oriya, Bengali, French

B.E.(MechanicalEngineering),VishveshwaryaNationalInstitute of Technology

4 years 8 months of experience in Aerospace and Automobile industry.

Indian Space Research Organisation: Scientist Engineer C

• Co-ordinationwithmultipleteamstoevolvethe optimisedLaunchVehicleconfiguration

• Test,integrationandhandlingstagesandsub-assemblies

• Realisedcomponentsforsub-assembliesandstages

• Designed,integratedandtestedMoonImpactProbeofChandrayaanmission

• In-housetrainingworkshop

Bajaj Auto Ltd.: Engineer

• Improvedproductivity,qualityofcellsintheshopwiththeimplementationofTPM

• Reduceddeliverytime

Shuvashish Chatterjee

English, Hindi, Malayalam

B.Tech. (Electrical Engineering), NIT Rourkela

5 years 9 months of experience in IT (Services) industry.

Cognizant Technology Solutions: Senior Associate - Projects

• Ledandmanagedteamsworkingonsoftware maintenance and development projects

• Handledprojectestimationandresourcemanagement

• Consultedonsoftwareandprocesschangesforoverallsystemimprovementsand cost savings

• ProposedandimplementedaprojectthatsavedourclientoverUSD7million annually

• WorkedonclientlocationsintheUSA

• Startedprojectsandgrewthemintoprofitablebusinessaccountsforthecompany

Siddharth Rajiv Nair

English, Hindi

B.Tech. (Computer Engineering), Sikkim-Manipal University

4 years 11 months of experience in IT (Services) industry.

Encora Technologies Pvt. Ltd.: Module Lead

• Workedoninternettrawlingteamtogathershopping related data for Google Base and Google Product search

• Increasedthescopeandproductivityofmyteamresultinginhighercustomer satisfaction

Infosys Technologies Ltd.: Software Engineer

• CustomersupportinterfaceforRiskAnalystsatGoldmanSachsforDailyand Quarterly reporting needs

• WorkedonvalidationofCreditPricingmodelfromtechnologyperspective

Siddharth Raman Singh

English, Hindi, Punjabi

B.E. (Computer Science), Thapar Institute of Engineering and Technology

4 years 8 months of experience in IT (Services) industry.

Deloitte Consulting LLP: Consultant

• ClientFacingOnsiteLeadinUSAforDataMigration, managing offshore team in India

• Requirement-Analysis,Scope-Design&EstimationinProcuretoPay&FinancialERP

• WorkedaspartofDeloitteRFPteamtoestimateprojectscopewhilebiddingfor Global ERP consulting projects

CSC India Pvt. Ltd.: Software Engineer

• DesignanddevelopmentofOracle-EBSRICEcomponents

• 6certificatesofappreciationforoutstandingworkin3years

• NominatedforCSCEmployeeofQuarterandCSCWorldwideTechnicalExcellence Award

Simrandeep Singh Parmar

English, Kannada, Marathi

B.Tech.(InstrumentationTechnology),SJCE,VisvesvarayaTechnological University

4 years 8 months of experience in Consumer Products industry.

Taylor Nelson Sofres (TNS) India Pvt. Ltd.: Research Executive

• Recommendedclientchangeadvertisingstrategy,thatincreasedsalesby15%

• Ensuredfieldworkcompletionevenduringfloodsandterroristattacks

AC Nielsen Bases: Team Leader

• WorkedontheconceptandproducttestingforClorox’sGreenWorks,andP&G’s Ariel Green concept, the first green products launched by these companies

• Designedandimplementedbusinessprocessesintheglobalresearchcentre,of AC Nielsen Bases, India

Wipro Technologies: Project Engineer

• Rebrandedasalesportalsinglehandedly

Sindhu V Kakade

English, Telugu

B.E. (Electronics & Communications), ANITS, Andhra University

4 years 9 months of experience in IT (Services) industry.

Mahindra Satyam: Developer

• WorkedonImplementationofCollectionsandBilling system for Ericsson UK and Ireland

• WorkedonRomanianrolloutofUKCollectionssystem

• DevelopedamiddlelayerapplicationforrealtimeintegrationbetweenBillingand Collections

• ImplementedRetailPointofSalesystemfor‘3’UKtomanagestoresales

• HandledtheFirepondemailmanagementforContactCenterof‘3’UK

Sireesha Dandu

English, Hindi, Kannada, Marathi

B.E. (Information Science), PES Institute of Technology, VisvesvarayaTechnologicalUniversity

5 years 5 months of experience in IT (Services) industry.

Dell Perot Systems: Technology Specialist

• Ledateamtobuildworkflowapplicationtoenable service booking, execution and fulfillment for largest relocation company in USA

• Customerinterfacetoplanproductroadmap

• Workedwiththeresource-managementteamfortheUSD4millionaccount

• Wasrated‘exceptionalperformer’everyyear

Smitha Vijendra Purohit

English, Hindi

MS (Electronics and Computer Engineering), The University of Birmingham

B.E. (Hons.) (Electronics and Software Engineering), The University of Birmingham

4 years 11 months of experience in Telecommunications industry.

Ericsson: Local Customer Manager

• RepresentedEricssonIndiaonGlobalR&DIntegrationproject

• EstablishedSLAswithallclients

• DevelopedTestEnvironmentsforclientsinIndia

• SetupEricsson’sGlobalTrainingAcademyinGurgaon

Ericsson UK: Computer Systems Engineer

• Upgradationofclient’snetworksfrom2GMobileTechnologyto3GTechnology

• EricssonUK’srepresentativefortwoproprietarysolutions,implementedacrossthe globe

Interesource Ltd.: Developer

• Improvedin-housecontentmanagementsystem

• Workedoneononewithclienttodeveloptheirportal

Somi Rai

English, Hindi, Tamil, Malayalam

BS (Computer Science and Engineering), Nanyang Technological University, Singapore

4 years 9 months of experience in IT (Services) industry.

IBM Singapore Pte Ltd.: Bid Manager, Asean Deal Hub

• Workedwithmulti-functionalteamstodevelop competitive proposals to win business opportunities

• Handledproposalsforfinance,educationandtravelsectorsofvalueUSD0.5-45 million with a success rate of 65%

• LedinitiativetomentorandtrainthebidmanagersinVietnam

IBM International Holdings: Software Engineer (Supply Chain Management Domain)

• SingaporeTeamLeadforarealtimewarehousetrackingprojectforNestle

• ProgrammemanagerforISCInventorAwakeningprogramme

Sowmya Ramakrishnan

English, Hindi, Marathi, Telugu, French

Dual Degree - B.Tech. and M.Tech. (Civil Engineering), IIT Madras

4 years 10 months of experience in Construction industry.

CRISIL Risk and Infrastructure Solutions Ltd.: Manager

• Managedteamsonconsultingassignmentsforurban infrastructure projects

• Workedondemandstudies,financialfeasibility,projectstructuringandrisk assessment, bid process management

Tamil Nadu Road Development Company (TNRDC) Ltd.: Project Engineer

• ResponsibleforsitesupervisionandapprovingcontractorsworkonITCorridor project in Chennai

Road Infrastructure Development Company of Rajasthan (RIDCOR) Ltd.: Project Engineer

• InvolvedinallstagesofMegaHighwaysproject-reviewofdetailedProjectReports, selection of contractors, project implementation and co-ordination with government agencies

Srikrishna Chaitanya Gujjar

Page 38: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

74 75

English, Telugu, German

MS (Computer Science), Amherst, University of Massachusetts

BS, Amherst, University of Massachusetts

5 years 5 months of experience in IT (Products) industry.

EMC Corporation: Senior Product Manager

• ProductStrategy

• Managedproductmanagementinitiativesforcoreportfolioproducts

Srinath Gaddam

English, Hindi, Kannada, Konkani, Tulu, French

B.E. (Electrical & Electronics Engineering), NIT Suratkal

4 years 8 months of experience in Automation industry.

Honeywell Technology Solutions Pvt. Ltd.: Senior Engineer

• TechspecialistintheAvionicsdomain,withproven functional excellence in Test Instrumentation &

Automation, Product Innovation, Project Management and Six Sigma implementation

• SixSigmaGreenBeltandtrainer,recognisedfortrainingexcellencein2008and2009

• YoungestrecipientoftheHoneywell‘All-Rounder’award,forexcellenceatworkand in extracurricular activities

• WontwoPartnerAwardsfromcustomersforexceptionalprojectexecution

Subhas Harishchandra Sumithra

English, Hindi

Dual Degree - B.Tech. and M.Tech. (Chemical Engineering), IIT Bombay

4 years 8 months of experience in Consulting industry.

KPMG Advisory Services: Management Consultant

• AdvisedclientsinInfrastructure,ConsumerMarkets, Healthcare, Travel & Leisure, and Financial services

• StrategyConsulting/BusinessPlanningfordomesticclients,MarketEntryStrategyfor foreign clients

• TransactionAdvisory-Commercial/FinancialevaluationofpotentialtargetsforPE investments (Buy/Sell)

• OperationsConsulting-BusinessProcessRe-design,Supply-chainoptimisation, Large scale Transformation for private/ public sector

• Consistentexceptionalperformance,2successivepromotions

• Co-developedThoughtLeaderships,pioneeredCSReducationinitiative

Sudeep Laad

English, Hindi

B.Tech. (Civil Engineering), IIT Roorkee

5 years 7 months of experience in IT (Services) industry.

Tata Consultancy Services Ltd.: Information Technology Analyst

• Ledhomeloanadministrationapplicationupgrade costing USD 8.2 million-reduced operational costs by 50%

• BuiltapplicationtoanalyzetheJPMCmortgageservicingapplication,involving150 personmonthseffort;developedaninductionprocessfortheproject

• Trained20resourceswhiletransferringTCSdevelopmentcenterfromNoidato Bangalore

• Streamlinedtrainingfor60resourcesacross3functions-homefinance,autofinance andIVRS,increasingmonthlyrevenuebyUSD100,000

Sudhir Kumar Sharma

English, Hindi, Marathi

B.E. (Electronics & Telecommunications), Pune Institute of Computer Technology, University of Pune

5 years 6 months of experience in IT (Products) industry.

KPIT Cummins Infosystems Ltd.: Senior Software Engineer

• TeamLeadforproductdesignlifecyclesincluding system programming for industrial automation

• LedaprojectonnetworksensorsforOilTanksvaluedatEuro225,000

• Initiatedqualityprocessessuchasautomateddocumentationandregression analysis

Embedded Computing Machines: Senior Embedded Engineer

• Team-leadforproductdevelopmentofembeddedsystemframeworks

• DesignedanddeliveredcustomisedtrainingmodulestoinstitutessuchasC-DAC

Persistent Systems Pvt. Ltd.: Member of Technical Staff

• ResearchworktowardsaknowledgemanagementsystemthroughOpenSource collaboration

Sudip Ajit Shah

English, Hindi, Punjabi

CA, ICAI

B.Com.,DAVCollege,Amritsar,GuruNanakDevUniversity

4 years 4 months of experience in Transaction Structuring Advisory industry.

S.R. Batliboi & Co. (member firm of Ernst & Young): Manager

• Managedend-to-endtransactionstructuringprojectsandclientrelationships

• Developedregulatoryandtaxsolutionsforfunding,restructuring,andacquisitions

• SelectedforAcceleratedCareerPath,whichresultedinadoublepromotion

• AdvisedonadebtfundingtransactionworthUSD5billion

• Led,developedandcoachedateamoftenpeople

Anmol Sekhri & Associates: Trainee

• Valuedcompaniesandbrands

Suhas Khullar

English, Hindi, Oriya

B.Tech. (Electronics and Communications), NIT Warangal

4 years 9 months of experience in IT (Products) industry.

Oracle India: Senior Applications Engineer

• DevelopmentofHumanCapitalManagementmodules for Oracle Fusion (ERP)

• Ledateamforautomatedunittesting,whichimprovedefficiencyofDevelopment Team by 12.5%

• DevelopedcompletesolutionsforDutchHumanResourceManagementlegislative reports, which led to a 300% drop in time taken to produce reports

• Receivedteamrecognitionawardforacriticalautomationprocessfor9,000 employees

Suman Mohanty

English, Hindi

CA, ICAI

B.Com. and M Com., Sydenham College of Commerce & Economics, University of Mumbai

4 years 9 months of experience in Consulting industry.

KPMG: Assistant Manager

• AccountingadvisoryonIFRS,USGAAPandIndianGAAP

• LedIFRSconversionprojectsforcompaniesinconsumer-goods,mining,mediaand BPO industries

• WrotewhitepaperonimpactofIFRSonmediacompanies

• Conductedtechnicaltrainings

• Assistedinbusinessdevelopmentactivities

BSR & Co (member firm of KPMG in India): Assistant Manager

• Conductedfinancialstatementsauditsandduediligences

• Keyresponsibilities-project,teamandclientrelationshipmanagement

• SecondedtoKPMGUKtolearninternationalbestpractices

Sumit Maheshwari

English, Hindi, Punjabi

Executive Program in Applied Finance, IIM Calcutta

PGDM (Agri-business), National Institute of Agricultural Extension Management

BachelorofVeterinaryScience,CollegeofVeterinary&Animal Science, Rajasthan Agricultural University

5 years 8 months of experience in Commercial Banking industry.

Kotak Mahindra Bank Ltd.: Chief Manager (Corporate Banking - Large Corporate Group)

• AcquisitionandmaintenanceofCorporateRelationshipsforthebank

• Handledvariousproductslikedebtandequitycapitalmarketproducts,treasuryand derivatives, working capital, etc

• HandledtwoofthelargestCMSandsecuritisationdealsfortheBank

• Selected‘YoungAchieveroftheYear’inFY2007

• Selected‘BestRelationshipManager’inFY2008

Sumit Sachdeva

English, Hindi

B.E. (Electrical and Electronics), NIT Suratkal

4 years 8 months of experience in Electronics industry.

Ittiam Systems Pvt. Ltd.: Senior Engineer

• LedtheMPEGbasedvideoCODEC’sproductlinefor Cisco’s Telepresence solution

• WorkedonaninnovativeunderwatersurveillanceproductforLockheedMartin

• Workedonencoding/decodingprocessesonclient-servermodelforaninflight entertainment system

• Contributedtoproductmanagementinitiativesbyinteractingwiththecustomers across the globe and providing technical as well as pre-sales support

Sushmita Sharma

English, Hindi

CA, ICAI

B.Com. (Hons.), Hansraj College, University of Delhi

5 years 8 months of experience in Financial Services industry.

Macquarie Group Ltd.: Executive - Fund Accounting

• Migratedtax/financeworkforPEfundsfromSydney; reported directly to Sydney Associate Director

• PreparedmonthlyinvestorreportsforPEfunds

• SavedEuro2.3millionintaxcreditsthroughkeyfinancialsanalysisforGermanPE fund

Emaar MGF Land Ltd.: Assistant Manager - Management Assurance Services

• Implementedriskmanagementstrategies/practicesacrosslocationsinIndia

• RepresentedEmaarsuccessfullyincommercialsitebidding

Lovelock and Lewes (PricewaterhouseCoopers): Assistant Manager - Assurance and Business Advisory Services (ABAS)

• ReporteddirectlytopartneronSOX,USGAAP/IFRSaudits

• Highclientsatisfactionrating(5.5/6)onkeyassignments

Tushar Agarwal

English, Hindi

M.Tech. (Computer & Information Technology), IIT Kharagpur

B.Tech. (Computer Science), IIT Kharagpur

4 years 11 months of experience in IT (Products) industry.

Microsoft R&D Pvt. Ltd.: Software Development Engineer - II

• Led3engineerstodesignanddevelopcomponentsofMicrosoftCRM(Customer Relationship Management)

• PatentforextensiblechartingengineforMicrosoftCRM

• Patentfornewmethodtodetectduplicatesinbusinessdata

• MicrosoftGoldstarawardforcross-teamimpact

• Conceivedapeer-feedbackmechanismtomeasuresoftperformanceaspectssuch as quality, teamwork

• MicrosoftIndia2009InnovationAwardforbestdesignamong75projectsdeveloped in India

Tushar Bhatia

Page 39: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

76 77

English, Hindi

CFA, The Council of Chartered Financial Analysts, India

M.Sc. (Finance), ICFAI University

B.Com. (Hons.), St. Xavier’s College, University of Calcutta

5 years 11 months of experience in Manufacturing industry.

VedantaResourcesPlc.:ProductManager-PrimaryProducts

• Sales&MarketingofPrimaryAluminiuminEasternIndia(exceptChhattisgarh)- increased sales by 288% in 6 months

• Suggestedimplementablewaystoincreaseproductivityby30%forRolledProducts (RP) division

• DevelopedProductivityandCostingModelforRPdivision

• ‘StaroftheBusiness’Award

• Expandedintonewgeographies-SriLanka,Greece,Nigeria(AluminiumFoils Division)

Narayani Nitwel Pvt. Ltd.: Executive

• Assistedinsettingupthenewproductionunit

Uday Sanganeria

English, Hindi

CA, ICAI

B.Com. (Hons.), Shri Ram College of Commerce, University of Delhi

4 years 7 months of experience in Financial Services industry.

KPMG, Transaction Services: Senior

• PartoftheduediligenceteamonM&Atransactions

• Analysedfinancialstatementstoidentifyissuesandthenrecommendstepsforrisk mitigation

• Assistedclients(sellside)insettingupdataroomsandmanagingbuyer’sdiligence teams

PricewaterhouseCoopers: Associate

• Responsibleforentireauditfieldworkatclientlocations

• MaintainedrelationshipswithAuditClient’smanagementteam

Arren & Arren: Engagement Manager

• Managedclientrelationships

• Responsibleforentireexecutionoftheauditprocedure

Vaibhav Arren

English, Hindi

B.A. (Hons.) Fashion Merchandising and Production Management, Pearl Academy of Fashion, Nottingham Trent University

4 years of experience in Retail industry.

Landmark Group - Splash: Store Manager

• Research:FashionTrends/Competition/Retail technology

• Achievedgrowthof13%insalesrevenue

• Improvedconversionratioby10%

• Ledateamof40peopleofdifferentnationalities

ITC Ltd.: Assistant Manager Merchandiser

• Achievedannualgrowthof20%deliveringbusinessofUSD6million

• On-timeshippingimprovedby30%

Triburg Sportswear: Merchandiser

• Achievedagrowthof25%inrevenuewithin1styearofoperations

• PromotedfromAssistantMerchanttoMerchant

Varun Handa

English, Hindi

B.E. (Instrumentation and Control), Netaji Subhas Institute of Technology, University of Delhi

4 years 8 months of experience in IT (Products) industry.

Ittiam Systems Pvt. Ltd.: Senior Engineer

• Designing,developingandproductisingvariousVideo Compression algorithms on microprocessor based DSP Systems

• OwnedtheH264encoderproductandwasresponsibleforitsprogress,qualityand performance during entire life cycle

• Mentoredjuniors,planningandreviewingtheirwork,facultyforinitiationandtraining programmes

• CompanyrepresentativeforastrategiccustomerinUSA.Convertedrequirements to technical specifications, feasibility analysis, effort estimation, presented the designed solution

Varun Rai Bansal

English, Hindi, Tamil

MBBS,JIPMER,PondicherryUniversity

4 years of experience in the Pharmaceutical and Healthcare industry.

RxMD Pharmaceutical Physicians Pvt. Ltd.: Clinical Scientist

• Closelymonitoreddynamicsofglobalmedical emergency;involvedinauthoringrelevantmanuscriptforpublication

• Co-authoredreportservingasbasisforhealth-authorities’drug-useguidelinesfor at-risk population

• DevisedRiskManagementPlanforadverseeventsfrommilliondollardrug(inat-risk population)

• AuthoredsectionsofDrugSafetyReportsevaluatingneedforchangeindrugsafety profile

• Preparedguidancedocumentsforglobalpharmaleaderforreleasing/withholding microbe-contaminated drugs

SRM Medical College Hospital and Research Centre: Resident/Tutor

JIPMER:MedicalIntern

Vedhavalli S

English, Hindi, Tamil

MS (Optics and Photonics), University of Alabama, Huntsville, USA

B.E. (Electronics and Communications), Dr M G R Engineering College, University of Madras

4 years 6 months of experience in Manufacturing industry.

Photonics Industries International Inc.: Laser Engineer

• Ledmanufacturingteam,productdevelopmentandsetupqualityandreliability criteria

• Trackedandmonitoredteamperformanceagainstcustomerexpectations,setup project schedules

• Providepreandpostsalessupportandliaisebetweencustomersandengineering

• Introducedinnovativetechniquesinproductionandqualitycontrol

Laser Propulsion Group: Graduate Research Assistant

• Set-upprojecttimelines,teammeetings&monitorteamandindividualprogress

• WorkedonJointAirForce&NASAfunded(JANNAF)project

Venkata Krishnan Mukundarajan

English

B.A. (History), Dartmouth College

5 years 8 months of experience in ITES/BPO industry.

ClutchGroup,LLC.:VP-Marketing

• SourcedlegaloutsourcingassignmentsfromUS Fortune 500 companies and AMLAW 200 law firms

• AssistedtheacquisitionandmergerofJuriMatrixwithClutchLegaltoformClutch Group

• Contributedtogrowingtheteamfrom3to200

Accenture: Service Manager

• QualityManagement

• SLAManagement(HR,Insurance,F&AandCallCentreClients)

• VendorManagement

• Trackedcenter-widemetrics

Weil, Gotshal and Manges LLP: Corporate Paralegal

• Assistedlargetransactions

• Maintaineddealdocuments

Vijay Rao

English, Hindi

B.Tech. (Electronics and Communications), NIT Hamirpur

4 years 8 months of experience in IT (Products) industry.

Wipro Technologies: Project Engineer

• Designed,developedandsupportedLayer3DSL multiplexer for Alcatel Lucent

• Managednetworkedenvironmentofhardwareandsoftwareprovidersandclient resulting in better synergy

• Prunedswitchsoftwaretoimprovemaintainabilityresultingin50%decreasein defect rate

• Designednewfeatureonswitchforbetterfaultdetectionandselfcorrection

• Mainorganiserforteambuildingandstressrelievingactivities

• Recognisedforexceptionalsupportfromclient

Vikas Saroha

English,Hindi,Japanese

M.A. (Economics), School of International Studies, JawaharlalNehruUniversity

B.A. (Hons.) (Economics), St. Stephen’s College, University of Delhi

4 years 2 months of experience in Consulting industry.

Deloitte Research - Deloitte Services LP (USA): Senior Analyst

• Engagedwithseniorpartnersasmemberofstrategicresearchgrouptoproduce thought leadership reports for business development

• Co-authoredreport‘MaximizingROICtodrivegrowthinconsumerproducts’

• Managedprojectdeadlinesanddeliverablesincollaborationwithkeyseniordirectors and partners

• LedresearchforreportonChina’sretaillandscape

• DevelopedcasestudiesofUSPharmaceuticalcompanies

Confederation of Indian Industry: Executive

• PreparedbriefsandwhitepapersonWTOissues

Vinay Hukumchand

English , Hindi

BBA, University of Texas, Austin

4 years 6 months of experience in Consulting industry.

Ernst & Young US LLP: Senior (Performance Improvement)

• EngagementsincludeSOX404,mortgagereviewand process improvement work in Energy and Financial

Services domains

• Builtamortgagecalculatorimprovingconfidencelevelsby95%andachievingcost savings of USD 200,000

• Developedanddeployedlossmitigationsolutionsinatargetedgeography,saving USD 50 million

• LedSOXengagementforanOil&GasgloballeaderinAustralia

• AppointedPeerAdvisorfornewrecruits

Vinay Pamnani

English, Hindi, Kannada

B.E.(Electronics&Communication),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity

5 years 8 months of experience in IT Products industry.

SAP America Inc.: Consultant

• Managedupto8accountswithcombinedsupport revenue of USD 6 million

• HandledcriticalcustomersituationsbyinvolvingrelevantpartyinsideandoutsideSAP

• Providedtechnicaladvisoryserviceforthedesignofend-to-endbusinesssolutions

• TwoServiceAchievementAwardsin2008forcontributionsatNewYorkTimes

• Involvedinpre-salesactivities;Productdemostoclientexecutiveteams

Sap Lab (India) Pvt. Ltd.: Software Developer

Vineeth Gururaj

English, Hindi, Telugu

B.E. (Hons.) (Computer Systems), University of Auckland

5 years of experience in Manufacturing industry.

Rakon Ltd.: Project Engineer

• Securedakeydesignwininakeymobile manufacturer’s next generation phone (tier-1 US company)

• ManagedaNZD4.4milliongovernmentfundedhighprecisiontimekeeping (Calibrated Crystal Oscillator) project as technical lead

The Auckland Lite: Strategy and Marketing Director

• Createdcompanywithvisionofmakingitthefirstfreeweeklynewspaperfor commuters in Auckland

• Soldadvertisingspaceofupto45%oftotalrevenuein4monthsandformed partnerships

Vinod Chinni

Page 40: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

78 79

English, Hindi, Tamil, Kannada, Malayalam

LLB, Seshadripuram Evening Law College, Bangalore University

B.Com., Christ College, Bangalore University

5 years 7 months of experience in Legal Services & Audit industry.

Tata Advanced Materials Ltd.: Deputy Manager (Legal)

• Negotiated3highticketinternationalcontractsforthecompany

• Trained130employeesonExportControls

• AwardededucationalgrantbySirRatanTataTrust

Pramata Knowledge Solutions Pvt. Ltd.: Delivery Lead - Data Analysis Group

• ResponsibleforadvancedbusinessanalyticsforClientsinoutsourcingdomain

• Builtinternalcontrolsaroundcontractualinformationandprovidedstrategic management solutions

UAE Exchange LLC., Dubai: Assistant Manager - Legal, MIS and Pricing Analysis

• Drafting,vettingandreviewingAgreements,implementingantimoneylaundering policies for the entire company

Trans Movers and Packers Pvt. Ltd.: Manager (Internal Audit & Legal)

C R Nulvi and Associates: Audit Team Leader

Vinod Subramanian Sundaram

English, Hindi, Sindi, Marathi

B.E. (Computers), TSEC, Mumbai, University of Mumbai

5 years 7 months of experience in IT (Services) industry.

Emirates Bank Group: Senior Analyst

• LedtheprojecttocalculateFundTransferPricing between treasury and other units

• IntegratedCreditCardunitperformancereportingintoMIS

• AssessedsoftwarelicenseutilizationresultinginUSD100,000savings

Orient Information Technology Ltd.: Senior Systems Analyst

• SinglepointcontactforMISrequirementsforProfitability,CostAllocationsand interest statements

NSE Infotech Services Ltd.: Associate System Analyst

• LedF&OData-MartProjecttoenableassessmentofperformanceofF&Osegment

Vishal Motwani

English, Hindi, Punjabi

B.E. (Mechanical), Delhi College of Engineering, University of Delhi

5 years 9 months of experience in Energy industry.

Hindustan Petroleum Corporation Ltd.: Project Engineer

• Received500crossingsapprovals,75daysearlierthan expected date for the project of INR 4.5 billion entailing

laying of an underground finished product pipeline

• PublicationofGazettenotificationanddisbursementofcompensationforland acquisition in record time

• Energysavingsthroughinnovationslikecommissioningofsolarsystematoutlets

• Commissioningof7outletsinUttarakhandenablingHPCLtoattainmarket leadership

Godfrey Philips India Ltd.: Graduate Engineer Trainee

Vishal Sharma

English, Hindi, Punjabi

B.Tech. (Computer Science), Main Campus, Guru Nanak Dev University

4 years 5 months of experience in IT (Products) industry.

Microsoft R&D Pvt. Ltd.: Software Design Engineer/Test 2

• WinnerofMicrosoftIDCInnovationAward2009,for development of Automation Health indicator which saved USD 2 million in costs

• ReceivedGoldStarAwardforExecutionexcellenceforhandlingcriticalsituations such as security attacks by hackers

• Promotedtwiceinaspanof3years,forsuccessfullyexecutingmilliondollarprojects

Wipro Technologies: Project Engineer

• WontheBestDeliveryManagerAwardintheProjectLifecyclecompetitionarranged for new joiners

Vishesh Sethi

English, Hindi, Tamil

M.Sc. (Biological Sciences) and B.E. (Electrical & Electronics), BITS Pilani

5 years 6 months of experience in High Technology industry.

QualComm Inc.: Senior Engineer

• BenchmarkingandOptimisationofQualcommAndroid Solution

Mediatek (India) Pvt. Ltd.: Software System Design Engineer II

• TechnicalinterfacewiththeMarketingteamforRFWSGSM/GPRSWireless baseband product definition

• ProjectLeadforValidationactivitiesinHyderabad

Analog Devices (India) Pvt. Ltd.: Software Systems Design Engineer II

• ProductdefinitionforWirelessBasebandchipset,AGPStechnology

• SystemAnalysisandBenchmarking

• DeviceDriverDevelopmentandValidation

Visweswaran Gowrisankaran

English, Hindi, Tamil

Bachelor of Law (Hons.), Cardiff University, UK

4 years 3 months of experience in Consulting industry.

Deloitte Consulting: Business Analyst

• Conductedstrategicsupplychainanalysis,identified USD 185 million in savings for a global LCD manufacturer

• IdentifiedUSD125millioninsavingsforaninternationaloilshippingcompany

• FoundingmemberofDeloitteAdvancedAnalyticsGroup

QuisLex, Inc.: Project Manager

• Ledoneoftheworld’slargestcorporateforensicinvestigations(80-memberteam, 40+countries)

• Managedindustry’sfirstlarge-scaleoffshoreantitrustanalysis(100-memberteam)

• Spearheadedinitiativetoachieveenterprise-wideISOaccreditation-industryfirst

Vivek Sekar

English, Hindi

B.E. (Electronics and Telecommunications), Government EngineeringCollege,Jabalpur,RGPV

5 years 5 months of experience in Telecommunications Industry

Aricent Technologies (Holdings) Ltd., Gurgaon: Technical Lead

• Recruitedandmanagedateamof10engineersfor3GtestinginEurope(Poland, France, Germany and UK) and Korea

• ResponsibleforUSD600,000billingbythecustomer

Invest Faith Technologies Company Ltd., Hong Kong: Consultant

• DuediligencephaseofCapitalSemiconductor,aUSD200millionstart-up

• BuiltuptheteamandprocuredIPandtestequipment,worthUSD50million

Freescale Semiconductors, Bangalore: Software Engineer

• 3GFeatureleadonFreescalechipset,handling6engineers

• Receivedemployeeexcellenceaward

Vivek Shrivastava

English, Hindi

B.Tech. (Electronics and Telecommunications), Army Institute of Technology, University of Pune

5 years 5 months of experience in IT (Services) industry.

Accel2Market: Co-Founder

• Builtcompanyfromscratchtoacashpositiveventure in 4 months

• WorkedonmarketingprojectswithITcompaniesacrossAPACandUSA

Calsoft Pvt. Ltd.: Manager - Business Development

• LedsalesteaminIndia;revenuesearnedwere50%ofcompany’stotalrevenues

• IntheUSA,handledAccountManagementforSiliconValleyandBostonAreaclients

• Closedmaximumnumberofdealsforthecompany;dealsvariedfromstart-upto Fortune 500 clients

Vivek Vikram Singh

English, Hindi

B.Tech. (Hons.) (Civil), IIT Roorkee

5 years 9 months of experience in IT (Products) industry.

Amdocs Inc.: Senior Subject Matter Expert

• Ledateamof8atAT&T,USAsupportingbusinessand product development in telecom billing segment

• DesignedsystemssavingUSD2.5millionpermonthincostsandincreased productivity by 10%

Amdocs (India) Pvt. Ltd.: Senior Subject Matter Expert

• Proposed,designedanddevelopedanOrderManagementApplication(budget USD 10 million) for Sprint, USA

Infosys Technologies Ltd.: Software Engineer

• DesignedanddevelopedamortgageapplicationforBankofAmerica

Tata Motors Ltd.: Graduate Engineer Trainee

• WorkedondesignandimplementationofTata-Daewoo(NOVUS)AssemblyLine

Vivek Vishal

English, Hindi

B.E.(IndustrialEngineering&Management),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity

5 years 8 months of experience in Consumer Products and Automotive industry.

Adidas (India) Marketing Pvt. Ltd.: Area Manager - Sales (Golf - South Asian Region)

• Grewoutletsfrom17to78

• GrewsalesfromUSD150,000in2007toUSD1.1millionin2009

• Tappednewmarkets-Pakistan,Nepal,SriLanka(USD150,000sales)

Tata Motors Ltd.: Manager - Dealer Development (Northern region)

• AsHeadofProcessActionGroup,achievedthehighestgrowthandimprovementin the region for M I P index

• Grewthedealersfrom36to44

• ContributedtoNorthernregionscoring1stinTNSSalesSatisfactionSurvey

PiaggioVehiclesPvt.Ltd.:SalesandServiceEngineer

Yuvraj Chadha

Page 41: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

80 81

UPTO 4 YEARS

Page 42: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

82 83

English, Hindi, Kannada, Tamil, Telugu

MBBS, Bangalore Medical College, Rajiv Gandhi University of Health Sciences

3 years 3 months of experience in Healthcare industry.

Columbia Asia Hospitals Pvt. Ltd.: Operations Executive

• Formulatedpolicies,SOPs,MISformatsandquality indicators across the hospital chain

• Productivity/utilisationmanagement,inventorymanagement,processimprovement and quality monitoring

• InvolvedinNABHaccreditationprocess

National Institute of Mental Health & Neuro Sciences (NIMHANS): Medical Officer

• Managedneurosurgerypatients

• Co-ordinatedstudyworkflow,identifiedinefficienciesandinstitutedcorrective measures

Bangalore Institue of Oncology: Medical Officer

Bangalore Medical College: Intern

• Managedpatientsacross7govenmenthospitals,villagehealthcamps,anganwadis and govenment schools

• Handledmorethan50patientsperday

Aarthi Rao

English, Hindi

B.E. (Mechanical Engineering), Delhi College of Engineering, University of Delhi

2 years 9 months of experience in Automobile industry.

Maruti Suzuki India Ltd.: Assistant Manager

• Conceptualised,created,andimplementedMaruti Insurance Express, a breakthrough product that generated more than a 1000 additional sales leads from Total Loss Claims

• ReducedtheIncurredClaimRatioofinsurancecompaniesby3%

• DesignedMarutiSuzuki’sin-houseonlineclaimsprocessingsystem

• SpearheadedcustomerrelationshipmanagementofinsuranceclaimsacrossIndia

• Co-ordinatorofSouthzone(115dealers)foroverallbusinessdevelopment

Abhinav Bhatia

English, Hindi

CFA, Cleared Level III, CFA Institute, USA

B.E. (Hons.) (Computer Engineering), Nanyang Technological University

3 years 9 months of experience in Financial Services industry.

Deutsche Bank, AG, Singapore: Associate

• DefinedandhelpedlaunchDBdirect,thestrategicmulti-millionEuroglobal transaction banking product, to serve as a single global internet channel

• DefinedandanalysedanewliquiditymanagementproductforDB’stransaction banking and capital markets verticals

• Received‘RecognisingandRewardingExcellence’(RARE)awardin2009fortop2% performance

• Initiatedaglobalknowledgesharingprogrammeamongallbusinessanalystswhich facilitated internal transfers

Abhinav Garg

English, Hindi

B.Tech. (Hons.) (Chemical Engineering), Institute of Engineering & Technology, Lucknow, Uttar Pradesh Technical University

3 years 8 months of experience in Energy industry.

Technip KT India Ltd.: Engineer - Sales and Marketing

• Ledteamsoftechnical/commercialexpertstoprepare techno-commercial proposals

• Handledthehigh-endtechnologyclient,AXENSandgeneratedrecordbusinessof USD 1.4 million

• Developedanewclientinpharmasector,anewsectorforourcompany

• Chosentobepartofthesix-memberteamtojointlybidwithParisofficefor international projects

• Juniormostmemberofcorporateplanningcommittee,consistingof70managers across India

Abhinav Jain

English, Hindi

B.Tech. (Chemical Engineering), IIT Mumbai

3 years 9 months of experience in Consulting industry.

ZS Associates (India) Pvt. Ltd.: Associate Consultant

• Designedcustomerstargetingstrategytooptimise sales efforts

• Streamlinedandoptimisedbrandmarketingeffortsacrosspromotionchannels

• Evaluatingpromotioneffortsandrecommendingchangestoenhanceresults

• Modeledcustomerlife-cycletoidentifyhighimpactmarketingopportunitiesand designing appropriate interventions

• Healthoutcomesresearchtoidentifyandcapitaliseondrugpurchaseandusage patterns of industry stakeholders

• Deployedonsite(US)todeliverthepreceding3projects

Abhinav Khare

English, Hindi

B.Sc. (Computer Science), Amity School of Engineering, Guru Gobind Singh Indraprastha University

3 years 10 months of experience in IT (Products and Services) industry.

Microsoft Corporation: Software Development Engineer

• Ledadesignanddevelopmentteamforanalyticsin business intelligence software

• DevelopmentleadinprojectonboardedsuccessfullyfromUSA;projectwasworth USD 5 million

• ForWindows7,developedautomationsoftware,reducingtestingtimefrom3 months to 3 days, awarded ‘IT Star’

• AwardedMicrosoft‘ITPro-Dependable’forstabilisingglobaltechnicalreporting consolidation

VerizonDataServicesIndiaLtd.:DatabaseAdministrator

• Pointofcontactforordermanagementwebsite

Abhineet Bhardwaj

English, Hindi, Telugu

B.Tech. (Naval Architecture and Ocean Engineering), IIT Madras

3 years 8 months of experience in Investment Banking industry.

Morgan Stanley India: Manager

• Involvedindesignandimplementationofsalesand operation performance reporting for top management

• Designedanintegratedproductrepositoryofallglobalinvestmentmanagement products of Morgan Stanley

• ConductedtrainingsonreportingapplicationatChicagoandNewYork

• Workedonstreamliningdevelopmentlifecycleandimprovingqualityofdeliverables

• Mentoredandguidednewrecruits

Abhiram Alamuru

English, Hindi

Dual Degree - B.Tech. and M.Tech. (Mechanical Engineering), IIT Bombay

3 years 9 months of experience in Investment Banking industry.

BA Continuum Solutions (Bank of America): Analyst

• Workedaspartofglobalcorporateandinvestment banking team to provide transactional and business development services

• DevelopedadvisoryproposalsonM&A,capitalraisingandrestructuring

• GainedexpertiseinbuildingLBO,DCFandaccretion/dilutionmodels

• CreatedacomprehensiveideageneratingproposalontheIndianrealestatemarket

• Gainedexposureintherealestate,financialsponsorsandhealthcaresectors

Abhishek Modi

English, Hindi, French

MS (Environmental Engineering), Georgia Institute of Technology

B.E. (Environmental Engineering), Delhi College of Engineering, University of Delhi

2 years of experience in Consulting industry.

Trinity Consultants, USA: Environmental Consultant

• SalesandmarketingleadinUSAandgloballyforBREEZE‘RiskAnalyst’software,an internally developed environment risk analysis software

• Primarytechnicalleaderforcompany’sfirsthumanhealthriskassessmentproject

• DevelopedGreenhousegasinventoriesandclimatechangecostanalysisfor USD 2.8 billion natural gas distribution client

• Managedthreeclientsforenvironmentalcomplianceprojects (amounting to USD 60,000)

• Achievedhighestbillableutilisation(94.8%)inAtlantaofficein2008

Abhishek Srivastava

English, Hindi, Bengali

B.E. (Environmental Engineering), Delhi College of Engineering, University of Delhi

2 years 9 months of experience in Consulting industry.

Evalueserve SEZ (Gurgaon) Pvt. Ltd.: Senior Business Analyst(EnergyVertical)

• WorkedwithanOilandGasmajoronstrategyformulation,marketassessment, competitive intelligence and industry monitoring

• Teamlead(2-4analysts)formorethan20projectsinenergysector

• Evaluatednewbusinessofferingsforthecompany

• Assistedclientexecutivesinbusinessdevelopment

• Spearheadedtheimplementationofproductivityimprovementinitiative(VBbased)in the team

• Co-ordinatedwithteamsacrossgeographiesandfunctions

Aditya Jha

English, Hindi, Tamil

B.Arch., Dr B N College of Architecture for Women, University of Pune

3 years 8 months of experience in Real Estate industry.

CB Richard Ellis Inc.: Assistant Manager - Transaction Management Group

• Providedoptimumrealestatesolutionstoclients

• WonmultipleprestigiousclientssuchasCanon,Daesung,etc.

• RealestatesupplymanagementforofficeandITspaces

VishwashreeConstructions:Architect

• Conceptualisedanddesignedforhospitality,educationalandresidentialprojects

SE ARCH: Architect

• Designedanddetailedforexistingresidentialandcommercialprojectsincluding landscape design

• Grantedopportunitytohandleaprojectwiththeprincipalarchitect

Akila Jayaraman

English, Hindi, Punjabi

B.Com. (Hons.), SGTB Khalsa College, University of Delhi

2 years 9 months of experience in Consulting industry.

WTE Energy Pvt. Ltd.: Entrepreneur/ Senior Consultant

• ConsultedHeroGroupUSD3.5millioncarbonfinance project, project due for UN registration

• WorkedwithStanfordUniversitytoevaluate103renewableenergystart-upsfor Sequoia Capital

Nucleus Software Exports Ltd.: Management Trainee

• InterfacingwiththePRagenciesin3regions-APAC,MEandIndia

• SupervisedthePRcampaignforIITDelhi’sNucleusFormulaCar,achieved100% funding requirement

• BroughtanewPRagencyon-boardforEMEAregion,increasingPRcoverageto 166%

Akshat Kshetrapal

Page 43: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

84 85

English, Hindi

BS (Biomedical Engineering), Drexel University

3 years 2 months of experience in Pharmaceuticals industry.

JubilantOrganosysLtd.:ExecutiveAssistanttoMD

• Marketstrategyforkeyproductlinesforenteringinto the Indian market

• Growthstrategyfortheallergyandtheanimalnutritionbusiness

• LedthemergerandacquisitionteamfortheKazakhstanmarket

JubilantBiosysLtd.:AssistantManager-CorporatePlanning

• Developedamutualgo-to-marketstrategywithJapaneseconsultantsforJapanese market

• IdentifiedandassessedpotentialacquisitionoptionsintheChinesecontractresearch market

• Mappedanddocumentedprocessesacross5corefunctionaldepartments

Akshay Bawa

English, Hindi

B.A. (Hons.) (Economics), Delhi College of Arts & Commerce, University of Delhi

3 years 6 months of experience in Consulting industry.

Corporate Executive Board: Senior Analyst - Corporate Strategy and Development

• TransformedCEBIndiafromcostcentretoAPAC revenue centre with CFO cohorts project generating approximately USD 1 million in 2009

• AdvisedCFOsatsomeofIndia’slargestcompaniesonriskmanagement,IFRSand governance

• Publishedarticlesinleadingbusinessjournals(includingMintandBusinessLine)on governance practices

• LaunchedmanagementbestpracticesadvisorynetworksforIndianCEOsandCFOs

Akshay Chopra

English, Hindi

B.E.(Mechanical),KJSomaiyaCollegeofEngineering,University of Mumbai

3 years 10 months of experience in Engineering industry.

Auditra Engineering Pvt. Ltd. (part of Agra Engineering Company Group): Head of Business Development

• SetupabusinesstoexportmachineryandconsumablestoministeelplantsinAfrica

• Turnkeycontractsforasteelrollingmillprojectandaplastictubemanufacturing project in Tanzania

• InitiatedsalestoUganda,Ethiopia,Mozambique,etc.

• Createdastrongnetworkofdomesticvendors

• ImplementedSAPinthecompany

Akshay Satish Gupta

English, Hindi, Tamil, Telugu

B.Tech. (Metallurgical Engineering), IT-BHU

2 years 9 months of experience in Energy industry.

Shell Technology India Pvt. Ltd.: Materials and Corrosion Engineer

• ProjectleaderintheUSchemicalplanttosolvea critical plant reliability issue, which averted a potential

shutdown, and prevented a loss of USD 150,000 per day

• WonspecialrecognitionawardformyworkinMalaysia,draftedaglobalstrategyfor appraising mills that manufacture pipelines

• SavedapproximatelyUSD100,000byre-framingcylinderinspectionstrategy

• PreparedmaterialsselectionreportforBruneiLNG

Akshay Rajagopalan

English, Hindi, Danish

B.E. (Hons.) (Electronics and Communications), P D Memorial College of Engineering, Maharshi Dayanand University

3 years 9 months of experience in IT (Products) industry.

IBM India Pvt. Ltd.: Associate System Engineer

• Testanalystforacustomerserviceandfulfillmentapplicationinshippingindustry

• Plannedandexecutedend-to-endtestingonlegalandregulatorydocumentationflow

• Workedonbuildinganapplicationforcontainerallocationandmovementtracking

• Ratedamongsttopperformersforlasttwoyears

• IBMBravoawardstwoyearsinsuccession

Amit Ojha

English, Hindi

B.Tech. (Electrical Engineering), IIT Roorkee

3 years 9 months of experience in Energy industry.

Hindustan Petroleum Corporation Ltd.: Engineer - Projects

• Installationandcommissioningofelectricalequipments costing INR 140 million for effluent treatment plant

• Co-ordinatedwithconsultants,vendorsand contractors for timely completion of projects

• Preparedandreviewedtenderspecificationsformaterialsandservicescontracts

• WonHPCL’szonallevelannualbusinesssimulationcontest

Amit Singla

English, Hindi, Bengali

B.Sc. (Statistics), St. Xavier’s College, University of Calcutta

3 years 9 months of experience in Consulting industry.

McKinsey Knowledge Centre: Analyst

• Ledanalyticalprojectsforclientsacrossfunctionsand industries

• Workedlargelyoncreditriskmanagementprojectsforclientsinfinancevertical

• StarAwardforamarketinganalyticsprojectforaleadingbankinThailand

• Awarded‘BestAnalyst’twiceforexceptionalclientimpact(USbankmajor)

• ConductedexceltrainingworkshopsforMcKinseyconsultantsandclients

• Ledtrainingefforts(statistics,SASandSPSS)fornewjoinees

Anal Ghosh

English, Hindi, Malayalam, Tamil

B.Sc. (Statistics), Loyola College Chennai, University of Madras

3 years 10 months of experience in Financial Services industry.

Goldman Sachs Services Pvt. Ltd.: Associate

• Responsibleforportfolioaccountingandasset servicing of private wealth management accounts

• Involvedinsettinguptheprivatewealthmanagementantimoneylaunderingand compliance team in Bangalore

• FoundedtheGoldmanSachsBangaloreEnvironmentalCommitteewithaviewof reducing the carbon footprint of the office

Anand Ananthapadmanabhan

English, Hindi, Bengali

CFA, ICFAI

B.Com. (Hons.), St. Xavier’s College, University of Calcutta

2 years 11 months of experience in Auto Components industry.

Aditya Gears Group: Director

• Leda3-memberteamtorestructurethesecuredloans with a commercial bank

• Instrumentalinobtainingjobworkcontractsandresumingtradingactivitieswhich was vital in turning around the company

• Negotiatedeffectivelywithcreditors,dealersandothermajorstakeholdersto implement the proposed restructuring plan

• Conceptualisedandimplementedinnovativemarketingcampaignswhichincreased sales by 10% beyond target

• Designedmanagementandperformancereportingframeworks

Anant Veer Harlalka

English, Hindi, Bengali

B.A. (Hons.) (Sociology), Lady Shri Ram College for Women, University of Delhi

2 years 7 months of experience in Consumer Products industry.

Trutopia Foods Pvt. Ltd.: Managing Director

• Liaisedwithinvestors,vendors,governmentbodies and consumers and executed pilot run for fresh fruit juice business

Hindustan Unilever Ltd.: Area Sales & Customer Manager

• DesignedBTLlaunchplanforClearShampooandhelpedlaunchVaselineBody Wash in Thailand

• Ralliedteamof25fieldstaffand56distributorstodeliverhighesteverterritory turnover of INR 720 million in first year on the job

• Director’sAwardforoutstandingteamperformanceincustomerdevelopment

Ananya Ukil

English, Hindi, Telugu

B.Tech. (Information Communication Technology), DAIICT Gandhi Nagar

3 years 11 months of experience in IT (Services) industry.

Pioneer Marketing Corporation: Head Business Development

• Workedonmarketingandretailstrategyensuring18%growthduringrecession

• Plannedandorganisedpromotionalevent-‘LaptopMania’

• AttractednewcorporateclientstoPioneer

Infosys Technologies Ltd.: Software Engineer

• CorememberoftheUNIXanddatabasesolutionsteam

• BecameteamleadforKraftFoodsUNIXtrackwithin9months

• Improvedefficiencyofassessmentphaseofmigrationprojectsbynearly99%

• Consistentlyratedamongtop5%ofpeergroup

Anila Narla

English, Hindi, Bengali

M.Tech. (Computer Science and Electrical), IIT Delhi

B.Tech. (Electronics), ISM Dhanbad

3 years 10 months of experience in Electronics industry.

Calypto Design Systems Pvt. Ltd.: Senior Member, Technical Staff

• Conceptualisedanddevelopedmultiplelanguagesynthesisproductswhich contributed to 30% of Calypto’s revenue in 2009

• Projectleadfor64-bitproducts;ledteamof35engineersinIndiaandtheUSA, enabling product deployment on large designs for customers like Texas Instruments, Apple, Cisco and Sony

• SinglepointofcontactforthehardwarelanguagesynthesisteamacrossIndia,USA, JapanandEurope

Anindita Mukherjee

Page 44: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

86 87

English, Hindi

B.E. (Computer Science), Institute of Technology & Management, Maharshi Dayanand University

3 years 9 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Technical analyst

• ITconsultingininformationsecurityandbusiness continuity planning space for BFSI clients

• Salesandpre-saleswork,preparingRFPresponseandprojectestimates

• Costandeffortnegotiationswithmultiplevendorsandstakeholdersforpre-sales proposals

• Buildingaknowledgerepositoryforpre-salesactivities

Anish Jain

English, Marathi, German

B.E.(Printing),PVG’sCollegeofEngineeringTechnology,University of Pune

3 years 3 months of experience in Publishing and BPO industry.

Macmillan Publishing: Manager - Account Management

• Managedoperationsandsupportforateamof65 members

• Handledthecompleteportfoliofortwoofourlargestyellowpageadvertisingclients

Affinity Express, India Pvt. Ltd.: Project Manager

• Ledateamof45associates

• HandlingoperationsforfournewspaperclientsinUSAandCanada

• DualfunctionsofProjectManager-AdvertisingandTransitionManager-Advertising

• Trained500+associates-IndianandFilipino.SetupprocessesinPhillippineCentre

Anjali Rajendra Datar

English, Hindi

CFA, Cleared Level III, CFA Institute, USA

B.Tech. (Textile Technology), IIT Delhi

3 years 10 months of experience in Investment Management industry.

Irevna Research Services Ltd.: Senior Research Analyst

• Partoftheclients,aLondonbasedhedgefund,relative value desk

• Responsibleforconceptualisinginvestmentstrategiesusingtechnical,fundamental and macroeconomic indicators

• Workedonassetallocationandsectorrotationmodelsthatoutperformedbenchmark allocations by 5%

• Developedmodelstoidentifyturningpointsinequityindices

IndusValleyPartnersPvt.Ltd.:SoftwareEngineer

• Conceptualisedtheintegrationofadditionaltradingdesksandproductsduringthe client site stint in New York

Ankit Kumar Garg

English, Hindi, Dogri, Punjabi

B.Tech. (Computer Science), NIT Kurukshetra

3 years 7 months of experience in IT (Products) industry.

Computer Sciences Corporation India Pvt. Ltd.: Application Developer / Programmer Analyst

• TechDesignforAXA’sannuityinsuranceproductsusing CSC’s wealth management product

• CustomerinterfacewithAXAforCSC’swealthmanagementproduct

• Co-ordinationofqualitycompliance,causalanalysisfordefectsandpost-project reviews

• RecipientofCSC’sKeytoSuccessAward‘09;NominatedforCSC’sYoungTurk Award ‘07

• Alwaysratedunderperformancecategory1

• 3Certificateofappreciationawardsforexcellenceinprocessoptimisation

Ankur Sharma

English, Hindi

B.Sc. (Hons.), St. Stephen’s College, University of Delhi

3 years 9 months of experience in Automobile industry.

Maruti Suzuki India Ltd.: Territory Sales Manager

• WorkedinGurgaonandRewarimarkets,handling5 dealers, achieving INR 300 million sales per month

• LedateamtoreviveA-StarperformanceinDelhiNCRresultingina25%sales growth

• Co-ordinatedmarketingactivitiesfortheentireregion

• RegionalbrandmanagerforA-Starbrand:createdandexecutedamarketing roadmap for the brand

• Controlledcostsintheregionaloffice,savingINR27.5million

Anmol Joneja

English, Hindi

B.Tech. (Metallurgical Engineering), IIT Bombay

3 years 9 months of experience in Consulting industry.

Sterlite Technologies Ltd.: Project Analyst

• Workedonassessingmarketpotentialofbroadbandin India

Analysys Mason India (Formerly BDA Connect Pvt. Ltd.): Senior Analyst

• PerformedduediligenceofwirelessbroadbandproviderforaleadingSingapore based PE company

• Developedgo-to-marketstrategyforaFortune10technologyvendorinIPTVspace in India

Deloitte Consulting India Pvt. Ltd.: Senior Analyst

• GrowthstrategyandvalidationofbusinessplanforaFortune10companyinoptical films and display business

• Go-to-marketstrategyforaleadingnetworkequipmentvendorinIndia

Anugrah Aggarwal

English, Hindi

B.Tech. (Hons.) (Computer Science), Harcourt Butler Technological Institute, Uttar Pradesh Technical University

3 years 6 months of experience in Consulting industry.

IBM India Pvt.Ltd.: Consultant (Business Consulting Services)

• DevelopedthebusinessstrategyforIBMinBFSI captives segment

• Developedtheroadmapforpost-mergerintegrationoftwolargeUSfinancialservices firms

• MaturedthefirstSwedishBFSIclientdealforIBMGBSIndia

• ConsultedforRBS,Barclays,JPMorganandANZ

• PublishedtwotechnicalpapersininternationalconferencesinICNN(Cairo)and ICAAS (Athens)

• Filedapatentongeneticalgorithms

Anupama Pande

English, Hindi

B.E. (Electronics and Communication), Manipal Institute of Technology, Manipal Academy of Higher Education

3 years 9 months of experience in Semiconductor industry.

Freescale Semiconductors: Design Engineer

• Ledplatformdesignteam;createdroadmap,defined responsibilities and timelines

• Managedprojectthroughitslifecycleandensuredachievementoftargets

• Co-ordinatedactivitiesofallchipdesignteamsacrossIndia,USA,IsraelandChina

• Developedprocessforimprovementindesignmethodology;publishedinCadence CDN Live, an international semiconductor conference

• WasawardedFreescalecommendationaward-‘Bravo’severaltimesfor outstanding performance in projects

Anuradha Agrawal

English, Hindi

B.Tech. (Hons.) (Chemical Engineering), IIT Kharagpur

2 years 9 months of experience in Energy industry.

Shell Global Solutions (US) Inc.: Senior Associate Consultant, Hydrocarbon Management

• Implementedadvancecrudeconstraintmanagement system

• Developedyieldandpropertiesvalidationsystemforrefineries

Shell Technology India Pvt. Ltd.: Senior Associate Consultant, Feed Supply

• LedbasicdataandprocessmodellingactivityforTuprasOilCompany,Turkey

• SolvedcrudeassaysproblemforPTTAR,Thailand,savingUSD500,000

ShellGlobalSolutionsInternationalB.V.:SeniorAssociateConsultant,SupplyChainOptimisation and Management

• DevelopedmodelsandmethodologytocalculateCO2footprintforeveryrefinery product

• LedprocessmodelingactivitiesforPortArthurRefineryexpansion

Anurag Sharma

English, Hindi, Kannada, Konkani, Mandarin (Chinese)

M.Sc. (Economics), Singapore Management University

B.A. (Hons.) (Economics), St. Stephen’s College, University of Delhi

2 years 8 months of experience in Energy industry.

Platts: Petrochemicals Editor - Asia and Middle East

• DailymarketcoverageofpetrochemicalsacrossAsia, including news, pricing, analysis

• Managedatradingwindoweveryafternoonandsettlingpricingdisputes

• EngagedtheindustrythroughseminarsinDubai,SouthKorea

• ExtensivelycoveredChinesemarketusingmarketknowledgeandlanguageskills

GMO LLC.: Intern Economist

• MacroeconomicsresearchandindustryanalysisoftheMiddleEast

• AnalysedtheequitymarketandmeansofinvestinginSaudiArabia

• Usingeconometricstostudymacroeconomictrends

Anusha Pai

English, Hindi, Tamil

B.Com., Stella Maris College (Autonomous), University of Madras

2 years 9 months of experience in Financial Services industry.

Goldman Sachs Services Pvt. Ltd.: Technical Specialist

• Providedbackofficesupporttosettlementofcredit derivative trades

• Pointofcontactfortheteamforthequarterlyrollprocess

• Settherecordforthehighestmatchrate(99.68%)duringSeptember‘09roll

• DeputedtoGoldmanSachsInternational,Londonforbusinesscontinuity programme

• Involvedinprojectstoimplementprocessimprovementsfortheworkflowintrade settlements

• Trainednewmembersinductedintotheteam

Anusha Ramakrishnan

English, Hindi, Bengali

B.E. (Electrical Engineering), Sardar Patel College of Engineering, University of Mumbai

3 years 9 months of experience in Manufacturing industry.

Larsen & Toubro Ltd.: Executive Design Engineer

• Designedanddevelopedformanufacture,awide variety of MCCB and associated accessories

• Validateddesignsthroughtypetestingofnewlydevelopedproducts

• Havefiledfor3patentsundermynameinaspanof3years

Anwesh Das

Page 45: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

88 89

English, Hindi

B.Tech. (Civil Engineering), IIT Delhi

2 years 9 months of experience in IT (Products) industry.

Manhattan Associates India: Consultant

• Consultingforsupplychainsolutions,expertisein warehouse management

• Ensuringsmoothproductimplementationsandsubsequentdefectresolution

• Providingdesignforclientspecificenhancements,suggestingproductimprovements based on industry requirements

• Redesignedwarehouseoperationsflowthatimproveddailyshippedvolumeforthe India factory of one of the world’s largest cosmetics firm

• IncreasedshippingcapacityforMiddleEasternsupermarketschainbyreducingpost implementation defects by 70%

Apurva Prakash

English, Hindi, Telugu,Tamil

B.E. (Hons.) (Civil), BITS Pilani

2 years 6 months of experience in Energy industry.

Schlumberger Asia Services Ltd.: Field Engineer

• Workedasaleadengineerinover20oilwell commissioning projects both on onshore and offshore rigs, responsible for job planning and execution

• Asassistantsupervisorledthefirstevertemperaturearraysysteminstallationinthe KG-D6 deep-water gas-field for Reliance Energy

• Workedinseveral,shortduration,wellcommissioningprojectsforBritishGas,Total, ONGC and Hardy

Archana Ramana

English, Kannada

BS (Electrical Engineering), Georgia Institute of Technology

2 years 11 months of experience in Electronics industry.

Siemens Industry Inc.: Sales Application Engineer (F & B domain)

• TechnicalconsultanttoP&Gevaluationsandadvised on project rollouts

• ExecutedanenergymanagementprojectforPepsi

• Top+2009Awardforbusinessprocessimprovementproject

• InductedintoSiemensthroughtheprestigiousengineeringleadershipdevelopment programme

• Ledandexecutedabusinessgenerationproject

• Top+2008Awardforcontributiontomarketingdivisionofdiscreteautomation business unit

Arjun Krishna Bhatt

English, Hindi

CFA, Cleared Level I, CFA Institute, USA

B.Sc. (Accounting), Bethune-Cookman University

2 years 8 months of experience in Financial Services industry.

UTI Asset Management Company Ltd.: Private and Foreign Banks Channel - Relationship Manager

• Drivesalesinregionallotedthroughthechannel

• EquityAUMgrewfromINR80milliontoINR140millionfromAug‘09toApr‘10

Motilal Oswal Securities Ltd.: Advisor

• Adviseclientsontheirinvestmentandtradingpositionsinequitiesandderivatives

• Achievedthreetimestargetin2007-08,andtargetin2008-09inatough environment

• Increasedcustomerbaseby15%over2years

Arjun Singh

English, Hindi

B.Tech. (Mechanical Engineering), IIT Kanpur

3 years 8 months of experience in Transportation & Analytics industry.

Prem Cargo Movers: Business Manager

• Streamlinedbusinessoperationslikeinventory management, preventive maintenance and payment

processes

• Developedvehicletrackingsystemandfleetpermitexpirationtracking

• Initiatedbuyingvehiclesbyonline-bidding,onlinefundtransfersandonlinetender listings for cost savings of 5%

Zinnov Management Consulting: Senior Consultant - Analytics

• LedateamtodevelopworkforceplanningmodelforaFortune10company

• Preparedamodeltoestimatecallcentreoperation-costforaFortuneGlobal500 company

Arpit Patni

English, Hindi, Telugu, Tamil

B.Tech. (Chemical Engineering), Alagappa College of Technology, Anna University, Chennai

3 years 5 months of experience in IT (Services) industry.

Cognizant Technology Solutions: Associate - Projects

• Workedontransferagencyapplicationforalarge financial services major in USA

• Qualityandinnovationteamchampion,automatedcodemigrationresultinginUSD 75,000 savings

• Certifiedwithknowledgeofthetransferagencybusinessandyoungestentrantto the Global TA team

• LeadofaTeamof5associatesinM&Aactivities

• WonCognizantStarawardamong35,000employeegroup

Arun Panta

English, Hindi

B.E. (Electronics and Communications), Delhi College of Engineering, University of Delhi

3 years 8 months of experience in Consulting and Semi Conductor industry.

BGJeffreysConsulting:Consultant

• Helpedclientsinstallperformancemanagement systems in their organisations

• Providedsolutionstoclientstoeliminateinhibitorstogrowth

ST Microelectronics Pvt. Ltd.: Design Engineer - II

• Developeddesignplatformsthatenabledsignificantreductioninproduct development cycle times

Conexant (India) Pvt. Ltd.: Design Engineer

• Evolvedinnovativedesignsthatsignificantlyreducedproductcosts

Ashish Gupta

English, Hindi , Punjabi

B.E. (Computer Science), Thapar Institute of Engineering and Technology, Patiala

3 years 10 months of experience in Financial Services industry.

BA Continuum Solutions (Bank of America): Team Leader

• Createdanewrevenuestreamwithaprojectedworth of USD 3 million for an engagement with Bank of America-Merrill Lynch

• OnlycandidatefromIndiaofficetobeselectedforthequantitativemanagement programme, conducted by the bank in the USA

• Developedprofitandlossstatementsforvariousonlinebankingproducts

Inductis (India) Pvt. Ltd.: Programmer Analyst

• Generatedcriticalbusinessinsightsusingadvancedstatistical,econometricand stochastic modeling methodologies

Ashwinder Singh Sethi

English, Spanish, German

M.E. (Telecommunications), University of Oviedo

Master in Innovation and Business Development Management, University of Oviedo

3 years 3 months of experience in Manufacturing industry.

Arcelor Mittal: Research Engineer

• WorkedonidentifyingkeyresearchideasforR&DcenteratAsturias

• Launchingofresearchaxisforblastfurnacehearthwearestimation

• Projectproposalsapprovedforregional(2),national(1)andEuropean(1)R&D programmes

• Supportforblastfurnaceblow-inindifferentplantsofthegroup(Bosnia,Belgium, France, Spain)

• PursuingPh.D.inprojectmanagementatUniversityofOviedo

Aurelio Gutierrez Perez

English, Hindi

B.E. (Computers), Sardar Patel College of Engineering, University of Mumbai

2 years 4 months of experience in Education industry.

Career Launcher India Ltd.: Key Accounts Manager

• Headed2centerswithrevenuesofINR16millionand 11 member team

• ResponsibilitiesforP&L,marketing,teammanagement,developnewkeyaccounts

• Ledregionallaunchofnewproductsandmarketingcampaigns

MindTree Ltd.: Pre-Sales Team Lead, Concierge

• Ledteamof3tonegotiate,implementandpresentprototypetoDanamon,Al-Rajhi and SCB business heads

• Prototypelead,P&GMDMreporting

• Top5%inthecampuslearningprogrammeamong585recruits

Ayush Ahuja

English, Hindi

B.E. (Hons.) (Mechanical Engineering), IIT Kharagpur

2 years 9 months of experience in Manufacturing industry.

ITC Ltd.: Assistant Manager Process Improvement

• Spearheaded13SixSigma,12lean,101innovation and 110 work-out projects saving INR 51 million

• Ledtrainingof44managersonprocessexcellence

• Improvedqualitystandardsof8brandsandreducedcomplaintindexby60%

• Achievedzeronon-conformitiesinISOaudits

• Evaluatedcigarette-buffersystemstopurchasetechnologyworthINR200million

• ReducedmaintenanceinMungerfactoryinBiharfrom2shiftsto1shift

Ayush Mathur

English, Hindi, Gujarati, Marathi

CFA, cleared all Levels, CFA Institute, USA

CA, ICAI

M.Com., Sydenham College of Commerce & Economics, University of Mumbai

B.Com., Narsee Monjee College of Commerce & Economics, University of Mumbai

3 years 9 months of experience in Financial Services industry.

Warburg Pincus India Pvt. Ltd.: Research Analyst

• Keymemberofdealteamsthatevaluatedprivateequityopportunitiesacrosssectors

• Closelymonitoredtheperformanceofportfoliocompanies

• Valuedadiversifiedfinancialservicescompanywithpresenceinbanking,insurance, assetmanagementandcapitalmarkets;stresstestedthebank’sprovisioningneeds

• Evaluatedinvestmentopportunitiesinmedia-broadcasting,cableandsatellite

• Evaluatedanopportunityinthethermalpowergenerationspace

HDFC Securities Ltd.: Research Analyst

• Coveredthemid-capsector

Bhairav Rajnikant Shah

Page 46: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

90 91

English, Hindi, Kannada

B.E. (Mechanical), M S Ramaiah Institute of Technology, VisvesvarayaTechnologicalUniversity

2 years 9 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Senior Engineer

• Performedstructuralanalysisandprovidedengineering solutions for a major aerospace client

• Handledtheoffshoreimplementationforanewapplicationdevelopmentprojectin the insurance domain

• AwardedacertificateofrecognitionbytheCEOforaHRDbrandbuildinginitiative, ‘In-Corporate’

• ‘ExtraMiler’awardforQ3FY2009-10

• Workedonadoptingthe‘ToyotoProductionSystem’intheinternalworkflow processes

Bharath Bevinahally Raghunath

English, Hindi, Marathi, German

B.E. (Computer Engineering), Cummins College of Engineering, University of Pune

2 years 7 months of experience in IT (Services) industry.

Deloitte Haskins & Sells/ S. B. Billimoria: Assistant Manager

• Workedonriskmanagementandassuranceprojects for global and Indian organisations across industries

• LedcontractriskandcomplianceteamsandrecovereduptoINR20millionin shortfall for two software multinationals

• Excelledinmarketing,businessdevelopmentandcreatingbrandmaterial,identified 700 prospective clients through independent research

• Nominatedbyseniormanagementtoconductinternaltrainingsessionsonanalytical and communication skills and mentor analysts

Chaitrali Sujay Joshi

English, Hindi

B.Tech. (Information and Communication Technology), Dhirubhai Ambani Institute of Information and Communication Technology

3 years 11 months of experience in Tourism and IT (Products) industry.

ThrillophiliaAdventureToursPvt.Ltd.:Co-founder;Marketing Head

• Establishedownventure(boot-strapped);ledbusinessdevelopmentandoperations of the company

• Grewthecompanyfromstaffstrengthof2to10;achievedINR1millionsalesin 6 months

• Relationshipmanagementwithmediapartners-OutlookTraveler,Kingfisher,FMand radio partners

• Onlinemarketingandsearchengineoptimisation

Sap Lab (India) Pvt. Ltd.: Senior Software Engineer

• Softwaredevelopment(supplierrelationshipmanagement)

• Ledteamforcustomerramp-upforSRM7.0product;achievedzerocustomer escalations

Infosys Technologies Ltd.: Software Engineer

Chitra Gurnani

English, Spanish, French, German, Hindi

M.E. (Telecommunications), Higher Engineering College, Sevilla, Universidad de Sevilla

3 years 9 months of experience in Telecommunications industry.

red.es - Spanish Government: Project Manager

• ImplementationandreportingofEuropean commission policies for the i2010 programme for the development of the information society in Europe

• Technicaldesignandimplementationofinfrastructureprojectsforthepublicsector

• Negotiationandco-ordinationwithdifferentstakeholdersinordertoensuretheir participation (state governments, private corporations, independent institutions)

• Budgeting,trackingandfinancialreporting;harmonisationwithEuropeanreporting standards and intra-communitary partners

red.es - Spanish Government: Trainee

Daniel Gomez Diaz-Pines

English, Portuguese

Dual Degree - M.E. (Software Engineering), University of Southampton

2 years 9 months of experience in Diversified Manufacturing and Service industry.

Mozambique Holdings Ltd.: Executive Director

• Administrationofmaincompanyandsubsidiaries

implemented automated inventory and accounting system, which reduced inventory cost by 5%

• ManagedEximBankofIndiafundedwaterproject,ofsizeUSD28million

• ManagedrestorationofMaputoOilTerminal(largestsourceofoilforMozambique)

• Creatingandmanagingofcontracts/tenders

• Designedhospitalprojectforfunding

Deepak J. Parayanken

English, Hindi, Tamil

BBM, Christ College, Bangalore University

3 years 3 months of experience in Consumer Products industry.

ROR Infotech: Marketing Manager

• Consumerresearchandcrosspromotionaltie-ups

Hindustan Unilever Ltd.: Brand Officer, Ice Cream Division

• Brandactivationofallthebrandsintheicecreamportfolio

• Sales-support-retailvisibilityrolloutsandon-groundactivation

• Marketingbudget-brandallocationandcontrol

• Planned&ExecutedProjectDoorstep:HomeDeliveryofIceCreams

• Favourablementioninbook‘Where’smyketchup’(Gonda&Khan)forhandlingof Consumer Complaint

JWalterThompsonPvt.Ltd.:TraineeAccountExecutive

• WorkedontheLeviStraussaccount

Deepak Subramanian

English, Hindi

B.Com.(Hons.),SriVenkateswaraCollege,UniversityofDelhi

2 years 6 months of experience in Consulting industry.

The Energy and Resources Institute: Research Associate

• Identifyingfinancingmechanismsforthe‘Lightinga Billion Lives (LaBL)’ campaign

• DevelopedPDDforLaBLasaprojectunderCleanDevelopmentMechanism(CDM)

KPMG: Analyst

• Understoodprocesscontrolsformanufacturing,BPO,hospitality,mediaand power clients

• Identifiedrisksandsuggestingprocesscontrolsalongwithcost-benefitanalysis

• Recommendedcontrolsforexistingprocessesandredesigningprocesses

• Exceptionalperformerratinginbothyears

• Handled4outof9clientsindependently

Deepika Seth

English, Hindi

B.E. (Electrical Engineering), Shri Govindram Seksaria Institute of Technology and Science, Indore, Rajiv Gandhi ProudyogikiVishwavidyalaya

3 years 3 months of experience in IT (Services) industry.

Accenture: Senior Software Developer

• WorkedondatamodellingforaninsuranceclientbasedinUSA

Capgemini (India) Pvt. Ltd.: Consultant (P2) (Software Developer)

• Partoftheteamthatdevelopedsalesanalyticaltoolforclient’sROIanalysis

• Developedadatamodeltobringinsupplychaindataforclient

• Awarded‘BestLearner’foroverallperformanceduringthefreshers’training programme

• Awardedfirstprizeforpresentationon‘BusinessIntelligence&Virtualworld’

Deepshikha Yadav

English, Hindi, German

B.Com.(Hons.),SriVenkateswaraCollege,UniversityofDelhi

2 years 9 months of experience in Consulting industry.

PricewaterhouseCoopers: Associate (Business Advisory Services)

• Executedbusinessadvisory,processreviewandinternalauditassignmentsfor clients in oil & gas, FMCG, professional services and aviation domains

• DevelopedapproachpapersonClause49,SOXandinternalcontrolframeworks

• Memberofbusinessdevelopmentandmarketingteam-obtainedprojectsfromRIL and Canadian High Commission

Corporate Executive Board: Research Associate

• Researchedoninternalandexternaldatabasesforsolutionsandbestpracticesin financial service industry

Dhruv Vohra

English, Hindi, Kannada

B.E.(IndustrialEngineering&Management),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity

3 years 9 months of experience in Consulting industry.

Deloitte Consulting: Consultant

• Unifiedtheordermanagementsolutionforanindustrial gases major with over 7 million customers

• Onsiteco-ordinatorfortheaboveengagement

• ProcessLeadinasolutionupgradeprojectforanaircraftmanufacturer(teamsize-8)

• TrainedandmentorednewrecruitsintheSAPpractice

• ApplauseAwardforaSAPdesignsolutionforautilitiesmajor

Divyashree

English, Hindi, Oriya, Bengali

B.Tech. (Hons.) (Energy Engineering), IIT Kharagpur

3 years 9 months of experience in FMCG industry.

ITC Ltd.: Assistant Manager-Projects

• Drivingdesign,planningandexecutionofaINR3.5 billion Greenfield cigarette manufacturing factory

• Developmentandcompetencybuildingofamulti national vendor base

• Initiationandimplementationofaknowledgeportaltomanageprojects

• CertifiedSixSigmablackbeltandleangreenbelt

• Memberofthemanagementteamtonegotiatemanpowerrationalisationwithtrade unions

Durga Madhab Dash

English, Hindi

B.E. (Computer Science), Thadomal Shahani Engineering College, University of Mumbai

2 years 9 months of experience in IT Products and Engineering industry.

Acrovent Systems Pvt. Ltd.: Engineer (Planning)

• Projectengineering,planningandmanagementfortwo big air-conditioning projects for CMC and L&T

• Handledasmallmanufacturingunit

• Increasedproductionbyintroducinganewpaymentstrategyforworkers

Google India Pvt. Ltd.: Software Test Engineer

• Ledateamofvendorsandco-ordinatedthetestingforGooglePack

• Increasedproductivitybymakingtheautomationlanguageindependent

• Ownedintegration/releasesofapplications

• MovedreleaseprocessestoHyderabadfromKirkland

Dyuti Barma

Page 47: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

92 93

English, Hindi

B.E. (Information Technology), DCE, University of Delhi

2 years 9 months of experience in Consulting industry.

PricewaterhouseCoopers: Consultant

• Engagedwithhealthcare,retailandgovernmentclients for MS dynamics ERP implementation

• Involvedinimplementationoftravelersclinicandstaffclinicmodulesforahospitalin Bangladesh

• Wasinstrumentalingettingtwonewprojectsfortheorganisation

Esha Agarwal

English, Hindi, Gujarati, Marathi

M.Com., H R College of Commerce & Economics, University of Mumbai

BMS, H R College of Commerce & Economics, University of Mumbai

3 years of experience in Construction & Financial Services industry.

Spenta Properties Pvt. Ltd.: Director

• Managementofday-to-dayoperations

• Organisationoffundingandliaisingwithgovernmentofficialsforrequiredpermitsand permissions

• Oversawthefirstcertifiedgreenbuildingbuiltbythecompany

• Handledaccounting,taxplanning,marketingandsales

JPMorganChase:Analyst

• ConductingfundamentalcreditresearchonJPM’sIBclients

• Workingwithportfoliosmanagersandtraderstomanagerealestateportfolio

Farshid Aspan Cooper

English, Hindi

M.A. (Economics), Delhi School of Economics, University of Delhi

B.A. (Hons.) (Mathematics), St. Stephen’s College, University of Delhi

3 years 10 months of experience in Investment Banking industry.

ICICI Bank Ltd.: Manager Structured Finance Group

• WorkedwithMckinsey&Cotodeviseroadmapforbankforayintodistressedasset market

• WorkedonIndia’sfirstdistressedassetsecuritisationworthUSD80million;completed securitisation worth USD 1 billion across product classes and multiple buyers

• HandledstrategiccarveoutofdebtcollectiondivisionworthUSD100million

• Carriedoutequityinvestmentindistressedfundsandcreditbureaus

Gaurav Arora

English, Hindi, Russian, Spanish

B.A. (Economics), Yale University

3 years 7 months of experience in IT (Services) industry.

TwoFour Global: Systems Analyst

• SoftwaresolutionsdeliveryforBFSIdomain

• WorkedonFXtradingsystemsforMorganStanley private wealth management

• RedesignedworkflowsystemsforanewABS/CDStradingsystematMerrill-Lynch

• WorkedatLondonandNewYorkmarkets

• Droveinitiativetocreateinternalknowledgebasetocollectandcategoriseknown system issues

• IndependentlywroteVBAmacropackagestoimproveefficiencyoftestcreationteam

Gaurav P. Sajjanhar

English, Hindi

BBS, College of Business Studies, University of Delhi

3 years 6 months of experience in Consulting & Financial Services industry.

Talent365: Founder

• Launchedanonlineplatformforcompaniestorecruit from colleges

UBS AG: Project Officer, Global Strategy & Business Development (Wealth Management)

• Managedtheprojecttodevelopretailbankingstrategy

• LedanoffshoringprojectfromZurich,NewYorkandLondontoHyderabad

• Workedontheannualglobalplanningprojectforthetopmanagement

KPMG: Analyst (Risk Advisory Services)

• Advisedclientsaboutbusinessrisksandcontrolsrequiredtomitigatethem

• Conductedprocessreviews,analysisandinterviewswithclientsacrossdifferent industries

Gaurav Pasricha

English, Hindi

B.Tech. (Hons.) (Mechanical), IIT Kharagpur

3 years 6 months of experience in IT (Products) industry.

Adobe Systems India Pvt. Ltd.: Member of Technical Staff

• ResearchanddevelopmentonFlashandIDE

• Filed5USpatents

• ‘SpecialContribution’awardforleadingstrategicenterprisepartnershipsforproduct development

• WorkedtowardsmarketdevelopmentofFlashbuilder

• Workedwithbusinessteamsoftechnicalcollaborators

Onmobile Asia Pacific Pvt.Ltd.: Software Engineer Trainee

• ActingtechnicalleadforISteam

• Received‘OnMobileEmployeeIcon’award

Gaurav Priyadarshi

English, Hindi

B.Tech. (Electronics), Harcourt Butler Technological Institute, Uttar Pradesh Technical University

3 years 8 months of experience in Engineering industry.

Schneider Electric (India) Ltd.: Senior Automation Engineer

• GeneratedrevenuesworthINR70millionforthe financial year 2009-2010

• Businessdevelopementforautomationproductsandsolutions

• Channelandstrategicaccountmanagementforsustainedbusiness

• AwardedbestgraduateengineertraineefortheGETbatch2006

• SelectedasoneoftheonlytwomembersacrossIndiafortheMarcoPolo programme

• Youngestmemberoftheautomationteam

Gaurav Taragi

English, Hindi

B.E.(InformationTechnology),DwarkadasJSanghviCollege of Engineering, University of Mumbai

2 years 6 months of experience in Manufacturing industry.

Strata Geosystems (India) Pvt. Ltd.: Business Development Executive

• IdentifiedthepotentialforgeocellsinIndiaafteranalysingseveralgeosynthetic products

• InstrumentalinestablishingapartnershipwithPRS,worldwideleadersingeocells

o3 Capital Advisors Pvt. Ltd.: Assistant Manager - Technical

• Setupandimplementedanautomatedarbitragetradingsystem,generatingan above average return using complex derivative trading strategies

• InitiatedandimplementedaCRMsolution

• Designedanddevelopedaportfoliomanagementsystemforourbrokingoperations

Gautam Narendra Dalmia

English, Hindi

Green Belt Certification in Six Sigma, BMG International, Mumbai

B.Tech. (Hons.) (Chemical), IIT Kharagpur

2 years 9 months of experience in FMCG industry.

ITC Ltd.: Maintenance Incharge, PMD (Primary Manufacturing Department), Bangalore

• Ledmaintenanceteamof23toimplementconditionbasedmonitoringandreliability centric maintenance, reducing plant downtime by 23%

• Developedandimplementedprimaryknowledgeportalforcigarettemanufacturing; trained 45 managers post implementation

• Plannedandexecutedcapexprojects(INR12million)

• ExecutedprocessimprovementprojectsusingSixSigmatoimprovetobacco utilisation by 1.3% (INR 8 million savings)

Gautam Sharma

English, Hindi, Malayalam

B.Tech. (Mechanical Engineering), NIT Calicut

3 years 8 months of experience in Offshore Oil & Gas EPC Industry

Larsen & Toubro Ltd.: Assistant Manager - Marketing and Business Development (MENA)

• Inchargeofevaluatingopportunities(aboveUSD100 million) from technical, commercial and strategic perspective

• Workedcloselywithmanagementoninternationalisationstrategyforoilandgas projects

• PartoftheteamthatformedstrategicbusinessunitatAbuDhabi

• AmongthefewidentifiedandpromotedtothetoptalentschemeManagement Leadership Programme (MLP)

• Projectmanagementteamfor4WPP(value:USD250million)managing sub-contractors at fabrication yard and offshore

Gautham Krishnan

English, Malayalam, Bengali, Marathi

B.A. (Economics), St. Xaviers College, University of Mumbai

3 years 8 months of experience in Broadcasting industry.

Discovery Networks Asia-Pacific: Assistant Manager - Advertising Sales

• Handled33%ofallIndiaannualsalestargetof INR 250 million

• AchievedannualsalestargetwithYoYgrowthof10%

• Workedondeepeningandexpandingcustomersegments,notablyPSUs,autoand finance

• SalespersonforDiscoveryTravelandLiving’slargestclientHULfor2yearsinarow, growing it by 20% YoY

• Youngestnon-MBAemployeeinsalesfunction

Gayatri Rajagopal Tampi

English, Hindi, Sindhi

CA, ICAI

B.Com., PMB Gujarati Commerce College, Devi Ahilya Vishwavidyalaya

3 years 7 months of experience in Financial Consulting and Banking industry.

Grant Thornton India: Senior Consultant

• Ledteamsforbusinessplanreviewsandfinancialduediligenceacrosssectors

• WorkedononeofthelargestBPOacquisitionsinIndia

• AdvisedvariouscorporateclientsonM&AandIFRSrelatedvaluations

Citibank NA: Assistant Manager (Product Control Group)

• SupportedFXtreasuryfrontofficeindecisionmakingandriskmanagement

• Waspartoftheteamthatimplementednewriskmanagementsystem

Geetesh Ahuja

Page 48: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

94 95

English, Hindi

B.A. (Economics), Hansraj College, University of Delhi

3 years 11 months of experience in Real Estate industry.

DLF Ltd.: Deputy Manager, Finance and Investor Relations

• RaisedINR10billioncommercialpapers

• RaisedINR5billioncorporateloanfromUCOBank, also worked on other funding proposals including NCDs

• Gotshort-termratingfromCAREforcommercialpapers

• Increasedequityresearchcoverageto25brokerages

• Closeliasioningwithanalysts/investors

Adfactors PR Pvt. Ltd.: Account Executive - Investor Relations

• Investorrelationsfor10+clientsacrosssectors

• Strategisinginformationflowforkeyeventsandfinancialresults

• Organisedroadshowswithtopfunds

Geetika Chhabra

English, Hindi

BMS,JaiHindCollegeandBasantsinghInstituteofScienceandJTLalwaniCollegeofCommerce,Universityof Mumbai

3 years 8 months of experience in Consulting industry.

Protiviti Consulting Pvt. Ltd.: Business and Risk Consultant Incharge

• Rebrandedaconsultingfirm-performedacomprehensivereviewoftheclient’s business offerings

• Reviewedoperationsinhospitality,manufacturingandretailsectorsanddeveloped standard policies and processes for clients in these sectors

• Recognisedasthemostemergingplayer(March2009)

Axis Risk Consulting Services Pvt. Ltd.: Senior Analyst

• Re-designedthechannelmanagementstrategyforaDTHserviceprovider

• Analysedtheeffectivenessofmarketingpromotionalspendsforanentertainment service provider

Hana Al Fahoum

English, Hindi

B.E. (Civil Engineering), Delhi College of Engineering, University of Delhi

2 years 9 months of experience in Real Estate industry.

Laing O’Rourke: Package Engineer

• Resourceplanning,tendering,sub-contractor management and project commercials for packages worth USD 31 million (team size: 40)

• Projects:DubaiInternationalAirport,HarvardUniversityHospital

• Filedapatentfor‘Methodoflocatingandmanagingelementsinbuiltenvironment’

• CSR,environmentandhealthandsafetyrepresentative

Laing O’Rourke: Assistant Manager

• Consultanttoteams(7-8members)forconstructionsoftware/hardwaredevelopment

• Establishedprocessesforproductcommercialisation

• Clientinteractionsforsales;materialisedadealwithALDAR

Haresh Vazirani

English, Hindi, Telugu

MBBS, NTR University of Health Sciences, Osmania Medical College

3 years 9 months of experience in Construction industry.

Chava Techno Constructions: Managing Partner

• Constructeda30apartmentresidentialcomplexat Khammam

• Single-handedlyfoundedthecompany,conceivedtheprojectandexecutedthesame

• MarketedtheprojectandsoldtheapartmentsatanaveragepriceofINR2million per flat

Hari Krishna Chava

English, Hindi, Tamil

B.Sc. (Statistics), Loyola College, University of Madras

2 years 9 months of experience in Market Research industry.

AC Nielsen ORG-MARG Pvt. Ltd.: Senior Diagnostic Consultant

• Workedonmarketresearchprojectsacrossdomains- FMCG, telecom, durables, OTC, F&B, alcohol, etc.

• FiveCircleofExcellenceAwards

• Leadroleindevelopmentofanewmarketresearchframework

• Leadpersonfortwotechniques-segmentationandproductlaunchareas

• Supportedupto10clientsatonetimeacrossgeographies-AsiaandEurope

• HandledstudiesofmajorclientslikeP&G,Kraft,Phillips,etc.

Hariharan V S

English, Hindi, Punjabi

B.Tech. (Hons.) (Electronics & Communication), Guru Nanak Dev University, Amritsar

3 years 9 months of experience in IT (Services) industry.

Wipro Technologies: Senior Software Engineer (BFSI domain)

• Developmentandimplementationofscriptsforglobalgeneralledgerproject

• Managingquarterlyandoff-cyclereleasessinglehandedly

• Providingeffectivedesignsolutionstointernalandexternalteamsbasedoutof Asia, Europe and US

• Soleonsiteco-ordinatoroftheteamatSingaporeforfifteenmonths

• Recognisedas‘KeyTalentoftheCompany’fortheyear2009

Henna Mehta

English, Hindi, Bengali, German

B.A. (Hons.) (Economics), Miranda House, University of Delhi

3 years 9 months of experience in Consulting industry.

McKinsey Knowledge Centre, McKinsey & Co: Research Analyst

• Firstresearchteamincompanytointeractdirectlywithclients

• Specificareasofresearchfocusincludemarketandcompetitiveintelligencein consumer electronics industry

• Conductedworkshopstocoachjuniorcolleaguesonworkflowprocesses

• Receivedannualawardforexcellenceinprocessandpeoplecapabilities,givento top 5% of employees

• Receivedanawardforintroducingchangesthatreducedturnaroundtimein preparing reports by 50%

Ipshita Sinha

English, Hindi, Bengali

B.Sc. (Hons.) (Physics), St. Stephen’s College, University of Delhi

3 years 9 months of experience in Transportation industry.

A.P. Moller Maersk Group: Assistant Manager, Dubai

• Co-ordinatedmovementandportoperationsofships calling West & Central Asian ports from Dubai, including US Military cargo ships

• NominatedfromWestandCentralAsiaforglobalproject‘OnTimeDelivery’in Copenhagen

• AchievedhighestcustomersatisfactionscoreforNorthIndia,asteamleader (customer service) with 17 members

• Amongtop10inMaerskLeadershipManagementProgramme

• SavedUSD500,000incostsinJanuary2010

Ipsita Das

English, Hindi

M.A. (Economics), Delhi School of Economics, University of Delhi

B.A. (Hons.) (Maths), St. Stephen’s College, University of Delhi

3 years 9 months of experience in FMCG industry.

ITC Ltd.: Assistant Brand Manager (Candyman & Mint-O fresh)

• LaunchedCandymanintolactoandfruit-toffeesegmentsandMint-OGOLacross India

• MemberofBingotaskforce,strategisedlaunchofBingo-16%marketsharein 9 months

• AsAM,marketresearch,analysedretailauditdatatostrategisepromotions

• Developedlong-termforecastingmodelswithconfidencelevelof98%

• AsASM,increasedcigarettesalesofAPby27%,secondhighestinthecountry

Jagjeet Harode

English, Hindi, Gujarati

B.E. (Computers), SAKEC, University of Mumbai

2 years 4 months of experience in IT (Products) industry.

Tata Consultancy Services Ltd.: Assistant Systems Engineer

• In-chargeofnewcustomeronboardingprocess automation for a large telecom client

• Designedchangecontrolsystemfor115teams,implementedfor25

• Teamreceivedrecordcustomersatisfactionindexofover99%forthreehalf-year periods

• Projectachievedsavingsworth5000manhoursannually

• Keydriverbehindsuccessfulglobalrolloutofdomesticcontentmanagementsystem

• Received‘Outstandinginnovationsandout-of-the-boxthinking’certificateatTCS

Jainam Bharat Shah

English, Hindi, Tamil

B.E. (Electronics and Telecom), CCOEW, University of Pune

3 years 3 months of experience in IT (Products) industry.

Netezza Corporation (USA): Technical Support Engineer

• Providedsupporttodatawarehouseoperationsofbig retailers

• Workedonextendingcapabilitiesofexistingdatawarehouse

• ‘CustomerSupportEngineeroftheMonth’inthesecondmonthofwork

Archibus/ FM Pvt. Ltd. (USA): Application Engineer

• Managedcustomerserviceescalations

• Developedtheuserinterfaceforfaciltiesmanagementproduct

• Providecustomsolutionstopartnersanddirectcustomers

Brainvisa Pvt. Ltd.: Associate Programmer/ Project Lead

• Designedanddevelopede-learningcourseware

• Mentorednewmembersoftheprojectteam

Janaki Ramakrishnan

English, Hindi

B.Sc. (Hons.), St. Stephen’s College, University of Delhi

2 years 9 months of experience in Financial Services industry.

Ernst & Young Pvt. Ltd.: Analyst (Oil & gas domain for M&A)

• Valuationstudies,comparativebenchmarking, investor searches and business development

• Preparingpitches,informationmemoranda,clientpresentationsfortransactions

• HelpedclientswincitygasandNELPbids

• Independentlyexecuteddatarooms

Evalueserve.com Pvt. Ltd.: Business Analyst

• Financialandbusinessresearchforprivateequitiesandhedgefunds

• Projectmanagementofmarketstudiesandcompetitiveanalysis

• Instatedoffshoreresearchcenters

• Thoughtleadershipmodules(sovereignwealthfunds,PIPES,etc.)postedonintranet

Japun Ahluwalia

Page 49: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

96 97

English, Hindi, Malayalam

B.Tech. (Electrical & Electronics), College of Engineering, Thiruvananthapuram, University of Kerala

3 years 8 months of experience in Manufacturing industry.

VictoryGlassandAluminium,Dubai:OperationsManager

• Increasedproductioncapacityby60%,from50to80 glass sheets per day

• Ensuredzerodowntimefrommachinerybreakdown

• Formedthedesigndepartmenttherebyincreasingtheproductbase

• Establishedthetradingdivisionofthecompany

Larsen & Toubro Ltd.: Graduate Engineer Trainee (Strategic sourcing department)

• MadeoverUSD3millionworthofpurchasewith16%savings

• 10annualmaintenancecontractsforthefinancialyear2007-08

Jince Joy

English, Hindi

B.Arch., C R State College of Engineering, Maharshi Dayanand University

2 years 8 months of experience in Hospitality and Consulting industry.

VatikaHotelsPvt.Ltd.:Executive-ProductStrategy

• Projectmanagement-backofhouseareasofThe WestinHotel(Starwood);‘TopPerformeroftheCompany’awardforcostreduction

• Co-ordinationwithmanagement,purchaseandoperationstofacilitateprocurement and approvals

• Workedwithconsultantsandcontractorstoresolvesiterelatedissues

Incubis Consultants (India) Pvt. Ltd.: Executive - Architecture

• Designconsultant-TheMetropolitanHotel(EmaarMGF)

• Technicaldetailing;projectcostandmaterialrequirementestimation

• Preparingbillsofquantities,tenderdocuments,finishingschedules

Juhi Dang

English, French, German

M.E. (Electrical Engineering), IIITM, University of Karlsruhe

B.E. (Electrical Engineering), Institute National Polytechnique de Grenoble

3 years 9 months of experience in Automotive industry.

Robert Bosch GmbH, Stuttgart, Germany: Chassis System Engineer

• Initiatednumerousprocessimprovementstoreducetimelines.

• Growingexpertiseandenthusiasticleadershipmademebecomeakeyplayer

• Tooktheinitiativetosetupsmallteamstoworkonthrillingresearchtopics

• Estimationofvehiclemassaswellasend-of-linetestingledtopatents

Julien Levrier

English, Hindi

B.Tech. (Mechanical Engineering), NIT Suratkal

2 years 9 months of experience in Automotive industry.

Tata Motors Ltd.: Assistant Manager

• Responsibleforperformanceofchannelpartnersin after sales and service marketing across North

• Co-ordinationandimplementationofJDPowerrelatedactivities

• Deploymentofaftersalespolicyinitiativesintheregion

• KeyroleinachievinghighestgrowthinJDPCSIsurvey‘09forDelhi/NCRregion

• LedKaizeninitiative-improvedproductivityoffreeservicecategoryby74%

Karan Sahni

English, Hindi

BS (Electrical Engineering), Purdue University

3 years 9 months of experience in Manufacturing industry.

Zenith Forge Ltd.: Executive Director

• Implementedtwoexpansionprojectsformanufacturing automotive finished products

• Conceptualisedamanagementinformationsystemtomonitorqualityandcost

• SetupanancillaryunitfortheTataNano;productionfacilitiesbeingshiftedtoPune

• ImplementednewqualitycertificateTS16949

Motorola Inc.: Electrical Engineer

• TeamlaunchedthefirstMOTORAZRinJapan

• ConceptualisedamatrixtotrackSixSigmalogistics

• IntegratedanRFIDprototypeonacellphone

Karan Sood

English, Hindi

BBS - Finance, College of Business Studies, University of Delhi

2 years 8 months of experience in Manufacturing industry.

Supra Craft Packaging Pvt. Ltd.: Manager-Marketing and Process Controls

• Developedmarketingandbusinessdevelopmentstrategyforthecompany

• Involvedina3-monthlongpackagingprojectforHondaIndia

• Conductedinternalassessmentofsystemsorientationandprocessre-engineering, and worked to introduce an ERP system to improve operations

• Co-ordinationbetweenmarketingandproduction,planningandcontrol

KPMG Business Advisory: Analyst

• Undertookinternalaudits,mademodelbusinessprocessesandSOPsforsomeof the country’s leading companies

Karn Bhugra

English, Hindi, Kannada, Telugu, German

B.E.(Mechanical),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity

3 years 9 months of experience in Automotive industry.

National Instruments India: Field Sales Engineer

• ManagedUSD2millionterritoryacrossSWIndia; accountmanagerfromconcepttodelivery;clientsincludedRBI,GE,L&Tand American Power Conversion

• Exceededrevenuetargets;grewbusinessby40%in2009-10

• Executedagreement(USD1millionrevenue)withNITSuratkalforestablishingaCOE

Robert Bosch (India) Ltd.: Engineer

• Workedonsite(Germany)onspecificationsforautomativediagnosticcontent

• Increasedprojectdeliveriesby35%QoQ

• ‘BestEmployeeoftheDepartment’,2007

Karthik P Kishore

English, Hindi, Gujarati, Bengali

B.Tech. (Information Technology), NIT Durgapur

2 years 10 months of experience in IT (Products) industry.

Cisco Systems Inc.: Software Engineer

• LedtheR&Deffortsfortwonewhardwaremodules, collaborating with global cross functional teams

• OwnedthedevelopmentactivitiesofservicemodulesonCatalyst6500,an enterprise/ internet switching product

• Filedtwopatents:oneonincreasingservicingcapacityofanetwork,andanotheron efficient load sharing and connection movement in a network

• Awarded‘CiscoAchievementAward’and‘CiscoSTAR’foroverallperformance

Khilan Haria

English, Hindi

M.Sc. (Employment Relations), London School of Economics

B.A. (Hons.) (Literature) and M.A. (Literature), Hansraj College, University of Delhi

3 years 6 months of experience in Consulting industry.

GradTrain: Associate Director

• Businessheadforastartupineducationsector

• Responsibleforproductdevelopment,salesandmanagingteamoftenemployees

Ernst & Young Pvt. Ltd.: Associate Consultant - Business Advisory Services

• Consultingexperienceacrossretail,utilities,infrastructure,bankingandtechnology for competency development, ESOP’s and sales force effectiveness

• Streamlinedknowledgemanagementsystemforthepractice

Komal Jalan

English, Hindi, French

B.Tech. (Metallurgy), IIT Kharagpur

3 years 9 months of experience in Investment Banking industry.

Global Market Centre, Deutsche Bank Group: Senior Analyst

• Equitystructuring,structured/pricedmorethan300 complex exotic derivatives using state of art techniques

• HelpDeustcheBankstructureandhedgeUSD4billioncash/synthetic/hybridCDOs

Byte Consulting Pvt. Ltd.: Software Engineer

• Buildingmodelsfordebtcashflows

• Modelingsecuritisationofassetsusingdealdocuments

Krishanu Sinha

English, Hindi

B.Sc., St. Stephen’s College, University of Delhi

2 years 9 months of experience in Consulting industry.

Accenture Services Ltd.: Business Analyst

• Workedonstrategyandsupplychainprojects, delivered 20% cost savings in the supply chain of a

consumer electronics client

• Shareholdervalueanalysistoidentifypotentialareasofengagement

• DevelopedbusinessworthINR20millioninstrategyconsulting

• Consistentlyrankedamongsttop5%inpeergroup

• CreatedanM&AtoolkittoidentifycostbenefitsofUSD10millionforaUStelecom company

Kriti

English, Hindi

BS (Electrical and Computer Engineering), Carnegie Institute of Technology, Carnegie Melon University

2 years 8 months of experience in Internet Development Services industry.

SnatchKing Online Pvt. Ltd.: Founder and CEO

• ExclusiveallianceswithTimesofIndiaGroup,Mid-day and Dainik Bhaskar for online classifieds

• OperatedIndia’slargestonlineclassifiedwebsiteSnatchKing.com

• Provisionalpatentsinartificalintelligenceandnaturalanalysis

• Grewthecompanyfromanemployeestrengthof2to15in2years

• CompanyhasnowbeenacquiredbyMid-dayInfomediaLimited

Kunal Kapur

Page 50: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

98 99

English, Hindi

B.E. (Computer Science), Delhi College of Engineering, University of Delhi

3 years 9 months of experience in Pharmaceuticals and Market Research industry.

Medo Chem Laboratory Pvt. Ltd.: Director

• Instrumentalinsettinguptwopharmaceutical manufacturing plants in North India

• Diversifiedcompany’sproductportfoliobyintroducingnutraceuticals

• Increasedrevenuesby80%intwoyearsbylaunchingproductsinfivenewstates

• Implementingglobalmanufacturing,environmentalandsupplychainpractises

The Smart Cube: Consultant

• AdvisedAsiansupplychainstrategyforglobalpetrochemicalscompany

• StrategisedentryofEuropeanaircargocompanyintotheexpresscourierservicesin the Nordic Region

Kunal Bansal

English, Hindi

CFA, Cleared Level I, CFA Institute, USA

B.Tech. (Civil), IIT Roorkee

2 years 9 months of experience in Financial Services industry.

Capital One Services (India) Pvt. Ltd.: Senior Associate

• Identifiedfraudtrendsandconstructeddefencesto save over USD 10 million annually (7.7% of overall transaction fraud)

• Received‘CapitalOne-Icon’awardformentoringjunioranalysts

• Collaboratedwithteamsacrossgeographiestodesignandimplement‘International Traveller’ strategy

• Developedbreak-throughquantitativemodelstoimprove‘defaultrisk’predictionsin collections

Kunal Garga

English, Hindi, French

B.A. (Economics), Franklin and Marshall College

3 years of experience in Real Estate industry.

Knight Frank India Pvt. Ltd.: Assistant Manager - Research

• Workedonfirsteverofficerentforecastingmodel formulated by an Indian IPC

• Formulatedmodeltoquantifypotentialmarketsizeof middle income housing by 2011

Zenta Knowledge Services Pvt.Ltd.: Process Lead - Citigroup/ Barclays Underwriting Team

• InstigatedareductionofcycletimeforunderwritingofCitigroup/Barclays commercial mortgages

• Awarded‘EmployeeoftheMonth’forthesuccessofaqualitycontrolmodelI devised for a project

Zenta: Consultant: Bear Stearns Securitization Group

• Oversawassetsummaryreportpreparationandclientcommunication

Kunal Sabharwal

English, Hindi

Masters in Finance & CFA Charter, ICFAI University

B.Com. (Hons.), Bhawanipore Education Society College, University of Calcutta

2 years 11 months of experience in Insurance industry.

AON Specialist Services Pvt. Ltd. (ASSPL): Assistant Manager

• Investmentadvisoryservicesforpensionfunds

• TeamLead(10members)handlingthehighestrevenuegeneratingoffice

• Actuarialvaluationsandassetliabilitymodellingforpensionfunds

• Advisoryservicesforpensionfundbuyouts

• Oneofsixoutof100selectedfortheleadershipdevelopmentprogrammeofthe company

Rakhecha Insurance Consultants Pvt. Ltd.: Consultant

• Teamleadforsourcingclientsforinsurancebrokeragebusiness

• Handledthelargestclientaccount

Laxmipat Singhi

English, Hindi, Telugu

B.Arch.,JNTUSchoolofPlanning&Architecture,Hyderabad

3 years of experience in Real Estate industry.

Freelancer: Architect/ Interior Designer

• Designaspects-spaceplanning,volumetricstudy, furniture and illumination design

• Managementaspects-clientservicing,projectplanning,productspecificationand financial estimations, periodic site evaluation and supervision

Freelancer: Actress/ Model

• ActedinfourTelugufilms(KarthikeyaCreations-SasirekhaParinayamu,SM Creations - LIfestyle, WorthWatching Entertainment - Yuvatha, Amigos Creations- Happy Days)

• ActedinaTelugutelevisionserial(AnnapurnaStudios-Yuva)

Madhumita N

English, Hindi, Telugu

B.Tech. (Civil), IIT Madras

3 years 5 months of experience in Financial Services industry.

Capital One Bank (UK): Senior Business Analyst (credit cards)

• Identifyingimpactofloyalty/satisfactiononcustomer value

• Creatingmonthlymarketingplansaligningwithbusinessstrategy

• Relaucheddirect-mailchannelwith>75%reductioninfixed-cost

• Created‘Balanced-Scorecard’,afirstofitskindattempttointegratestrategyacross different teams

• Developedchequestargetingmodelleadingto40%decreaseinmarketingspend

• Created2008,2009and2010marketingbudgetplansforentireacquisition/ customer-management activity

Mallika Kodali

English, Hindi

B.Tech. (Hons.) (Electronics & Communication), NIT Kurukshetra

3 years 9 months of experience in IT (Services) industry.

Accenture: Senior Software Engineer

• CRMsolutionarchitectforamajorpublicservices ‘Diamond’ client

• Client-liaisonperson,responsibleforschedulingprojectreleases

• Teamleadinthesoftwaretestphase,involving900man-daysofeffort

• Co-ordinatorforLife@Accenturesocialeventsandteamsuccesssurveys

• Responsibleforend-to-endtestingof2CRMfunctionalities

• Winner-ASEAchieversAward2006-2007andcontributedtooffshoringof70% project activities

Manavendra Davar

English, Hindi

B.Tech. (Civil), IIT Kanpur

3 years 9 months of experience in Financial Services and IT (Services) industry.

HSBC Electronic Data Processing India Pvt. Ltd.: Assistant Manager (Analytics)

• Toassessandmitigatecredit-riskinpersonalfinancial services portfolio of HSBC, Europe

• StartedenvironmentalclubtomakeHSBCagreenerplace

Fair Isaac Software (India) Pvt. Ltd.: Software Quality Assurance Engineer

• Detailedanalysisoffeaturesofpredictiveanalyticsproduct,acreditrisk management tool

• SpotAwardforoutstandingperformance

• MentorforFairIssacBuddyProgrammeforcampusrecruits,2008

Manjari

English, Hindi

B.E. (Information Technology), Delhi College of Engineering, University of Delhi

2 years 9 months of experience in Electronics industry.

ST Ericsson: System Software Engineer

• Evaluateandimplementnewdesignfeaturesin Bluetooth IP

• Createandstandardisetestingandvalidationproceduresfornewfeatures

• Inventedprocessforenablingcommunicationstacktorunacrossseveraldevices, patent pending

• Inventionrecognisedasamongsttop3patentproposalsfromIndia

• NominatedforCEO’scorporaterecognitionawardfordevelopingkeyproduct differentiator for IP

• Significantlyimprovedefficiencyoftestingprocessesbycreatingautomatedsuite

Mayank Agarwal

English, Hindi, Tamil

MBBS, Sri Ramachandra Medical College & Research Institute, Sri Ramachandra University

2 years 10 months of experience in Healthcare industry.

Dr.RamManoharLohiaHospital:JuniorResident

• Helpedorganize‘WoundCon2009’and‘WorldKidney Day’

Public Health Foundation of India: Intern

• Assistedseniorstaffincarryingoutresearchactivities

• UndertookastudyontheAarogyasrischemetounderstandtheutilityofsuch schemes in future

Pushpanjali Medical Centre Heart and Trauma Hospital: Resident Medical Officer

• Undertooktheinitiativeofreducingbillingtimeby50%

Dr. Ram Manohar Lohia Hospital: Intern

• Exposuretoruralaspectofhealthservicesthroughthreemonthsruralposting

• Activeparticipantinthenationalpulsepolioeradicationcampaign

Mayank Bharat

English, Hindi

Dual Degree - M.Tech. (Mechanical Engineering), IIT Madras

2 years 9 months of experience in FMCG industry.

ITC Ltd.: Maintenance Incharge

• Partofmanagementteamtoplanandnegotiatethe long-term agreement with labour union

• CapitalexpenditureplanningworthINR830million

• Led17Technicianstoincreaseplantproductivityby25%

ITC Ltd.: Project Engineer

• Improvedoperationsandmaintenancesystemsoftwonichetobaccoprocessing lines with focus on labor productivity and capacity planning

• LedSixSigmaprojecttoimproveoverallproductqualitygainsworthINR3million

• WorkedonINR2100milliongreenfieldtobaccoprocessingproject

Mayank Sharma

English, Hindi, Tamil, Spanish

B.Com. (Hons.), Lady Shri Ram College for Women, University of Delhi

2 years 10 months of experience in Consulting industry.

Ernst & Young: Analyst

• Led15memberteamtoachieveINR6millioncost saving, through supply chain efficiencies, for a INR 7 billion company

• ConductedINR4millionmarket-studyforaFortune500company

• InitiatedE&Y’sfirstpro-bonoconsultingengagement

Bank of America: Project Trainee

• IndependentlyhandledaUSD70millionletterofcreditaccount

• LedateamoffourtocentralisetradefinanceoperationsinChennai

KJJohn&Co:ResearchAnalyst

• Recommendedreleventcaselawstosupportcounselsinpreparingargument

Meenakshi Ganesh

Page 51: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

100 101

English, Hindi, Kannada

B.Tech.(Hons.)(ComputerScience),NITJamshedpur

3 years 9 months of experience in IT (Services) industry.

MindTree Ltd.: Associate

• Co-ordinatedwithteamsfromEurope,USandAsia, managing global purchasing applications for an

automobile manufacturer

• Initiatedapplicationperformanceimprovementandachievedcostreductions

• Mainframecommunitychampion;organisedknowledgesharingsessionsfor250 members

Cognizant Technology Solutions: Programmer Analyst

• Leda7-memberteamtodesignandimplementhealthcareenterprisecapitation modules

• Analysedandautomatedbusinessprocessesreducingeffortsby35%

• Adjudged‘BestPerformer’forcontributionstofinanceandhealthcareverticals

Megha Yethadka

English, Hindi, Bengali

CA, ICAI

B.Com. (Hons.), Shri Ram College of Commerce, University of Delhi

1 year of experience in Investment Management industry.

JaiMaaVinimayPvt.Ltd.:Director

• Identifiedandanalysedinvestmentopportunitiesinequitymarketsandformulated investment strategies

• Expertinvestorinopportunitieslikeopenofferanddelisting

• ManagedaninvestmentportfolioofapproximatelyINR100million

• Earned36%returnfortheportfolioin2009-10

• ExtensivelyinteractedwithSEBIandmerchantbankersinrelationtoinvestmentsand the laws governing situations like open offer and delisting

Mehul Choudhary

English, Hindi, Gujarati

CA, ICAI

CS, Institute of Company Secretaries of India

B.Com., Narsee Monjee College of Commerce & Economics, University of Mumbai

2 years 3 months of experience in Investment Banking industry.

Classic Stripes Ltd. (ASTARC Group): Analyst

• Preparedentrystrategyandbusinessmodelfornewbusinessline(fleetgraphics)of existing company

• Preparedbusinessmodelfor1320MWpowerplant

Yes Bank Ltd.: Associate

• Preparedfirstrealestatemodeloftheinvestmentbankingteam

• Negotiatedtermsheetsfor2prospectiveinvestments

• Preparedfinancialmodelsandinvestorpitchesacrossindustries(education,OOH, realestateandmobileVAS)

• Unearthedfraudsin3branchaudits

Mihir Shailesh Kamdar

English, Hindi, Bengali, Punjabi, Marathi

B.Des. (Fashion Design), NIFT Delhi

2 years 8 months of experience in Textiles and Apparel industry.

Technopak Advisors Pvt. Ltd.: Associate Consultant

• Marketingservices:Representationforbusiness development for a globally renowned fashion forecasting service in the Indian sub-continent

• Travelandmallretailstrategy,involvingbrandportfoliodevelopment,performance management and market research

V.F.ArvindBrandsPvt.Ltd.:Designer

• Productdevelopment,womenswear,Wrangler:Trendforecasting,line conceptualisation, graphics and silhouette design

• Marketingactivities:Assistanceintakingforwardthedevelopmentofmarketing material such as catalogues, line books, photoshoots and fashion shows

Mili Kapoor

English, Hindi, Telugu

MS(Telecommunications),JamesClarkSchoolofEngineering, University of Maryland, College Park

B.E. (Electronics and Telecommunications), Cummins College of Engineering for Girls, University of Pune

2 years 10 months of experience in Telecommunications industry.

IBM (India) Pvt. Ltd.: Package Solution Consultant

• Developed3modulesofthetelecomclientsextensivecallcentreapplication

Tech Mahindra (Formerly Mahindra British Telecom): Technical Associate

• Led2releasesforthequalitycontrolofamobiletelecomoperator’ssalesforce application

• Assignedteamleaderrolewith2yearsexperience,againstthe3-4yearrequirement

• Undertookprojectmanagementandbudgetaryresponsibilities

Linkwell Telesystems: Research Associate

• Researchoninternationaltelecommunicationsunionmodemtransmissionstandards

• Implemented60%oftelecomtransmissionhardwareinsoftwarecode

Mitalee Mulpuru

English, Hindi

B.Tech. (Mechanical Engineering), IIT Guwahati

3 years 9 months of experience in Investment Banking industry.

Global Markets Centre, Deutsche Bank Group: Associate

• Structuredcreditproducts-involvedinnearly15deals ranging from USD 400 million to USD 2 billion

• HelpedDeutscheBanktoreduceexposuretonearlyUSD4billionofleveragedloans during recent credit crisis

• DevelopedmodelstoimplementS&P/Moody/Fitchcriteraforratingandpricing credit derivatives

Byte Consulting Pvt. Ltd.: Software Engineer

• Developedmodelsforidentifyingtradeopportunitiesandassessingcreditrisk

• Developedmunicipalbondtradingsystem

Mithilendu Kumar Jha

English, Hindi

B.E. (Computer Science & Engineering), Sapthagiri College ofEngineering,VisvesvarayaTechnologicalUniversity

3 years 6 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Technology Analyst

• Workedonproductionsupportofretailexecutionand production planning applications for Kraft foods

• LedKMsoftskillsandleadershipinitiativesfora600memberteam

• PresentedInfosys’workmethodologiesandKMinitiativestoseveralclients

• Performedtheroleofoffshoreteamlead

• TheKMteamIled,receivedInfosysExcellenceAwardsandBestPracticeAward from the client

• Received‘MsInnovator’award

Mrinalini Sinha

English, Hindi

B.E. (Computers), Nanyang Technological University

3 years 8 months of experience in Investment Banking industry.

CreditSuisseAG:AVPProductControl

• Ensuredtheintegrity,completenessandaccuracyof profit and loss and balance sheet for Asia-Pac equity

desk

• Performedindependentpriceverificationandmarketanalysisinadherencewiththe firm’s policies

• Involvedwithstrategicandcontinuousimprovementprojectsandoperation excellence initiatives

• DeployedproductcontrolfunctionsfromLondontoSingapore

• Designedandmanagedinductionprogrammesfornewjoinees

Mudita Chauhan

English, Hindi, Punjabi, Marathi

B.E.(Electronics&Telecommunications),VivekanandEducation Society’s Institute of Technology, University of Mumbai

2 years 8 months of experience in IT (Services) industry.

Accenture Services Pvt. Ltd.: Senior Programmer

• Workedonseverallargestrategicinitiativestoprovidebusinessintelligence solutions to US-based electronics retail giant

• AutomatedquarterlyPCI/SOXauditcomplianceprocessforretailclients

• Keyareas-applicationdesign,developmentandenhancement,onshore co-ordination and knowledge transition

• ‘ASEAchiever’sAward’forexcellenceinperformanceasabusinessoperatorand value creator

• LetterofappreciationfromMDforcommitmenttodevelopingpeopleatAccenture

Namrata Kohli

English, Hindi, Kannada, French

B.Com., Mount Carmel College for Women, Bangalore University

2 years 10 months of experience in Consulting industry.

KPMG: Business Executive - Risk Advisory Services

• Providedindustry-tailoredsolutionssuchasbusiness process re-engineering, internal audits and model business processes

• Re-engineeredHRfunctionsofaleadingmultinationalITsolutionprovider’sIndian operations

• ObtainedrepeatengagementsforKPMGbasedonworkperformedatvariousclients

• SelectedbyExecutiveDirectorofKPMGforbusinessdevelopmentinitiatives

• Coachedandsupervisedjuniorteammembers

Namratha Jagadish

English, Hindi

B.E. (Communications), Main Campus, Purdue University

3 years of experience in Manufacturing and Financial Services industry.

Zenith Forge Pvt. Ltd.: Procurement Manager

• Materialsprocurementandmanagement

Halcyon Resources and Management Pvt. Ltd.: Analyst

• Partoftheinvestmentteamthatanalysedandresearchedprospectiveinvestment opportunities

• Didindustryandcompanyspecificresearchonavarietyofsectors

Trading Technologies: Associate Quality Engineer

• Createdautomatedtestcasesusinginternalautomationsoftware

• SoloprojectwithXetra

Natasha Sood

English, Hindi

B.Tech. (Mechanical Engineering), IIT Delhi

3 years 9 months of experience in Engineering industry.

Applied Materials: Technical Leader - Mechanical

• Providedautomationsolutionsforsolarcelland semiconductor manufacturing

• FiledUSpatentforgripperdesignforhandlingultrathinsolarsiliconwafers

• Technicalpaperselectedforpresentationatannualinternationalemerging technology conference amongst top 350 papers selected globally

Navdeep Gupta

Page 52: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

102 103

English, Hindi, Punjabi

BBA(Finance),JIMS,GGSIndraprasthaUniversity

3 years 9 months of experience in Financial Services industry.

Capital IQ Inc.: Senior Research Associate

• Researchedpublicofferingtransactions

• Establishedandledthenon-USandnon-English coverage processes

• Standardisedresearchguidelines

• Becametheprocesstrainerwithin10monthsofjoining

• Performedqualityanalysisandmentoredsubordinates

• Trainednewrecruits

PNB Principal Financial Planners Pvt. Ltd.: Relationship Assistant

• Sourcednewclientsformutualfundsandbonds

• Maintainedclientsportfolios.

• Recordedhighestsalesintheteam.

• Initiatedthe‘RotaryClubProject’thatsubstantiallyincreasedsales

• Mentoredmycolleaguesoncommunicationskills

Navendu P Dogra

English, Hindi

MS (Pharmacology), Medical School, University of Minnesota - Twin Cities

B.Pharm. (Pharmaceutical Science), Institute of Chemical Technology, University of Mumbai

3 years 2 months of experience in Pharmaceuticals industry.

Genentech Inc.: Research Associate

• Businessdevelopmentforlargeproteintherapeutics

• Regulatoryfilings(US,CanadaandEU)

• Pre-clinicalandclinicaltrialPK-PD

• Peerreviewedjournalpublications

• LaunchedmultipleUSFDAcompliantapplications

Colgate Palmolive (India) Ltd.: Research Assistant

• Independentresearchonclinicalsimulations

• Globalcompetitiveanalysisinareaoffabriccareandoralcare

Express Pharma Pulse and Express Healthcare Management: Sub-Editor and Reporter

• Industryspecificscientificarticles

• LiaisonwithleadersinthehealthcareIndustry

• Shortesttimetofrontpageon‘ExpressHealthcareManagement’

Navneet J Sharma

English, Hindi, Telugu, Tamil

B.E. (Hons.) (Electronics and Instrumentation), BITS Pilani

2 years 9 months of experience in Telecommunications industry.

Cisco Systems Inc.: Software Engineer

• R&DforOperationsAdministrationandManagement (OAM) on ethernet networks on a USD 10 million project

• ResearchanddevelopmentinethernettechnologyonCiscoproducts

• HandledcustomercasesinvolvingdirectinteractionwithCiscocustomersspread across different geographies

• SoleownershipofaCiscoproductcomponentwithin1styearatCisco

• RepresentedtheBUatTechShow2007

Neeharika Chenna

English, Hindi

Post Graduate Program in Broadcast Management, MICA Ahmedabad

B.A. (Economics), St. Xavier’s College, University of Mumbai

3 years 7 months of experience in Media industry.

NDTVMedia:SeniorExecutive,Sales

• ManagedadsalesforNDTV24x7withannualtargetofINR130millionfor2009

• ClientrelationshipmanagerforHUL,Loreal,PepsiandBSNLformorethanayear each

• Handledsponsorshipfortelevisedeventssuchas‘NDTVIndianoftheYear’

• Achieved100%salestargetsforthreeconsecutiveyears

• Awardedtwopromotionsinoneyear

Neeti Mishra

English, Hindi, Punjabi

B.E. (Production Engineering), Punjab Engineering College, Chandigarh

2 years 8 months of experience in IT (Services) industry.

Accenture Services Pvt. Ltd.: Analyst Programmer

• Involvedinrequirementgathering,highleveldesign and functional design - technical design transition at onsite

• Definedtestingobjectivesforsuccessoftheprogramme,mobilisedteam

• Responsibleforproductionandownershipofhighqualitytestdeliverables

• Teamleadofassemblytestteamatoffshoreforallprojectreleases

• Associatesoftwareengineer-achieversawardforexceptionalperformance

Neha Khurana

English, Hindi

B.Tech. (Mechanical Engineering), NIT Allahabad

2 years 9 months of experience in Energy industry.

Schlumberger: Mechanical Engineer

• MemberofteamthatestablishedSchlumberger TechnicalServicesIndia(STSI)inIndia;responsiblefor defining and implementing organisational vision and

goals

• Responsibleforbuilding,trainingandsupervisingteamofengineersworkingon equipment design for first Singapore clients of STSI

• ProjectmanagerforoilwellservicesequipmentofUSD1million

• Servedas‘SiteSecurityOfficer’forinformationsecurityofSchlumberger,Pune

Neha

English, Hindi

CA, ICAI

B.Com.,SriVenkateswaraCollege,UniversityofDelhi

1 year 9 months of experience in Financial Services industry.

BSR & Company (KPMG): Assistant Manager, Assurance

• Providedqualityservicestoclientsindiverseindustries by ensuring compliance with accounting and auditing standards

• LedauditteamsforproperexecutionandcompletionofIFRS,USGAAP,SOX, statutory and tax audits

• Builtrelationshipswithkeyclientcontacts

• Ratedanexceptionalperformer,inthetop10%ofthecompany

• KeyresourceinprovidingauditservicestoSEClistedclient

Nidhi Batra

English, Hindi

BS (Computer Science), Purdue University

3 years 2 months of experience in Telecommunications & Financial Services industry.

Starent Networks (India) Pvt. Ltd. (now part of Cisco): Program Manager

• LedthereleasemanagementforGGSN,InTracerand TTG products

• Workedwithcustomerandproductstrategyteams

• Awarded‘EmployeeoftheMonth’twice

Citigroup,Jacksonville:ProjectManager

• Ledplanninganddevelopmentactivitiesfor‘OneCitiView’softwarereleasestotalling 100,000 manhours of work

• Reducedcriticalcustomerissuesby15%incitibusinesscards

• SpearheadedcreationofasupportsystemforNorthAmericanemployeesto enhance telecommuting

Nikhil Alok Goenka

English, Hindi

B.Tech.(ElectricalEngineering),JSSAcademyofTechnicalEducation, Uttar Pradesh Technical University

3 years 10 months of experience in Consulting industry.

The Corporate Executive Board: Senior Research Analyst, Technology Practice

• Developedstrategicresearchproductsthatprovidedguidancetoaclient-baseof 600+PMOandapplicationsexecutives

• Co-authored3books,whitepapers,andwebinarsontopPMOmanagement- specific issues, including EPMOs, stakeholder management, agile methodologies, and project business outcomes

• Receivedfirm-wide‘OutstandingContributiontoSocialService’awardforleadinga pro-bono consulting engagement at Delhi-based NGO, Khoj Foundation

Nikhil Gupta

English, Hindi

B.Tech. (Hons.) (Computer Science), International Institute of Information Technology

2 years 11 months of experience in IT (Products) industry.

Amazon Development Center (India) Pvt. Ltd.: Software Development Engineer II

• DesignedtechnicalsolutionstoavarietyofbusinessproblemsinAmazon’s worldwide customer service space

• StandardisedtheCSprocessoftransferringcustomercontactsresultinginannual savings of USD 744,700

• Mentoredpeersacrossdifferentsites

• Receivedcustomerobsessionawardfortakinginitiativeandreducingsearchlatency in internal applications

• Honouredforpresentingtechnicalpaper‘WizardasaRuleEngine’atAmazon Developer Conference ‘09

Nikita Pandey

English, Hindi

CA, ICAI

B.Com., H R College of Commerce & Economics, University of Mumbai

1 year 9 months of experience in Consulting industry.

IK Oils: Director - Operations and Commercial

• PreparedtheproductionplanforrefineryunitofaINR1billioncompany

• Identifiedopportunitiestoincreasetheturnoverbycreatingbetterdistributor channels

• SetupaB2Bmarketingplantoorganisedretailchains

• Ledateamof50employees

Ernst & Young: Consultant

• Identifiedfavourabletaxjurisdictionsforcompanies

• Partofthecoreteamtoadviseoninternationalacquisitiondeals

Nirav Shah

English, Hindi

B.Tech. (Mining Engineering), ISM Dhanbad

3 years 10 months of experience in Energy/ Extractive Minerals industry.

HindustanZincLtd.(VedantaResourcesPlc.):AssociateManager - Commercial

• HandledannualsalesofUSD250millionto9Asian countries

• Ledmarketshareimprovementfrom4.5%to23%within2years

• Wontheprestigious‘StarofBusiness’award

• Handledprocurement,worthUSD30million,ofcommodities,specialitychemicals, OTR tyres and equipments

• DeliveredannualisedsavingsofUSD3.6millioninprocurement

• Playedkeyroleinfeasibilityassessmentforrailtransportofacid,afirstforIndia

Nishchay Chadha

Page 53: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

104 105

English, Hindi, Bengali

B.Tech. and M.Tech. (Mechanical), IIT Kharagpur

3 years 7 months of experience in Consumer Products industry.

ITC Ltd.: Assistant Manager - Technical (Haridwar)

• Partofthe3-memberteamresponsibleforstartingand stabilisingITC’sonlyownedbiscuitfactory(90%+

efficiencies)

• Headofengineering,leading8managersand22workmen

• WorkedonchangeoverofbiscuitSKUsfromstandardpacketsizestonewdeclared sizes to increase contribution

• Technologyevaluationandassessmentforallprojectsatplant

• Energyaudit-reducedconsumptionofpowerby20%andfuelby8%

Nitin Mohta

English, Hindi

B.E. (Hons.) (Electronics & Communication), Delhi College of Engineering, University of Delhi

3 years 9 months of experience in IT (Products) industry.

LearnBiz Simulations LLP: Co-Founder & Designated Partner

• Designedanddevelopedcomputer-runintellectualbusinesssimulationsand software applications

• Handledothertechnicalaspectsforsmoothfunctioningoftheventure

Motorola (India) Pvt. Ltd.: Software Engineer

• EngineeredthedesignanddevelopmentofWindowsMobileSmartPhoneswhich involvedstintsinNewJerseyoffice

• Ledtheprocessforsuccessfulfunctioningofthephone’skeypadandRILdriver

• CollaboratedwithMotorola’sUS,ChinaandLatinAmericateamsforthe development of Q-Series SmartPhones

• Mentoredandhelpedthe‘on-boarding’ofnewrecruits

Nivesh Seth

English ,Hindi

B.Tech. (Hons.) (Mechanical Engineering), IT-BHU

2 years 10 months of experience in Consumer Products industry.

Hindustan Unilever Ltd.: Production Manager - Toothpaste Plant

• Ledateamof7executivesand243workmenatHUL’s biggesttoothpasteplant;annualcapacityof16000tonsandturnoverofINR4billion

• Ledinitiativestoreduceplantconversioncostby20%anddeliveredsavingsof INR 30 million

• Delivered70%improvementinqualityatdepotlevel&5%increaseinproductivity

• Youngestleaderofmaterialwastagereductionteamacross8globaloralfactoriesin Unilever

Pankhuri Sakhuja

English, Hindi

B.Tech. (Electronics & Communication), Malaviya National InstituteofTechnology,Jaipur

2 years 9 months of experience in IT (Services) industry.

Tata Consultancy Services Ltd.: Assistant Systems Engineer

• Moduleleaderintheretaildomain

• Suggestedmethodsasabusinessanalysttooptimisetheclient’s(USretailmajor) inventory and thereby reduce operational cost by 2-3%

• Improvedtheperformanceofdataminingoperationsby50%

• Developedaworkforcemanagementsystemthatimprovedtheutilisationof manpower by 3%

Parul Jindal

English, Hindi

B.E. (Computer Science & Engineering), CMRIT, VisvesvarayaTechnologicalUniversity

3 years 9 months of experience in Electronics industry.

National Instruments India: Training and Services Manager India

• Grewservicesrevenue-training,certification,H/WandS/Wservicesby40%to INR 35 million

• IncreasednumberofNIcertifiedengineersto500in2009

National Instruments India: Technical Sales Consultant Lead

• LedateamtomanagetransactionalbusinessforUSD6.6millionSouth-Westregion (30% of NI revenue)

• WorkedwithOEM/VARSandthetopaccountsinthedefence,aerospaceand automation segments

• RecordedthehighestindividualannualsalesofINR45million

English, Hindi

B.Tech. (Electronics and Communications), NIT Kurukshetra

3 years 9 months of experience in IT (Services) industry.

IBM India: System Engineer

• Designed,developedandimplementedretail management modules to facilitate in-store sales, service

and activation for a major US mobile phone services provider

• Leda7memberdevelopmentteamfortheordermanagementsystemofalarge telecom company

• Nominatedforthe‘TopTalentProgramme’byVP&GM,GlobalDelivery,IBMIndia

• Wonthe‘BravoAward’foroutstandingcontributiontoprojectsandclientdelivery excellence

Pearl Jain

English, Hindi

B.Tech. (Hons.) (Electrical & Electronics), IT-BHU

3 years 9 months of experience in Telecommunications industry.

Samsung India Software operations: Senior Software Engineer - 2

• OutstandingcontributionawardforUSD50million Linux mobile platform project leading 300 professionals

• Ledglobalteam(120developers)forUSD20millionJVprojectbetweenVodafone and Samsung

• Businesscontributionawardforleading3projectswith35professionals

• StarPerformerAwardforoverallcontribution

Arada Systems Pvt. Ltd.: Member of Technical Staff (MTA) - Embedded Systems Engineer

• 5StarPerformerAwardfordesignanddevelopmentofUSD2millionAREProject

• Deployedbusinessprocessesfacilitating80%defectclosuresaving35%manhours

Piyush Singh

English, Hindi, Tamil

B.E. (Computer Science), BSA Crescent Engineering College, Anna University

3 years 10 months of experience in IT (Products) industry.

Oracle India Pvt. Ltd.: Senior Applications Engineer

• WorkedondevelopmentofCRMquotamanagement in fusion suite

• Handledqualityandbugtriagingfortheproductdevelopmentteam

• Leddivisionwideinitiativesforbringingstandardsinproductdevelopment

• Solepointofcontactforexternaldevelopmentandprojectmanagementteams

• Receivedtwopromotionsinthreeyears

Infosys Technologies Ltd.: Software Engineer

• ReceivedtrainingatInfosysMysoreandselectedforretailvertical

Prabhu Ramadas

English, Hindi

B.E. (Electrical & Computer Engineering), Georgia Institute of Technology

3 years 1 month of experience in High Technology and Development industry.

World Possible: Co-Founder, Chairman & CEO

• Designandlead,greencommunitycenterdevelopment

• AdvisortoMinistryofEducation,Oman,EthiopiaandSierraLeoneforICT infrastructure

• Developedstand-alonelowcosteducationserversforEthiopia,SierraLeone,India, and New Guinea

Cisco Systems Inc.: Design and Development Engineer

• DesignedthenextgenerationCisco3Kswitch

• EstablishedbesthardwaredesignpracticestherebysavingUSD175millioninannual engineering re-spins

• ManageproductrevenuestreamofUSD1billion

Pranav Rastogi

English, Hindi, Telugu

B.Tech. (Mechanical), NIT Warangal

2 years 7 months of experience in Manufacturing industry.

Larsen & Toubro Ltd.: Senior Engineer

• PlayedkeyroleinlaunchingIndia’sfirstnuclear- submarine, INS Arihant

• Productionin-chargeforintegrationandsettingtoworkthemainhydraulicsand torpedo, missile systems

• Designedandcommissionedhigh-pressuredecontaminationplantsforsubmarines for first time in India

• Developed200indigenisedproceduresforsubmarineoutfittingandsystem integration, saving INR 50 million

• Workedonmarinebusinessdevelopment-marketstudiesandcollaboration exploration with European companies

Prasanthy Gurugubelli

English, Hindi

B.E. (Environmental Engineering), Delhi College of Engineering, University of Delhi

2 years 9 months of experience Business Research and Consulting industry.

The Smart Cube: Assistant Manager

• Ledteamsinthestrategicservicesgrouptodeliver projects to clients across diverse industries

• Assessedmarketopportunitiesinnichemarkets,suchasbiometrics,microstock photography, and e-governance, for Fortune 500 companies

• ConductedskillenhancementtrainingsforIndianandRomaniananalysts

• Developedprototypeofproductbenchmarkingvendorsforclients;initiateda knowledge management solution

• ReceivedOutstandingAchievementAward(2009)andGoldenCubeAward(2008)

Pratibha Vaishnavi

English, Hindi, French

BBS, College of Business Studies, University of Delhi

2 years 8 months of experience in Consulting industry.

McKinsey Knowledge Centre: Research Analyst

• Workedwithhealthcare,consumergoodsandretail clients

• Developedacustomisedanalyticalmodelforanexpansionstrategyforaleading pharmaceutical company

• Conductedextensiveresearchtoimproveprimaryhealthcaredeliveryinlow-income countries

• LedtheformationofadedicatedresearchteamfortheSouthAfricaofficeinIndia

• Designedskillenhancementworkshopsforovera100colleagues

• Recipientofthe‘SuperContributionAward’

Preeti KumarPayal Bhuptani

Page 54: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

106 107

English, Hindi

B.A. (Hons.) (Economics), Delhi College of Arts & Commerce, University of Delhi

3 years 9 months of experience in Financial Services industry.

Capital IQ Inc.: Senior Research Associate

• Led2teams(15members)forresearchonprivate equity firms for iBanking clients

• Introducednewdatasets-sovereignwealthfundandshariahfunds

• Designedandimplementednewworkflowprocessesthatensuredfasterdata delivery to clients and reduced manpower requirement

• Authoredguidelinedocumentsfollowedbyglobalresearchteams

• Createdawikiusedbyclientsupportteamsinglobalofficestoresolveclientqueries

Prerak Bhatia

English, Hindi

B.Tech. (Chemical Engineering), IIT Kanpur

3 years 9 months of experience in Chemicals industry.

JohnsonMattheyChemicals(I)Pvt.Ltd.:ProcessEngineer

• Threeyearsofexperienceasprocessengineerin syngas and GTL industry

• LedintroductionofbreakthroughmethonolconvertercatalystsinAPAC

• LedintroductionoffuelcellbusinessinIndiaandacquiredfirstcustomeratINR5 million

• Reductionincustomerresponsetimeby20%byoptimisationoftasks/processes

• Workedoncustomeranalyticsandtargetingstrategies

Evalueserve.Com Pvt. Ltd.: Research Associate, Intellectual Property

• Workedonpatentdraftingandinvalidationsearches

Prerna Singh

English, Hindi, Maithili

Bachelor of Fashion Technology, Apparel Production, NIFT Bangalore

2 years 10 months of experience in Apparel and Retail industry.

Madura Garments, A division of Aditya Birla Nuvo Ltd.: Assistant Manager-Retail Buying and Merchandising

• Handled35exclusivebrandoutletsacrossSouthandEastregion

• 110%achievementoftargetedsalesandprofitsfor2consecutiveyears

• Turnedaround4stores,fromdegrowthto40%growth

• Managed12newstoreopenings

Lifestyle International Pvt. Ltd. - MAX Retail Division: Regional Retail Planner

• Enhancedsalesthroughmerchandise/spaceplanningforstoresinSouthIndia

• Strengthenedwomenswearcategory,increasedsalesatfullpriceto80%oftotal sales

• AwardedA+ratingtwiceinayear

Priyanka Mishra

English, Hindi

CFA, Cleared Level I, CFA Institute, USA

B.E.(InformationTechnology),DJSCollegeofEngineering,University of Mumbai

3 years 2 months of experience in Financial Services industry.

Citigate Dewe Rogerson: Executive

• Preparedreportsonmarketperception,shareholding,stockupdate,peerreview

• Preparedcorporatepresentations,businessreports,pressreleases

• Salespitchtoprospectiveclientsformanagingtheirinvestorrelations

IDBI Capital Markets Ltd.: Research Analyst

• Technicalresearchonsecondarymarket

• Macroeconomicanalysis

• Introducedmutualfunddistributionbusinessin25branchesofIDBICapital

Mastek Ltd.: Software Engineer

• Consultedprojectstoimproveefficiencyofapplications

• Deliveredtrainingto250peopleondatabasetuning

Priyanka Baxi

English, Hindi

B.Sc. (Statistics), Hindu College, University of Delhi

2 years 10 months of experience in Consulting industry.

McKinsey Knowledge Centre: Analyst

• Ledtheanalyticsworkstreamonconsultingprojects across the globe

• HandledmultipleclientsinSingaporeonvariousITandbankingprojects

• Providedmentorship/coachingtonewrecruits

• Awarded‘Tracking+’rankingtwice(receivedbytheteam’stop5%)

• Builtteamcapabilityinnichedomainsthroughtrainings,trainingmodulescovered 15-20 people at a time

• WorkedinmultiplelocationsinIndiaandSingapore

Priyanka Malik

English, Hindi, Bengali

PG Diploma in Pharmaceutical Management, Narsee Monjee Institute of Management Studies

B.Pharm.,JamiaHamdard,Delhi

3 years 11 months of experience in Consulting and KPO industry.

McKinsey Knowledge Centre: Senior Research Analyst

• Specialistmemberofconsultingteamduringstudiesandclientinteractions

• Fulfillingresearchforhealthcareclients

• Codifyingknowledgeintopracticedocuments

• BronzeMedalwinnerattheGlobalKnowledgeOlympics,USA2008

ORG-IMS Research Pvt. Ltd.: Executive

• Servicinginformationrequirementsforclientsinhealthcare

• Creatingcorporatepresentationsforclientmarketingteams

• Trainingclientsondeliveryplatformsandsoftwaresfordataanalysis

• Firstjuniorexecutiveinvitedtotopmanagement’shalfyearlystrategicconference

Priyanko Basu

English, Hindi, Tamil

CFA, Cleared Level I, CFA Institute, USA

B.E.(ComputerEngineering),VESIT,UniversityofMumbai

3 years 9 months of experience in Investment Banking industry.

Nomura Services India Pvt. Ltd.: Developer

• Single-handedlytransitionedanop-riskapplicationto India operations

• Enhancedop-riskapplicationfornewhierarchicalstructureofacquiringcompany and drill downs

• CollaboratedwithIndiariskmanagerstogo-liveonmarketriskapplicationfor primary dealership business

Lehman Brothers Ltd.: Developer

• ImplementedregulatorycompliancereportresultinginUSD1billionsavings

• AutomatedM&Adealcapturinginthefirm’smarketriskmanagementsystem

Raghuram Ananthasayana

English, Hindi, Telugu

BS (Business Administration), California State University, Pomona

2 years 9 months of experience in Financial Services industry.

PricewaterhouseCoopers: Senior Analyst (Corporate Finance & Investment Banking)

• Workedonengagementsinvolvingprivateequityplacement(realestatesector)

• Scopeofwork-informationmemorandum,financialprojections,investor identification, transaction structuring

• IdentifiedstrategicpartnersforFairmont’sentryintoSouthIndia(hospitality transaction) and syndicated private equity (USD 12 million)

• ExecutedUSD60millionequityinvestmentintoarealestatedevelopmentin Bangalore

• USD10millionequityinvestmentintoTeleDNAcommunicationsbyPeepulCapital

Raghuveer Veeramachaneni

English, Hindi

BS (Entrepreneurship & Economics), Babson College, Wellesley, Massachusetts

3 years 4 months of experience in Media industry.

ADI Media Pvt. Ltd.: Business Unit Head (Healthcare & Telecom)

• Responsibleforbusinessandprocessdevelopment for ADI Media (a business information vendor in B2B segment in healthcare, telecom, consumer electronics and broadcast domains)

• Transformedaprint-intensivebusinesstoabroadbasedmediabusiness

• Doubledthehealthcarebusinessintwoyearsandgrewthetelecombusinessby40%

• Controllededitorialcontentandbuiltpan-Indiareadership

• Managedandexpandedrelationshipswithvendorpartners

Rahul Arora

English, Hindi

B.Tech. (Computer Science), IIT Roorkee

3 years 9 months of experience in IT (Products) industry.

Amazon.com: Software Development Engineer

• Managedprojectschedulinganddependenciesacross internal teams

• Ownershipofthedesign,developmentandreleaseofproductfeatures

Trilogy E-Business Software (India) Pvt. Ltd.: Senior Technical Associate

• Consultingwithclients,providingcustomisedsolutionsforbusinessrequirements

• GeneratednewrevenuestreamsworthUSD6millionbymigratingclient’s compensation systems onto Trilogy’s products

• Ratedannualtopperformerin2008forensuring‘customersuccess’forcompany’s biggest financial domain client

• Executedprojectsinvolvingcollaborationwithcross-functionalteams

Rahul Jain

English, Hindi

MS (Financial Economics), Said Business School, University of Oxford

B.A. (Hons.), Shri Ram College of Commerce, University of Delhi

3 years 2 months of experience in Financial Services industry.

Ernst & Young India Pvt. Ltd.: Analyst (Transaction Advisory Services)

• Identifyingpotentialtargets,preparingpitchesandinformationmemoranda

• Preparingbusinessplansandcarryingoutcompanyvaluations

• IntegralmemberofteamadvisingModernDairiesonraisingfundsfromIFC

• IntegralmemberofteamadvisingSercoGroup’sUSD40millionacquisitionof InfoVisionBPO

• Advisedatelecomoperatoron3Glicensebiddingandalistededucationalservices firm raising funds

Rahul Malik

English, Hindi

B.Tech. (Ocean Engineering & Naval Architecture), IIT Kharagpur

3 years 5 months of experience in Investment Banking & Consulting industry.

SBI Capital Markets Ltd.: Deputy Manager (Project Appraisal & Structured Finance)

• Preparationofprojectinformationmemorandumandraisingfundsforinfrastructure projects (ports, power plants and coal mines)

• Achievedfinancialclosureof4debtsyndicationassignmentswithcombineddeal- size of over INR 25 billion

• WorkedonGopalpur,MumbaiandSalayaPortprojects

i-maritime Consultancy Pvt. Ltd.: Consultant

• Preparationofbusinessplans,entrystrategiesandtechno-commercialfeasibility studies for development of projects in maritime infrastructure domain

• ExecutedthefirstinternationalprojectofourcompanyinAfrica

Rahul Prasad

Page 55: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

108 109

English, Hindi

B.Tech. and M.Tech. (Chemical Engineering), IIT Delhi

2 years 9 months of experience in Consulting industry.

McKinsey and Company: Business Analyst

• Workedonmarketentryandgrowthstrategies,sales and marketing transformation projects, strategic due

diligence and M&A across telecom, food products, chemicals and contract research industries

• RatedamongthetoptwobusinessanalystsatMcKinsey

Rajat Agarwal

English, Hindi, Tamil, Gujarati, Malayalam

B.Tech. (Electrical and Electronics), NIT Trichy

2 years 9 months of experience in IT (Services) industry.

J235SoftwareIndiaPvt.Ltd.:SoftwareEngineer

• Leadanoffshoreteamof6astheonsiteco-ordinator in Boston having worked in the areas of project

planning and estimation, requirements gathering, design, development, testing and deployment

• Asqualityauditor,auditedinternalengineeringprocessesbasedonCMMIlevel3/5 guidelines

• Workedonavarietyoftechnologiesandplatformshavingworkedonenterprise-level data migration, custom application development and ERP implementation

Rakesh Krishnan

English, Hindi, Telugu, Tamil

B.E. (Electronics & Communication), Madras Institute of Technology, Anna University

2 years 9 months of experience in High Technology/Electronics industry.

Nvidia Graphics Pvt. Ltd.: ASIC Design Engineer

• Developedautomationprocesstoreduceverification effort of each peripheral controller on the computer chip by 3 man-months

• Performedlogic(gate)leveltestingforthememorycontrollermoduleofa breakthrough chip that provided 5X improvement in graphics performance of Apple Mac Books

• Ledmigrationtonewmethodologythatreducedtimetomarketchipsby20%

• Presentedininternationalconferencesandconductedtrainingsessions

Ravitej Sriram

English, Hindi

B.Com. (Hons.), SRCC, University of Delhi

2 years 7 months of experience in Consulting industry.

Accenture: Analyst

• Executedmarketentrybusinessresearchand developed competitive market landscape for communication and hi-tech clients

• CreatedtradeexecutionblueprintforanFMCGmajorformoderntrade

• Workedonoptimalroutingplanforanairlinemajorinpostmergerscenariousing passenger data

• AttendedaglobaltraininginSpainwith200consultants

• Awardedthe‘AboveandBeyond’award

Ridhi Kumar

English, Hindi, Bengali

CA, ICAI

B.Com. (Hons.), SRCC, University of Delhi

1 year of experience in Investment Banking Industry.

Goldman Sachs: Analyst - Investment Banking

• HelpedaCanadianenergycompanyacquireanother oil and gas company for USD 5.5 billion and boost

production from prolific unconventional gas holdings

• AdvisedanAmericancoalcompanytosellitscokingcoalassetsforUSD568million to a Russian mining and metal company

• HelpedanAmericanenvironmentalandhazardouswastemanagementservices company to acquire a Canadian service provider for USD 380 million

Rishi Gupta

English, Hindi, Telugu, Tamil, Sign Language

B.E. (Electrical & Electronics Engineering), Chaitanya Bharathi Institute of Technology, Osmania University

2 years 7 months of experience in IT (Products) industry.

ThePrIncetonReview:VerbalFaculty

• Trained115studentsforGMATandGREexam

University of Wisconsin, Madison: Research Assistant

• WroteCprogramfunctionsforoptimalbusselectioninadistributednetworksystem

• TocreateadatabaseofnetworkIPaddressesandmaintainthem

• AwardedresearchscholarshipofUSD17,646

• CavinkareAbilityAward,2009

Infosys Technologies Ltd.: Software Engineer (Telecom domain)

• EnvironmentteamleadforthejointprojectforBritishTelecomwithTechMahindra and TCS

• ‘BestTraineeof2006batch’award

Sai Prasad

English, Hindi, French, Spanish

B.E. (Electronics and Communications), Thapar Institute of Engineering and Technology, Patiala

3 years 10 months of experience in IT/ ITES and Commodity Trading industry.

Sambhav Enterprises: Manager/ Partner

• BusinessManagementfor10memberyarn-trading company

• ManagedturnoverofINR30-40millionannually

• Personalisedclientengagementandremovedintermediaries

• Achieved28%revenuegrowth

LearningMate Solutions Pvt. Ltd.: Senior Business Analyst

• Workedone-learningproductsforglobalpublishers

• Workedonsalesproposalswithfeasibilityanalysis,effortandcostestimation

• AcquiredprojectsworthUSD500,000

• Awardedstarperformer

IBM (India) Pvt. Ltd.: Application Programmer

• ApplicationtestingonCRMforBhartiAirtel

• Teammemberforpan-IndiaCRMdeployment

Sambhav Jain

English, Hindi, Bengali, Assamese

B.Com. (Hons.), SRCC, University of Delhi

3 years 9 months of experience in Consulting industry.

KPMG India: Executive

• SpokespersonforGlobalGreenatKPMGInternational

• Implementedcarbonreductionsolutions

• Reducedcarbonfootprintby25%inKPMG

Make a Difference (MAD) Dilli: Founder and President

• Supervisedteamof52volunteersteaching120childrenat2shelterhomes

• AppointedVP(Finance)forMADIndia

• LiaisonedwithColtandIBMforfundraising

Ernst & Young India Pvt. Ltd.: Principal analyst

• DevelopedthebusinessplanforCommonwealthGames,2010

• ProjectleaderforfeasibilitystudyofDelhiVAT

• DevelopedenterpriseriskmanagementforCellTel

Samhita Das Sharma

English, Hindi, Bengali

B.Sc. (Hotel Managment), Institute of Hotel Management, National Council for Hotel Management and Catering Technology, IGNOU

3 years 9 months of experience in FMCG industry.

ITC Ltd.: Assistant Manager - Sales

• RelationshipmanagerforSouthMumbai(corporates and consulates) at The Maratha

• ResponsibleforliaisonwithHyderabad,PuneandKolkatamarketingofficesforThe Maratha

• CustodianforsalesforcetrackingandleadmanagementatTheMaratha

• ConfirmedandmanagedtheUBSInvestorMeetfor3consecutiveyears,with revenues worth INR 16.5 million

• ConfirmedandmanagedthecelebrityengagementofformerMissWorldYuktaa Mookhey

Samyajit Das

English, Hindi, Bengali

M.A. (Economics), Delhi School of Economics, University of Delhi

B.A. (Economics), St. Xavier’s College, University of Calcutta

3 years 9 months of experience in Financial Services industry.

Citi, GDM: Assistant Manager

• Developedoff-usspendestimationGLMmodel,recommendedforpatentinCiti

• DevelopedstrategytooptimisecapitalacrossCitiAPACbusinessestomaximiseROE

• ‘OutstandingPerformance’and‘PGDMProjectExcellence’awards

Inductis(India)Pvt.Ltd.:JuniorModeler

• AppliedsurvivalanalysisonaprojectforatopUSinsuranceplayertoestimate customer lifetime value which won ‘Annual Project Excellence’ and ‘Best IP Created’ awards

• Heldacompany-wideseminaronsurvivalanalysis

Sandeep Gupta

English, Hindi, Marathi, Spanish

MS (Electrical Engineering), Illinois Institute of Technology

B.E. (Electronics), Thadomal Shahani Engineering College, University of Mumbai

3 years 3 months of experience in Transportation & IT industry.

International Road Dynamics South Asia Pvt. Ltd.: Manager - Business Operations

• StreamliningoperationsinMaharashtraandGujaratledtorecoveryofreceivables worth INR 3 million over 5 months

• AcquirednewprojectsworthINR1.5million

• Contractmanagementturnedunprofitablecontractintoprofitforthecompany

• Competitivebenchmarkingofproductsandsolutions

Cintra Concesiones de Infraestructuras de Transporte S.A.: Project Engineer

• Planning,specificationandestimationofbidproposals

• Planning,procurementandinstallationoftollcollectionsystems

• NegotiatingwithITpartners

Motorola: Test Engineer - Contractor

• Mobiletelecomdevicetesting

Sandeep Salunkhe

English, Hindi, Marathi, Telugu, Spanish

B.E. (Electronics and Telecommunications), Fr. CRIT, University of Mumbai

2 years 4 months of experience in IT (Services) industry.

Mastek Ltd.: Executive - Project Management Office

• Ledinitiativestoreducethecostperresource, cost of quality, and productivity improvement which led to a cost reduction of USD 120,000

• Aidedimplementationofcentralisedonlinesystemforcustomerfeedback,resulting in 80% of customers giving feedback, as compared to 20% earlier

• FeaturedtwiceinMastekhalloffame

• Awardedmonthlyrecognitionawardthriceinarowfortopperformance

Sandhya Venkatesh Boyapati

Page 56: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

110 111

English, Hindi, Bengali

CA, ICAI

B.Com. (Hons.), St. Xavier’s College, University of Calcutta

3 years 8 months of experience in Financial Services industry.

PricewaterhouseCoopers: Assistant Manager

• Riskandcontrolsreviewacrossportfolioofclients including IBM and Infosys

• Clientrelationshipmanagement

• Directreportingresponsibilitytoseniorpartners

• ManagedaccountsreconstructionprojectinSudanforKenana,world’slargest integrated sugar company

• SecondmentwiththeUKoffice-financialauditsacrossindustrysegmentswith clientssuchasVolvo,AT&T,TNTandEon,recognitionawardbytheUKoffice

• Supervisionandcoachingofpeers

Satyajit Mallick

English, Hindi

B.Tech. (Information Technology), IIIT Allahabad

2 years 9 months of experience in IT (Products) industry.

Kuliza Technologies: Senior Developer & Manager

• PartofinitialteamforWeb2.0basedsocialmedia product LifeBlob

• Enhancedandextendedopensourcecontentmanagementsolutionsforanon-profit organisation

• SpearheadedknowledgebaseandapplicationdevelopmentonDjango

• Spearheadedtheefforttolaunchonlineportalforwebteamandcompanyrecruitment

• RecruitmentchampionatKuliza

• Specialrecognitionawardforcustomersuccess

Saumya Chandra

English, Hindi

Dual Degree - B.Sc. and M.Sc. (Exploration Geophysics), IIT Kharagpur

2 years 10 months of experience in IT (Services) and Infrastructure industry.

Bansal Highway Constructions: Partner

• Devisedstrategiesforverticalintegration

• Standardisedsub-contractsanddevisedincentivepackagesforcontractors

• Increasedrevenueby300%inoneyear

• Maintainedcompletefleetoperations

Headstrong Services India Pvt. Ltd.: Senior Associate

• Maintainedanddevelopedtradingapplications

• Waspartofthe‘Headstrong:TeamoftheYear-2008’

• Conducteddomaintrainingsessionsonbasicsoffinance,fixedincomeassetsand derivatives

Saurabh Jain

English, Hindi, French, Spanish

CFA Level II, CFA Institute, USA

B.Tech. (Hons.) (Metallurgical & Materials Engineering), IIT Kharagpur

3 years 8 months of experience in Investment Banking industry.

Credit Suisse: Quant Analyst

• Quantitativeequityresearchforstockselectionfor130/30products

• Developedamodeltopredicthardtoborrowstockswithapproximately70%hitratio

• Analysedspecialsituationtradesfortheproprietarydesk

• Pricingofcustomfundderivatives

TransMarket Group Research India Pvt. Ltd.: Associate

• Fixedincomederivativestrader

Saurabh Roy

English, Hindi, Kannada

B.E. (Information Technology), NIT Surathkal

3 years 9 months of experience in Financial Services industry.

Goldman Sachs Services Pvt. Ltd.: Analyst Developer (Private Wealth Management)

• ManagedtheITinfrastructuredevelopmentofrisk management for private banking Escrow services

• Ledtherisk-managementanalyticsprogrammeforwealthmanagementvertical, delivering the system ahead of schedule with 30% savings in project cost

• Votedamongtop3innovativeprojectsforconceptualisinganddevelopinga securities management system to detect sensitive trades, saving 2 hours of work per day for 440 analysts worldwide

Shailendra Hegde

English, Hindi

B.E. (Information Technology), Netaji Subhas Institute of Technology, University of Delhi

3 years 9 months of experience in IT (Services) industry.

Inductis (India) Pvt. Ltd.: Assistant Manager

• Createdascorecardtomeasureproductivityand identified improvement areas for customer service division of British Gas

• LedInductisteamascustomerinterfacetoBritishGasaccount

• Employeeofthequarterfortwosuccessivequarters

CSC India Pvt. Ltd.: Software Engineer

• Level2supportleadforanonlineinsurancestorefrontforaleadingUKInsuranceco.

Shailendra Nath Jha

English, Hindi

B.Tech. (Hons.) (Chemical Engineering), IIT Kharagpur

3 years 10 months of experience in Energy industry.

Schlumberger Asia Services Ltd.: Senior Field Engineer

• Preparedestimationandworkscheduleforturnkey drilling projects for various national and international clients

• Mobilisedprojectresourcesatdrillingsiteswithindifferentpartsofthecountry

• Monitoredprojectprogressandperformancegoals.Finalreportdeliverytoclienton achieved objectives

• Planandexecutewelltestingtoestablishreservoirperformance.Themain parameters include productivity, flowrate and composition etc. of the oil reservior

Shailesh Lohia

English, Hindi

B.Tech. (Chemical Technology), Institute of Chemical Technology, University of Mumbai

3 years 9 months of experience in Chemicals industry.

C-Tech Corporation: Senior Manager - International Business Development

• DevelopedinternationalmarketsforRodrepel®andTermirepel®products

• Exploredpotentialapplicationareasandtechnicallyassistedcustomersonnew product developments

• AssistedTEC,GovernmentofIndiainformulatingspecifications

• RepresentedC-Techatvariousinternationalforums

• SpearheadedtheCSRprojectofthecompany,‘FanalesIndia’;producedand exported hand-made wax shapes (German brand)

Atul Ltd.: Management Trainee

• Carriedoutproducttestings(chemicals)inlaboratory

• Technicallyassistedbulktrialsatcustomersend

Shalu Birbal Bhanwariya

English, Hindi

CFA, Cleared Level II, CFA Institute, USA

B.Tech. (Computer Science), IIT Mumbai

2 years 2 months of experience in Investment Banking industry.

UBS AG: IT Analyst

• Developedfront-officeinvestmentbankingapplications

• Developedtheweb-basedFXtradesettlementsystem

• AutomatedthesettlementofKoreaswaptrades

• Introducedchartingtothereportingengineforhedgefundclients

• Providedtechnicalsupporttobusiness

Shashvat Rai

English, Hindi

B.Tech. (Mechanical Engineering), IT-BHU

3 years 10 months of experience in Consumer Products industry.

Hindustan Unilever Ltd.: Project Engineering (Manager)

• ManagedprojectsworthINR1.2billion,settingupnew manufacturing units

• Designedfactories,handlinginternalteams,teamsofengineeringconsultants,and over 500 contractors

• DesignedandexecutedaINR700millionprojecttosetupengineeringinfrastructure in 8 HUL factories for a product innovation

• Leda6months,fast-trackedINR500millionprojectofsettingupanewdetergents factory

• ConceptualiseddesignofHUL’sbiggestcreams-lotionfactory

Shashwat Nigam

English, Hindi, Konkani, Portuguese

B.A. (Economics), St. Stephen’s College, University of Delhi

3 years 8 months of experience in Consulting industry.

Hay Consultants India Pvt. Ltd.: Associate Consultant

• Ledprojectdeliverymodulesandimplementation of change management initiatives

• Workedacrossthemanufacturing,realestate,steel,oil&gas,textileandtelecom sectors

• Assistedinsalesoflargeststrategyconsultingprojectworldwide

HDFC Ltd.: Officer Operations

• Ledasalesteam(11members)toachievehomeloantargets

• DisbursedhomeloansamountingtoINR540millionin14months

• AchievedhighestULIPsalesintheNCRRegion-INR1.2million

Shaun Nicholas Lobo

English, Hindi, Bengali

B.E. (Mechanical), PES Institute of Technology, VisvesvarayaTechnologicalUniversity

2 years 8 months of experience in Engineering industry.

Larsen & Toubro Ltd.: Senior Engineer - Sales

• Salesofconstructionandminingequipmentto Kolkata based customers

• Interfacewithfinancingcompaniesforsalesaidfinancingandmarketinformation

• AchievedsalesofINR120millionover20months

• Preparedfleetrecommendationprocessforcustomerswhichhassincebeen accepted by other territories

• ConductedmarketandproductstudiesfortheEasternregion

Sheshadri Mookherjee

Page 57: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

112 113

English, Hindi

B.E. (Information Technology), Netaji Subhas Institute of Technology, University of Delhi

2 years 9 months of experience in Consulting industry.

GRAIL Research: Associate

• Supportedmonitorconsultantsonvariousassignments that included market entry strategy, product positioning, and market segmentation

• Setupandoperatedanewcollaborativeteamstructuretoassistmonitor consultants, developed an effective online interface for client interaction during such assignments

• Managedteamsonthreeretaineraccountsthatwererecognisedforoutstanding client service

• Trainednewemployeesforanalystroles

Shikha Gupta

English, Hindi

B.Com. (Hons.), SRCC, University of Delhi

2 years 9 months of experience in Consulting industry.

Inductis (India) Pvt. Ltd.: Senior Financial Analyst

• Providedinvestmentrecommendationsbyconducting industry and company diligence

• Integralpartofbusinessdevelopment,formulatedstrategyforpitchingtonewclients

• Instrumentalinsteeringaprivateequityclientaccounttostablephase

• Mentored2newlyhiredseniorteam-membersonanindustryanalysisassignment

• CommendedbytheCEOofEXLforbuildingamarketingpitchforinsurance companies

Shikha Sharma

English, Hindi

BS (Computer Science), Texas A&M University

2 years 10 months of experience in IT (Products) industry.

Microsoft Corporation: Programme Manager II

• Ledthedesign,planning,developmentandreleaseof Microsoft Office Live’s first personalisation platform

• Integrated3rdpartyemailserviceprovider-receivedtheintegrationawardfrom email service provider

• Ownershipofsign-upforacompleterelease,andincreasedcustomerconversion by 30%

• Intop6%ofMicrosoftbusinessdivision-invitedtotechnicalleadership development programme

• Internprogrammeco-ordinatorandmentorforMicorosoftOfficeLive

Shilpa Shah

English, Hindi

B.A. (Economics), Ferguson College, University of Pune

2 years 9 months of experience in Internet Development Services industry.

Google India Pvt. Ltd.: AdWords Senior Representative

• OptimisedAdWordsaccountsforbetterrevenue recognition and improved RoI for clients

• Interfacedwithadvertiserstooffersolutionsfortheironlineadvertisingcampaigns

• AccomplishedaninternationalprojectatSiliconValley,undertakentoimprovereal- time client interaction and facilitate retention

• Nominatedandservedasa‘Productivitymentor’basedonhighproductivity

• Basedonqualityofwork,selectedtomentorpeersonacoreprocess

Shivani Sharma

English, Hindi, Bengali

B.Sc. (Computer Science), St. Xavier’s College, University of Calcutta

3 years 9 months of experience in Marketing & Advertising industry.

Google India Pvt. Ltd.: Account Associate

• ManagedGoogleAdWordsclientsinNorthAmerican retail and agency clients

• ManagedclientportfoliosthatgeneratedrevenueoverUSD11million

• Workedwithhighpotentialunresponsiveclientsduringrecessionwhichimproved their campaign RoI by 12%

Google India Pvt. Ltd.: Senior Representative

• WorkedonoptimisingAdWordcampaigns,improvedadqualityandproviding cutomer support

• LedaprojectthatimprovedGoogleAdWords’globalcustomersatisfactionby13%

Shubhadipa Sarkar

English, Hindi, Bengali

B.Tech. (Hons.), (Manufacturing Science and Engineering), IIT Kharagpur

2 years 9 months of experience in Energy industry.

Shell Technology India & Shell Global Solutions International, Netherlands (Royal Dutch Shell): Senior Associate Engineer - Mechanical and Lead Coordinator - Logistics Management & Sourcing

• InAmsterdam,supervisedEPCteams,performedefficiencyoptimisationandonsite commissioning exercises for key client refineries across Europe and Asia-Pacific

• Designedandimplementedthegloballogisticsandsupplychainforchemicalfeeds and capital equipments for Bangalore pilot plants, ensuring compliance with EXIM policies and EOU SEZ regulations

• Co-ordinatedwith10cross-functionalbusinessgroupsinShelltoexecutesourcing and maintenance contracts with major vendors

Shubhasish Chattoraj

English, Hindi, Kannada

B.E.(Telecommunication),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity

3 years 5 months of experience in Hospitality and IT (Services) industry.

ITC Ltd.: Lobby Manager

• Responsibleformanagingfrontofficeoperationsfor ITC Windsor

• IncreasedroomrevenuebyINR0.5millionthroughrelationshipmanagement

• Enhancedcustomerretentionandloyaltybyproactivelyseekingcustomerfeedback

• ImplementedbrandstandardsoftheITCWelcomgroupthroughrigoroustrainingof team members

Cognizant Technology Solutions: Programmer Analyst

• Coreteammemberofthepilotprojectthatacquiredanonlineretaileraccount

• Developedcodeandtestplansforanonlineretailapplication

Shuchita Pai

English, Hindi, Tamil

B.E.(ElectricalEngineering),VJTI,UniversityofMumbai

3 years 10 months of experience in IT (Products) & Investment Banking industry.

Nomura India Services Pvt. Ltd.: Analyst

• Ledthedesignanddevelopmentofthemargin reporting application gateway for Nomura’s prime

brokerage business

• Interactedwithglobalsystemownerstomanagerequirements,developmentand testing

• Nominatedtocompany’scorporatesocialresponsibilitycommittee

IBM India Pvt. Ltd.: Associate System Engineer

• Analyzedbusinessrequirementstodesignusecasesanddatamodels

• Implementedproof-of-conceptinterfacesinvariousproductdevelopmenttools

• Conductedtechnicalworkshopsforteammembers,whichsavedUSD20,000in training costs

Shyam Sunder Subramanian M

English, Hindi, Punjabi, Marathi

BMS,JaiHindCollegeofCommerce,UniversityofMumbai

2 years 10 months of experience in Financial Services industry.

TresVistaFinancialServices:SeniorAnalyst,BusinessDevelopment

• HeadedbusinessdevelopmenteffortsinMiddleEast,SouthAsiaandNorthAmerica

• WorkedonformulatingthebusinessplanforthecompanyforraisingroundA funding

• Financialanalystfor2years,executingfinancialconsulting,valuationandresearch assignments

• WorkedwithPEs,IBsandentrepreneursinTMTandfinancialservicessectors

• Plannedandlaunchedcompany’sblog

Siddhartha Jain

English, Hindi

B.Tech. and M.Tech. (Chemical Engineering), IIT Kharagpur

2 years 7 months of experience in Consulting industry.

ANB Consulting: Consultant

• Helpedatelecominfracompanysave3%ofoperating costs by streamlining project management

• HelpedTataTeleservicesdevelopproductprofitabilitymatrixtoassesprofitabilityof new products

• HelpedreduceoperatingexpensesofaBPObyquantifyingworkforcerequirements

Rio Tinto Alcan: Process Engineer

• WorkedinanaluminiummeltingplantinAustralia

• Achieved5%reductioninpertonmetalcostbyimplementingtemperaturecontrol strategy

• AchievedUSD30,000savingsthroughwastereduction

Sidhant Srivastava

English, Hindi

B.E. (Computer Science), Delhi College of Engineering, University of Delhi

3 years 10 months of experience in Electronics industry.

ST-Ericsson India Pvt. Ltd.: Senior System Software Engineer

• Led6memberinternationalteamforwirelesstelecommunicationprojectsworth USD 5 million in USA, China

• Youngestmember,worldwidesystemarchitectureteamthatdefinesST-Ericsson’s roadmap for mobile platforms

• RepresentedST-EricssoninaUSD120millionpartnershipwithSamsungMobilein Korea

• Founded‘InnovationGroup’inIndiaofficeandledinitiativestowardsbuilding intellectual property within the company

• LedUSD3.2millionSmartPhoneprojectforaEuropeantelecommunicationsmajor

Sidharth Malhotra

English, Hindi, Punjabi

B.E. (Electrical Engineering), Thapar Institute of Engineering and Technology, Thapar University

2 years 9 months of experience in Oil & Gas industry.

Fluor Daniel: Electrical Engineer

• Providedelectricaldesignsolutionsforthe construction of petrochemical refineries

• LedsubstationengineeringanddesignforaUSD1.9billionoilandgasproject

• LedmotorschematicsdesignforaUSD585millionpolysiliconproductionfacility

• Youngestengineerfromthedepartmenttobechosenforastrategictalent development initiative for Fluor employees worldwide

Smita Singla

Page 58: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

114 115

English, Hindi, Bengali

M.Sc. (Physics), IIT Kanpur

B.Sc. (Hons.), (Physics), Presidency College, University of Calcutta

2 years 9 months of experience in Insurance industry.

ICICI Prudential Life Insurance Ltd.: Manager-Business Intelligence Unit

• Forecastboardkeyperformanceindicatorsonpolicyholderpersistencythrough predictive modelling

• Aidstrategicdecisionmakingthroughquantitativemeasuresandanalysisofimpact on enterprise value

• Reportnewbusinessprofitabilitytoshareholders

• Quantifyreasonsforvarianceinmarginandinitialcapitalrequirementandpresentto top management

• Sensitivityanalysistodeterminerelevanceofactuarialassumptions

• Develop/modifyretentioncampaignstomeetinternalpersistencymetrics

Sombit Bhattacharyya

English, Hindi

CFA, Cleared Level III, CFA Institute, USA

B.Tech. (Textile Technology), IIT Delhi

3 years 10 months of experience in Investment Banking industry.

Nomura Structured Finance Services Pvt. Ltd.: Associate

• Workedwithcommoditiesindextradingteamto develop a third generation commodity index

• Developedmodelstoconducttechnicalandfundamentalanalysisofthecommodites

• WorkedwithequitystructuredproductsdesktradingwithEuropeanandAsianclients

• Pricedderivativestructurebasedonequities,indicesandcommodities

• Managedandhedgedtradingbookbasedoncommodities

Qwest Telecom Software Services Pvt. Ltd.: Software Engineer

• Softwaredevelopment

• Ledateamofsixpeople

Sonal Dubey

English, Hindi, Oriya

B.Tech. (Mechanical Engineering), NIT Warangal

3 years 5 months of experience in IT (Services) industry.

Capgemini Fssbu India: Associate Consultant

• Handledamulti-milliondebtrestructuringproject

• Recommendedmodificationstoloanrejection/ intimation project and successfully completed the project realising sixteen man month revenue

• Convertedhighcostdatabasestoragetolowcostfilestorageresultinginsavingsof USD 50,000 on annualised basis

• Receivedbestmentorandfacilitatorawardforinductingsixtynewjoinees

Sourav Sekhar

English, Hindi, Tamil

BachelorofMassMedia,JaiHindCollege,UniversityofMumbai

3 years 7 months of experience in Marketing & Advertising industry.

Cartwheel Creative Consultants Pvt. Ltd.: Copywriter and Content Developer

• WorkedonadvertisingandcreativestrategiesforRelianceCommunicationsand UTVinewschannel

• Co-initiatedacricketR&Dlabtodevelopnewtoolstocovercricketforprint,online and television

• InvitedbytheICCtopresentapaperonrankingplayers

• Ranacricketwebsiteholdingwilley.com

Nobby Brand Architects: Associate

• Workedonproductplanningandmarketingstrategies

Sreeram Ramachandran

English, Hindi, Tamil, Marathi, French

B.E.(ElectricalEngineerging),VJTI,UniversityofMumbai

3 years 7 months of experience in Consulting industry.

Deloitte Consulting India Pvt. Ltd.: Consultant

• ProvidedCRMconsultingservicesforFortune100 companies

• LedateamofconsultantsinUSAtoprovideamarketingsolutionforAmerica’s leading healthcare organisation

• ‘OutstandingTeamContribution’awardonaservicetransformationprojectin Singapore/ USA for global telecom company

• TopperformanceratingsonCRMimplementationprojectsininsurance,bio-medical sectors

• Promotedtoconsultantonfasttrack(FY09)

• AppreciationAward(FY07)fromMD,DeloitteConsulting

Sridhar Vishwanathan

English, Hindi, Tamil, Sanskrit

B.E., (Computer Science), Crescent Engineering College, Anna University

3 years 6 months of experience in IT (Products) industry.

Expicient Inc.: Business Consultant

• Ledasoftwareengineeringteamthatlicensed ‘iPhone’ application for a Fortune 500 retail client

• Co-negotiatedaUSD1millionservicecontractthroughcost-benefitstrategiesand presentations

Oracle India Pvt. Ltd.: Applications Engineer

• BuiltkeyintegrationsforOracle’sCRMsoftwareofferingsthatsupportedaUSD83 billion FMCG account

• DeliveredOracleCRMwithsection501compliance,buildingsoftwareenhancements for visually challenged software users

• SetupteamsofsoftwareengineersforIndiaoperations

Sriraman Pattabiraman

English, Hindi

Bachelor of Mass Media, St. Xavier’s College, University of Mumbai

2 years 10 months of experience in Marketing & Advertising industry.

KPMG: Executive

• Mapdevelopmentsandthefirm’sactivityintheICE sector to identify areas for expansion

• Assistedpartnersinformulatingandimplementingabusinessexpansionstrategyin ICE LoB

India Today Group: Senior Executive

• ConductedbusinessdevelopmentforHBRandBusinessToday

• LaunchedandledtheteamforIndiaTodayWomanmagazine

• Achieved108%ofmy2008-09advertisingtarget

• Awardedthe‘MostInnovativeEmployeeoftheyear’attheannualconference 2007-08

Srishti Bakshi

English, Hindi, Telugu

MS (Electrical Engineering), University of Texas - Arlington

B.Tech.(Electrical&Electronics),GayatriVidyaParishadCollegeofEngineering&Technology,JNTU

3 years 6 months of experience in Engineering industry.

Eaton Corporation: Engineer (Aerospace Division)

• Developednewconceptstoprovidecontroltechnologysolutionstoengineering problems faced by customers

• Developedproofofconceptthroughrapidprototypingandmodelbaseddesignfor aerospace and automobile divisions

• Workedinateamof6tolaunchanewdriverwarningsystemintheUSautomobile market

• AwardedE-starforinnovationin2008

Srividya Varanasi

English, Hindi, Tamil, Indonesian

BS (Finance & Marketing), Kelley School of Business, Indiana University Bloomington

3 years 10 months of experience in Consulting industry.

Deloitte Consulting (USA): Consultant - Strategy & Operations

• RealisedUSD2millioninannualsavingsforanautofinancecompanythroughIT offshoring strategy

• AdvisedCXOsofacommercialbanktoimplementprofitableITinvestmentstrategy

• Redesignedsupplychainnetworkforacoffeeproducerincorporatingdistribution channel feedback

DeloitteConsultingIndiaPvt.Ltd.:Consultant(promotedJune2008)

• Developedclaimsprocessingstrategyforapropertyandcasualtyinsurancefirm

• Introducedaninvestmentbank(HongKong)tooffshoring,saving20%inannual costs

Subhashini Prasad

English, Hindi, Telugu

BBA (Hons.), University of Windsor, Canada

3 years of experience in Marketing & Advertising industry.

Wipro Technologies: Senior Marketing Communications Specialist

• Wontwoinnovationawards

• Migratedapilotprocessoffshore

• Deliveredstrategicprojectsthatservedasbenchmarks

Deloitte Consulting: Analyst, Communications

• Introducedtangibleimprovementstothenewsletter

• Rancampaignsforhigh-profile,firm-wideinitiatives

• Launchedfourinternalwebsites

• WonaCSRAward

Deloitte Support Services: Associate Analyst, Marketing and BD

• Establishedanewresearchdeliverable

• Promotedandawarded‘DeloitteWomanoftheYear2008’

• Top5ideafinalistinDeloitteUS-wideInnovationQuest

JWTmindset:AccountExecutive

• Managedkeycorporateaccounts

Suchita Rao Ketineni

English, Bengali

B.E.(ElectricalEngineering),JadavpurUniversity,Kolkata

3 years 8 months of experience in Consulting industry.

PricewaterhouseCoopers: Consultant

• TeamleadexperienceinSAPconsultingprojects across diverse industry sectors

• Implementedmethodologiesresultinginsignificantimprovementinproduction efficiency, cost reduction and profitability of clients

• Assistedinfirm’sbusinessdevelopmenteffortsgenerating20%ofplannedbilling targets in the region

• Ledinitiativesforcapabilitydevelopmentofteamsanddevelopingnewvalue propositions

• Youngestteamleadinbatchof2006

Sukanya Chakraborty

English, Hindi

MS (Biomedical Engineering), University of California, Los Angeles

B.Tech. and M.Tech. (Biochemical Engineering & Biotechnology), IIT New Delhi

2 years 6 months of experience in Consulting industry.

Kinapse Inc.: Senior Analyst

• Managedadata-collectionprojectcoveringover50countriesfor9majormarketed drugs

• Executedalarge-scaleBDprojectspanning200smallandmid-tierpharma companies across Pennsylvania

• Helpedassessandredesignalegacyfinancialdisclosureprocessforatop-10big pharma

• Enhancedtheclient’sEMEAcompliancethroughidentificationofdeviationsfrom EMEA guidelines

• DevelopedawhitepaperhighlightinglinksinFDAsubmissionsandperformancein device sector

Sumit Kumar

Page 59: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

116 117

English, Hindi, Telugu, Kannada

PGP, Hospital Management/ Hospital Administration, IHMR, Bangalore

BDS, M S Ramaiah Dental College, Rajiv Gandhi University of Health Sciences

3 years 6 months of experience in Healthcare industry.

Columbia Asia Hospitals Pvt. Ltd.: Customercare Executive

• ImplementedLEANmethodologyindischargeprocess,toreducedischargetimeby almost 50%

• Automatedpatientfeedbackmanagement

• Manageddailyoperations,financeandinsurance

• Preparedhospitalformid-termassessmentofNationalAccreditationBoardfor Healthcare Organisations

• UtilisationstudyofOPDledtoefficientmanagementofpeakhours

• Preparedmedicalqualityindicatorsreportforhospital

Impressions Multi-speciality Dental Care: Private Practitioner

• Introducedfamilycardfordentalcare,whichincreasedpatientsatisfaction

Sundeep Reddivari

English, Hindi, Bengali

M.A. (Economics), Delhi School of Economics, University of Delhi

B.A. (Economics), St. Stephen’s College, University of Delhi

3 years 11 months of experience in Printing & Publishing and Research industry.

India Infrastructure Publishing Pvt. Ltd.: Research Analyst

• Wrotearticlesfor3B2Bmagazines

• Wrote200to300pagesectorreportson‘InternetandBroadbandinIndia’, and ‘Investment Opportunities in Infrastructure in India’

• OversawcontentforB2Bwebsiteonglobalurbantransportationsystems

• Workedinateamtocarryoutcompany’sfirstsyndicatedresearchonenterprise telecom segment

• Organisedconferencesoninfrastructuresectorforindustry

Suparna Dasgupta

English, Hindi

B.E. (Hons.) (Computer Science), Lingaya’s Institute of Management & Technology, Maharshi Dayanand University

3 years 10 months of experience in IT (Products and Services) industry.

Amdocs (India) Pvt. Ltd.: Senior Subject Matter Expert (Tandem Technologies)

• Resourcescheduling,capacityplanning,estimationstudiesforAT&Tprojects

• Implementedautilitytosearchaccount,increasingsearchspeedby50%

• Specialbonusfortransitioningcarrierinterfacesystemsfromacquiredcompanyto AT&T

• Completedinitialsystemtrainingwithin50%ofallocatedtime

Infosys Technologies Ltd.: Senior Software Engineer (Healthcare)

• Developedacapacityplanningproductforhospitals

• Deliveredsolutionsforhealthinsuranceclients(billingandclaimprocessingareas)

• Defectpreventionandknowledgemanagementanchor

Suryanka Jatain

English, Hindi

B.Tech. (Civil), NIT Warangal

2 years 9 months of experience in IT (Products) industry.

Oracle India Pvt. Ltd.: Applications Engineer

• Enhancethevalueoftheexistingenterprise applications by seamless flow of business processes using integration framework and technology

• Conceptualisedanddevelopedproductivityenhancementtoolsforkeycustomers and developers

• Definedrealworldscenariosfortheusageofproductandaccessedthequalityofthe product

• Mentoredthenewteammembers

Sushama

English, Hindi, Punjabi

Bachelor of Software Engineering, Ottawa, Carleton University

2 years 4 months of experience in Manufacturing and IT Consulting industry.

Cast Profiles Pvt. Ltd.: Executive Director

• SettingupofITinfrastructure

• Decreasedworkerattritionby10%,throughimprovedrelationsbetweenworkersand management

• InvolvedinsettinguptwoprojectsworthUSD4million

Thinkwrap Inc., Canada: Software Consultant

• ResponsibleforthesupportanddevelopmentofDepartmentofForeignAffairsand International Trade’s online portal for businesses

• Trainedandmentorednewrecruitsintheorganisation

Swaraj Shergill

English, Kannada, French

B.E.(IndustrialEngineering),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity

2 years 6 months of experience in Manufacturing and Service industry.

Industries Chimiques du Senegal: Procurement Engineer

• Managedprocurementprocessformechanicaland electrical spares

• Identificationofnewsuppliers

• RegistrationandrelevantproceduresfornewofficeestablishmentinBrussels

• CommunicationfacilitationamongFrench,BelgianandEnglishsuppliersand colleagues

Achindra Online Marketing Pvt. Ltd. - Hungryzone.com: Business Development Manager

• Workedononlineandofflinemarketingcampaigns

• Corporaterelationshipdevelopment

Miebach Consulting - India (Supply Chain Engineering): Associate Consultant

• Physicalwarehouseplanninganddesign

• Providednetworkanalysisservices

• Completed5projectsmovingseamlesslybetweenengineeringandsupplychain strategy

Swathi Parthasarathi

English, Hindi, Tamil

B.E. (Computer Science), BIT Mesra

2 years 7 months of experience in IT (Products) industry.

Microsoft R&D Pvt. Ltd.: Software Design Engineer in Test

• Ledthedesignandqualitycontrolofmultiplefeatures from inception through the full product ship cycle for

Windows 7

• AsproductsecurityownerforcorefeaturesofWindows7XPmode,conducted systematic verifications to find critical security issues

• Designedautomationsystemsthatreducedvalidationeffortby90%

• Collaboratedwithaglobalteamandexternalpartnerstoensurehighqualityand timely delivery

Swetha Balasubramanian

English, Hindi, Spanish

B.Tech. (Hons.) (Electronics and Communication), NIT Kurukshetra

2 years 9 months of experience in Telecommunications industry.

Amdocs (India) Pvt. Ltd.: Senior Subject Matter Expert

• Offshorebusinessanalystforrequirementsanalysis for telecom billing application

• Ledclientsupportteamtoensuresmoothdeploymentofdeliverables

• Technicalarchitectandprojectco-ordinatorthroughoutapplicationdevelopment

• Appreciationawardfromclientforimplementationof4majorreleases

• Managedmultipleaccountsasacorememberoftheimplementationteam

• Onsiteco-ordinatorfor6monthsatclientproductionsite,inUSA

Tanvi Kapoor

English, Hindi, Punjabi

B.A. (Hons.) (Economics), St. Stephen’s College, University of Delhi

2 years 9 months of experience in Marketing & Advertising industry.

Hindustan Unilever Ltd.: Brand Manager

• ResponsibleforlaunchingCif(Unilever’sbiggest household care brand), first national brand launch in 3 years, Cif gained 160 bps in 6 months

• WorkedtowardsmakingVimliquidaUSD10millionbrand

• SolelyresponsibleformanagingRexona-theUSD40millionbrandwithanA&P budget of USD 6 million

• CompletedthebusinessleadershiptrainingprogrammeatHULfor15months acquiring cross-fuctional experience

Tanya Gupta

English, Hindi

B.Tech. (Electrical Engineering), Banaras Hindu University

2 years 7 months of experience in Investment Banking industry.

Morgan Stanley Advantage Services Pvt. Ltd.: Manager

• Managerforclientrelationshipteamforprime brokerage business

• Businessprocessanalysis,re-engineeringtoachieveoperationalefficienciesand savings

• Strategicplanning,buildingprojectroadmaps,trainingendusersanddocumentation

• Streamlinedandautomatedlegalclientinteractionswiththefirm,enhancingclient relationships

• Builtanexceptionmanagementsystem,contributingmillionsofdollarstorevenues

• Builtaclientanalyticstooltohelptakestrategicdecisionsbasedontrends

Taru Bazaj

English, Hindi, Punjabi

M.Tech. (Structural Engineering), IIT Kharagpur

2 years 4 months of experience in Manufacturing industry.

ITC Ltd.: Assistant Manager, Process Improvement and Innovations

• Conceived,designedandlaunchedITD’sfirst innovation centre

• Managed60innovationprojectsand20leanSixSigmainitiatives

• AchievedcostsavingsofINR20millionandinitiatedadditionalprojectswithpotential of additional INR 30 million

• Developedin-housestructuredproblemsolvingtrainingmodule

ITC Ltd.: Assistant Manager, Quality

• Achievedlowestmarketcomplaintlevel:1inayear

• Rated‘outstanding’forimprovingqualityscoresacross10brandsoftheunit

Tarun Bhambra

English, Hindi, Tamil, Kannada

M.Tech. (Metallurgy and Material Science), IIT Madras

B.E. (Metallurgical Engineering), Government College of Engineering, Salem, Periyar University

3 years 9 months of experience in IT (Services) industry.

IBM Global Business Services (GBS): Segment Analyst

• Waspartoftheinternalconsultingteamthatbuiltapricingandprofitabilityanalysis framework for IBM’s hardware business

• Customersegment,competitionandindustryanalysistoaidIBM’smarketingstrategy

• QualitativeandquantitativemarketresearchpertainingtoaidIBM’sconsultingand system integration business

• Workedonmicro-verticalentrystrategyintotheIndiandairymarketforITservices

• Wonthe‘IBMBravoAward’foroutstandingperformance

Thilak Ramanathan Subramanian

Page 60: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

118 119

English, Hindi, Punjabi

B.Tech. (Chemical), IIT Delhi

2 years 10 months of experience in FMCG industry.

ITC Ltd.: Assistant Manager, Purchasing (Tobacco division)

• HandledUSD14millionbuyforpackagingmaterials

• LedaSixSigmaprojecttoachieveUSD110,000(2%) savings in metallised paper cost

• Re-engineeredbusinessprocessesformerchandiseprocurement

• Developedpackagingandsourcingstrategyforanewproductcategory

• Aslogisticsmanager,Kidderpore,developedKPIsfordemandfulfillmentprocess; reduced stock-outs by 25%

• Negotiatedlong-termagreementwithunion.Improvedmanpowerproductivityby20%

Toshit Bharara

English, Hindi, Malayalam

B.A. (Hons.) (Economics), St. Stephen’s College, University of Delhi

2 years 9 months of experience in Consulting industry.

PricewaterhouseCoopers: Analyst

• Corporatefinance-researchandanalysisforM&A transactions

• Involvedinprojectswithclientinteractionandnegotiation

• Businessdevelopmentforfinancialadvisoryservices

• Partofthemarketsandindustriesvertical

• Co-authoredastudyontheIndianretailsectorwhichwaspresentedattheRAIRetail LeadershipSummitinJanuary2010

• LaunchedathoughtleadershipstudyontheIndianaerospaceindustryatAero India Show 2009

Treasa Tomy

English, Hindi, Malayalam

B.E.(ElectricalEngineering),VJTI,UniversityofMumbai

2 years 9 months of experience in Manufacturing industry.

Siemens Ltd.: Executive - Marketing

• Responsibleforproductpositioningandproductgap analysis

• LaunchedproductfromChinaintoIndia,aimedatpricesensitivemarket

• Analysisoforderslosttocompetition,withstrategiestorecoverlostcustomers

• Developedandconductedproducttrainingsforchannelpartnersandsalesteam across India

• Supportedsalesteamsandchannelpartnerswithpromotionalactivitiesforproducts

• Matchedproductwithvaryingcustomerrequirements

Tressa Joy

English, Hindi, Bangla

B.Tech. (Pulp and Paper Engineering), IIT Roorkee

3 years 10 months of experience in IT (Services) industry.

Infosys Technologies Ltd.: Associate Consultant

• Co-ordinatedtheexecutionofHRreorganisation projectatInfosysin2009for70,000+developersin

the organisation

• Ledaprocessconsultingassignmentforalargedistributionclientresultingan annual saving of USD 1.43 million for the client, and reduction in total cost of ownership of IT systems by USD 504,000

• FounderchairpersonofInfosysGreenCorridorinitiativeforengagementwithrural population in India

Udayan Dasgupta

English, Hindi

B.E.(ProductionEngineering),SardarVallabhbhaiNationalInstitute of Technology, Surat

3 years 3 months of experience in Non-Profit & NGOs.

Samanvay Pariwar Trust: Project Coordinator

• Createdinfrastructureforfinancialrehabilitationof400- 500 disabled persons

• GotSamanvay’spropertytaxreducedby70%(areductionofINR1million approximately)

Patni Computer Systems Ltd.: Software Engineer

• Workedonweb-basedsolutionsforassetmanagementapplicationsforGEAsset Management

• DreamTeamAward2007

Ujjaval Gupta

English, Hindi, Bengali

B.Tech. (Ocean Engineering & Naval Architecture), IIT Kharagpur

3 years 8 months of experience in Maritime industry.

Axsys Technologies Ltd.: Team Lead (Marine Engineering & Design)

• Led40%ofdesignprojectswithcompany,which included a container, coal barge and offshore supply vessel

• Helpedacquireinternationalclients,increasingongoingprojectvalueby25%

• Redesignedqualitymanagementsystem,toreducedesigndeliverytime

Indian Register of Shipping: Assistant Surveyor

• Inspectionandcertificationofstructuraldesignsofnewvessels

• Assessmentofloadlineconditionsandissuanceofloadlinecertificates

• WorkedwithnationalandinternationalclientsonprojectsworthINR20million

Umesh Shankar Saha

English, Hindi, Malayalam

B.Tech. (Mechanical Engineering), NIT Calicut

3 years 8 months of experience in Automotive industry.

Ashok Leyland Ltd.: Deputy Manager - Product Management Group

• Responsibleforidentifyingemergingopportunitiesin the road-based mass transportation through market studies and conceptualising solutions

• Responsiblefornewproductdevelopmentprocessimplementationandtraining

Ashok Leyland Ltd.: Deputy Manager - Sales and After-sales Support

• After-salesserviceco-ordinatorforkeycustomersanddealermanagement

• Developedandimplementedasalesprocessforincreasinginstitutionalsales

• WinnerofAshokLeylandImproveAwardandBestProjectbygraduateengineer06-07

Unni V

English, Hindi

B.Tech. and M.Tech. (Computer Science), IIT Kanpur

2 years 9 months of experience in IT (Products) industry.

University of Applied Sciences Northwestern Switzerland, School of Business: Software Development Researcher

• WorkedonEUfundedcloudcomputingproject; submitted two proposals since subsequently approved

Amazon India Development Centre: Software Development Engineer

• Buildingadvertisingsolutionsforaffiliatesteam

• Building,deployingandmonitoringdistributedsystemset-upusedforservingoutthe advertisement

• Becameownerofcorefront-endcomponentinjustoveroneyearofstartingthejob

• Cameupwithabusinessideainvolvingsocialnetworkingsites,partofwhichwas implemented and launched by Amazon

Uttam Kumar Tripathi

English, Hindi

CFA, Cleared Level III, CFA Institute, USA

CA, ICAI

B.Com.,ShriVaishnavCollegeofCommerce,DeviAhilyaVishwavidyalaya,Indore

3 years 6 months of experience in Private Equity and Investment Banking industry.

Bain Capital Private Equity: Analyst

• Industry/CompanyDiligence/Modeling/Valuation

• Dealingwithadvisors

• ExecutedUSD100millioninvestmentinHimadriChemicals

• EvaluatedUSD200millioninvestmentinleadingretailcompany

• EvaluatedUSD420milliondealinIndianautoindustry

• EvaluatedUSD170millionbuyoutofIndianBPOcompanyandinvestmentincrop protection chemical company

Morgan Stanley Advantage Services Pvt. Ltd.: Associate

• Workedonprovidence/permiraUSD2billionbidforEMAPB2B

• AdvisingprivateequityfirmonbuyingstakeinPyramidSaimiraTheaters

Vaibhav Badjatya

English, Hindi, French

B.Sc. (Industrial Engineering), Georgia Institute of Technology

2 years 6 months of experience in Consulting industry.

A.T. Kearney: Senior Business Analyst

• Conductedtheduediligenceandvaluationofan acquisition target for a segment-leading US-based juice-drinks company

• Developedagrowthstrategyandlong-termbusinessplanforaleadingIndianmulti- brand apparel retailer

• Conductedaglobalcostreductionassessmentandcontractnegotiationsfora European brewery

• ForaleadingIndiantelecomoperator,developedaglobaltelecombusinessevolution roadmap and designed an enterprise-wide capex management process

Vaibhav Shah

English, Hindi

B.E.(ElectricalEngineering),VaishCollegeofEngineering,Maharshi Dayanand University

3 years 8 months of experience in Engineering industry.

Korus Engineering Solutions Pvt. Ltd.: Senior Design Engineer

• LedteamonprojectswithtotalinvestmentofINR7billionforkeyclients

• Actedasaninterfacefornegotiationsbetweenclientandvendors

• Developedcalculatorforpowerfactorimprovementthatreducederrorsand execution time by almost 60%

• Increasedteam’sproductivityby20%

• Createdinductionandtrainingmodulefornewemployees,whichincludedthe operational processes and domain knowledge

Vani Malik

English, Hindi

B.A. (Political Science), Duke University

3 years 9 months of experience in Investment Management industry.

RaymondJames&Associates,Inc.:ResearchAssociate

• Researchcommunicationssoftwaresectorcompanies and stocks

• Initiatedcoverageofaseparateindustry(e-commerce)tocreateincrementalrevenue opportunities

• Increasedclientbasebyinitiatingcoverageofover10companies

• Alsoworkedwithtelecomandsoftwareindustrygroups

• Interactedwithclientstomakestockrecommendationsthatfacilitateinformed investments

Varun Chadha

Page 61: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

120 121

English, Hindi

BS (Hons.) (Finance & Accounting) and B.A. (Hons.) (Economics), Wharton School, University of Pennsylvania

2 years 10 months of experience in Consulting industry.

African Timber & Farming Corporation, Mozambique: Managing Director and CEO

• SetupJVwithSouthAfricanpapercompany,Sappifor30,000hectaresof Eucalyptus

• ObtainedUSD2millionVCfundingfromMirabaudBank

Cha De Magoma, Mozambique: Managing Director

• ModernisedteafactoryadheringISOandfair-tradestandards

• Marketedandsold2millionkgs/yearofteatoUnilever,Starbucksetc.

Oliver Wyman: Consultant

• RestructuredPMSofamulti-nationalbankleadingto17%increaseinsales

• MappedoutgrowthrouteandentrystrategyforaUSbankenteringIndia

RaigarhJute&TextileMillsPvt.Ltd.:Director

Varun Jalan

English, Hindi, Telugu

B.E. (Hons.) (Electrical and Electronics Engineering), BITS Pilani

2 years 9 months of experience in Non-Profit & NGOs.

Dastkar Andhra: Head - Promotions

• BuiltaCRMatretailstoresformarketingcampaigns, improved sales to achieve break-even

• Preparedcontentanddeliveredstafftrainingsoncustomerservice,product knowledge and staff motivation

• Preparedco-operativeanddistrictleveldatabaseonweaversinAP

Infosys Technologies Ltd.: Software Engineer

• Introducedtoolsandmethodologiesandensuredtheiruseduringthecourseof projects

• SecuredaCGPAof4.9/5inFinacle(bankingsolution),rankedamongtoppersto lead teams

Veena Kondaveeti

English, Hindi, Marathi, Tamil

M.A. (Economics and Development), The University of Leeds

B.A. (Economics), St. Xavier’s College, University of Mumbai

3 years 1 month of experience in Financial Services industry.

Credit Analysis and Research Ltd.: Manager

• Sub-sovereign,sovereign,publicsector,infrastructureandmunicipalcreditrating

• Economicresearchandanalysis,forecasting,modeldevelopment

• Referencequantitativemodelling

• In-chargeofprestigiousGoImegaratingassignmentunderJNNURM

• Teamleaderinimportantstrategicprojects

Business Standard Ltd.: Staff Correspondent

• Featurewrite-upsonequityanalysisandresearch

• Articlesonpolicy,M&A,capitalmarkets

• Coverageofautomobile,power,industrialappliancesandinfrastructuresectors

• Partofsmartinvestorteam

Venkatesh Rangan

English, Hindi

B.A. (Hons.) (Economics), Miranda House, University of Delhi

2 years 9 months of experience in Marketing & Advertising industry.

Google India Pvt. Ltd.: AdWords Account Associate

• WorkedonGoogleAdWordclients,managedportfolio valued at USD 3 million

• WorkedonkeyfashionandapparelclientslikeTommyHilfiger,ElizabethArden, Wolverine World Wide for managing their online business

• Specialisedinsearchenginemarketing,adcontentanddisplayadvertising

• WorkedonpipingadstosocialnetworkingmediasuchasFacebook,Youtubeetc.

• RepresentationinGoogle’sglobalsalesandoperationsconference

Vibha Adlakha

English, Hindi

B.Arch., IIT Roorkee

3 years 9 months of experience in IT (Services) industry.

Wipro Technologies: Project Engineer

• Selectedfor‘PerformanceRewardProgramme’for contribution to the success of the client account and

business unit

• PartofLEANimplementationforclient,thatledtoimprovementsinutilisationof manpower

• Singlepointofcontactforprojectmodule,atclientlocationinUK

• Involvedininception,design,development,testingandsupportofbusinesscritical applications in UK and India

Vibha Naryan

English, Hindi

B.Tech. and M.Tech. (Biochemical Engineering and Biotechnology), IIT Delhi

3 years of experience in Consulting industry.

Kinapse: Consultant

• Advisedtop10pharmaceutical,biotech,consumer healthcare and specialty clients

• Preparedbusinessplan,executeddemergingstrategyandrefinedvalueproposition for a Norwegian biotech to support USD 11.9 million IPO launch on Oslo Exchange

• Developeddiversificationstrategyforaglobalpharmaceuticalinto‘RareDiseases’ segment to tap the USD 82 billion potential market

• FormulatedtheresourcemanagementmodelfortheEuro10.6billionpost-merger integration of European biotech majors

NDG Global: Analyst

Vibhuti Gupta

English, Hindi, Telugu, German

B.Tech. (Engineering Physics), IIT Bombay

3 years 5 months of experience in IT (Products) industry.

Sap Lab (India) Pvt. Ltd.: Senior Software Engineer

• Designteammemberofbusinessrulesmanagement, responsible for conceptualisation and development of

new features

• UsabilityexpertforNetWeaverBRM,focusingonenhancingtheenduserproduct experience

• Recognisedas‘HighPotential’and‘TopTalent’,awardedtolessthan1%ofthe global work force

Yasu Technologies Pvt. Ltd.: Developer - Grade 1

• DesignedtheuserinterfaceforQuickRulesAnalytics

Vikas Garikipati

English, Hindi, Gujarati

BBS, College of Business Studies, University of Delhi

3 years 5 months of experience in Consulting industry.

Ernst & Young, Global Shared Services: Research Analyst (Power sector)

• Knowledgesupporttopower(focusonrenewables) and metals sector

• PresentedwhitepapertoCIIonpowertransmission&distributionandrenewable energy

• Receivedmultiple‘EYExtraMiler’awards

RocSearchIndiaPvt.Ltd.:JuniorResearchAnalyst

• Preparedcustomisedresearchreportforclientsacrossdomains

• Teamlead(6members)forcountryreportsonminingandmetalssector

• Involvedinbusinessdevelopment-workedonpilotprojectforacquiringKPMG account

Vikas Shah

English, Hindi

BS (Mechanical Engineering), University of Illinois, Urbana-Champaign

2 years 8 months of experience in Manufacturing industry.

Beri Udyog Pvt. Ltd.: Director - Marketing

• Grewdomesticmarketby33%andinternational market by 75% in West Africa and North America

• Forgedstrategictie-upswithleadingtractormanufacturingcompanieslikeJohn Deere and Escorts, retail chains like Hariyali

• Segmentedoperationsinto3focusedbusinessunitsleadingtooperationalefficiency and enhanced market presence

Deloitte Consulting: Business Technology Analyst

• ProcurementstrategyforafirstofitskindlogisticssolutionforaForbes100 manufacturer

Vikram Beri

English, Hindi, Telugu, Tamil, Kannada

B.E.(ElectronicsandCommunications),RVCollegeofEngineering,VisvesvarayaTechnologicalUniversity

3 years 7 months of experience in High Technology/Electronics industry.

Texas Instruments (India) Pvt. Ltd.: Design Engineer

• Improvedthetest-coveragefordigitalcircuitsby20% with automation

• Receivedaninnovatorawardfordesigninganewlevel-shiftercircuitwithpatent application

• Workedonpowermanagementtechniquesandanalysisforyieldatcircuitlevel

• Presentedapaperonchallengesin45millioncircuitdesignatcompanyconference

• WorkedwithclientsincludingCiscoacrossIndia,USA,UKandFrance

Vikram Pradeepkumar Bagepalli

English, Hindi

B.E. (Electronics), Netaji Subhas Institute of Technology, University of Delhi

2 years 8 months of experience in Sales and Trading industry.

Noble Resources and Trading India Pvt. Ltd.: Associate ResearchAnalyst,VegOils

• Tradedgrains(soybeancomplex)andvegetableoilsonNationalCommodities Exchange (NCDEX) and Multi-Commodities Exchange (MCX)

• Headeddemand-sideresearchinIndiafor3commodities

• RepresentedIndiaofficeinglobalanalystmeets

Evalueserve.Com Pvt. Ltd.: Group Representative - Macros and Business Analyst

• Researchforfinancialconsultanciesforcommodities

• WhitepaperonNSEindexanalysisselectedfor‘KnowledgeOlympics’

Futures First Info Services Pvt. Ltd.: Derivatives Trader

• TradedsoftcommoditiesonLIFFEandNYBOT

• NetAUM-USD600,000;netprofit-GBP35,000

Vinayak Kaushal Thakur

English, Hindi

CFA, Cleared Level III, CFA Institute, USA

BBS, College of Business Studies, University of Delhi

2 years 11 months of experience in Financial Services industry.

Inductis (India) Pvt. Ltd.: Senior Financial Analyst

• Financialmodeling,equityresearch,industry assessment and credit research for hedge funds, private equity and commercial banking clients

• ConductedcompletebusinessreviewofaQatarbasedrealestatedeveloperforan emerging markets focused hedge fund

• Designedarigorouscounterpartycreditriskassessmentmodelforinstitutionallender in the USA

Ameriprise Financial India Pvt. Ltd.: Analyst

• DrivingpreparationoffinancialreportsandmetricsshowingAmeriprise’sfinancial results

Vishal Chadha

Page 62: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

122 123

English, Hindi, Tamil, Telugu

B.Tech. (Hons.) (Instrumentation Engineering), IIT Kharagpur

3 years 9 months of experience in Consumer Products industry.

Procter&Gamble(India):VendorManager

• ManagecapitalsourcingfromIndia(USD2million)for P&G global needs

• Identificationofnewequipmentneeds,definedtechnicalandoperationalspecifications to most qualified vendor and monitored fabrication process

• Buildvendorcapabilityinprojectmanagementandqualitycompliance

• DeliveredIndia’sfirstskincaremodularproductionplant

• Received‘SpecialAppreciationAward’fromP&GIndiaCEOatNationalMeet‘08

• SPOCforenergyutilisationimprovementsintheplant

Yamini Chandrashekhar Yavarna

English, Hindi

B.A. (Hons.), Lady Shri Ram College, University of Delhi

2 years 6 months of experience in Marketing & Advertising industry.

Euro RSCG Advertising Pvt. Ltd.: Strategic Planner

• Developedbrandcommunicationstrategyinthe FMCG, travel and telecom industries

• Studiedconsumerbehaviourandindustrytrends

• Developedcommunicationstrategywhichincreasedmarketshare(soapbrand)

• Developedproposalsforaglobalmarketingmeet

• Partofbusinessdevelopmentteam

• Liaisedwithglobalteamtofacilitateknowledgesharingamongstoffices

TBWA (India): Management Trainee (Account Management)

• Partofteamresponsiblefor4keyaccounts

• Evaluatedcreativeworktoensureeffectiveness,fitwithstrategy

Yamini Tandon

English, Hindi

Bachelor of Financial & Investment Analysis, College of Business Studies, University of Delhi

2 years 11 months of experience in Consulting industry.

McKinsey Knowledge Centre: Research Analyst

• SupportedMcKinsey’sIndiaofficeonbusinessissues that require research and analyses

• AwardedMcKinseyIndiacentreannualexcellenceawardfor‘DistinctiveClientImpact’

• Authoredtwointernalknowledgedocuments,‘LogisticsopportunityinIndia’and ‘Indian Aviation’

• Appointedleadfacultyfortrainingonmacroeconomicconceptsfornewjoinees

• Providedactivecoachingtojuniorcolleaguesandnewjoinees

Yash Kumar

English, Hindi, Marathi

M.Com. (Banking & Finance), Sydenham College of Commerce & Economics, Mumbai

BMS,JaiHindCollegeandBasantsinghInstituteofScienceandJTLalwaniCollegeofCommerce

2 years 9 months of experience in Sales & Trading and Logistics Industry.

DGRLogistiksPvt.Ltd.:VicePresident

• DGRprovidesspecialisedcomprehensivelogisticssolutionsforlargeprojects- turnover INR 125 million

• Managedthelogisticsneedsofalargegreenfieldmanufacturingunit,foralarge primary metals major

EdelweissCapital:JuniorAssociate

• Salestraderforglobalinvestmentbanks

• AccountableforgeneratingannualturnoverandannualbrokerageofINR200billion and INR 50 million respectively

• Convertedglobalhedgefundsintorevenuegeneratingclients

Yomika Ghanshyam Agarwal

English, Hindi, Gujarati

B.Tech (Civil Engineering), IIT Bombay

3 years 9 months of experience in Energy industry.

Shell Technology India Pvt. Ltd.: Senior Associate Engineer

• ConceptdevelopmentanddesignofaUSD10million port expansion project for Algeria’s national oil company

• WonIDEASgamechangercompetitionfornoveltyin‘SmartLNGTunnels’

Nigeria LNG Ltd.: Technical Assurance Engineer (On secondment)

• TechnicalassuranceforaUSD3millionsitedevelopmentwork

• Receivedspecialrecognitionawardforefficientdelivery

Hazira Port Pvt. Ltd. (HPPL): Project Civil Engineer (On secondment)

• ManagedonsiteprojectsworthUSD0.5millionclocking25,000injuryfreemanhours

• Involvedinbusinessdevelopment,representedHPPLincommercialbidnegotiations

Zubin Gokhroo

AVijayKumar 10 4 18AarasPradeepVasa 8 8 18Aarthi Rao 3 3 82AbhijeetAnantJoshi 4 3 44Abhinav Bhatia 2 9 82Abhinav Garg 3 9 82AbhinavJain 3 8 82Abhinav Kala 5 6 44Abhinav Khare 3 9 82Abhineet Bhardwaj 3 10 82Abhiram Alamuru 3 8 83Abhishek Bisht 9 6 18Abhishek Chitlangia 6 2 28Abhishek Kapilaansha Mohunta 6 9 28Abhishek Modi 3 9 83Abhishek Nag 4 9 44Abhishek Satishkumar Rathi 4 1 44Abhishek Srivastava 2 0 83Achal Gupta 4 10 44AdarshKumarJain 10 6 18Aditya Atreya 4 8 44Aditya Bakshi 4 9 45AdityaJha 2 9 83Aditya Patil 6 1 28Aditya Shailesh Shah 4 2 45Aditya Sharma 6 8 28Aditya Sohony 4 3 45Aditya Wasudeo 4 9 45Adwitia Chakraborty 6 10 28Aishwarya Singh 5 9 45AjayJain 6 0 28Akash Maheshwari 4 11 45AkilaJayaraman 3 8 83Akshat Kshetrapal 2 9 83Akshay Bawa 3 2 84Akshay Ashok Bhandarkar 7 0 29Akshay Chopra 3 6 84Akshay Satish Gupta 3 10 84Akshay Rajagopalan 2 9 84Al Ameen Sherfuddeen 4 9 46AlokJain 5 2 46Aman Gupta 7 1 29Aman Raza Khan 4 7 46Amit Dhingra 4 9 46Amit Kekare 6 6 29Amit Kumar 6 8 29Amit Ojha 3 9 84Amit Raju 6 9 29Amit Singla 3 9 84Anal Ghosh 3 9 85Anand Ananthapadmanabhan 3 10 85Anand Krishnakumar 4 2 46Anand Ramani 4 9 46AnantVeerHarlalka 2 11 85Ananya Ukil 2 7 85Anil Ananth Prabhu 5 4 47Anila Narla 3 11 85Anindita Mukherjee 3 10 85AnishJain 6 10 29AnishJain 3 9 86Anisha Krishnan 4 6 47Anjali Rajendra Datar 3 3 86Anjani Bansal 5 9 47Ankit Bharat Patel 5 2 47Ankit Gupta 4 6 47Ankit Kumar Garg 3 10 86Ankit Kumar Mehra 4 7 47Ankur Gulati 4 10 48Ankur Gupta 4 9 48Ankur Sharma 3 7 86AnmolJoneja 3 9 86Anoop Gopikumar 4 7 48

Anshul Sachdev 4 9 48Anugrah Aggarwal 3 9 86Anupama Pande 3 6 87Anuradha Agrawal 3 9 87Anurag Sambyal 5 6 48Anurag Sharma 2 9 87Anusha Pai 2 8 87Anusha Ramakrishnan 2 9 87Anveshan Chaudhary 4 9 48Anwesh Das 3 9 87Apoorva Kakkeri 4 5 49Apurva Prakash . 2 9 88Archana Ramana 2 6 88Arindam Mohanta 7 9 30Arjun Krishna Bhatt 2 11 88Arjun Hegde 11 7 18Arjun Singh 2 8 88Arnab Kumar 4 9 49Arpit Goyal 4 7 49Arpit Patni 3 8 88Arpita Ghosal 6 10 30Arun Kawatra 4 9 49Arun Panta 3 5 88Arun Sharma 10 7 18Aseem Kohli 7 6 30Ashiqul Hameed Rawther 4 8 49Ashish Gupta 3 8 89Ashutosh Pratap Singh 5 6 49Ashutosh Singh 5 2 50Ashwin Gopala Krishna Shetty 4 9 50Ashwinder Singh Sethi 3 10 89Atma Shivalanka 6 8 30Augustya Keshav Somani 4 4 50Aurelio Gutierrez Perez 3 3 89Avinash Kumar 4 9 50Avishek Chandra 4 5 50Ayush Ahuja 2 4 89Ayush Mathur 2 9 89Bart Korteweg 17 4 19Bhairav Rajnikant Shah 3 9 89Bharat Mehra 6 9 30Bharath Bevinahally Raghunath 2 9 90Bharath Bhushan Aitha 4 2 50BhargaviV 4 3 51Carlos Albert 4 3 51Chaitanya Pandey 6 5 30ChaitraliSujayJoshi 2 7 90Chandini Hundalani 4 1 51ChandraPrakashJoshi 6 8 31Chandrasekhar Samiappan 4 5 51Charulata Singal 5 5 51ChinmayJoshi 4 11 51Chirag Rakshit 4 6 52Chitra Gurnani 3 11 90Christopher Devon Garnic 4 0 52Daljeet Kaur 6 1 31Daniel Gomez Diaz-Pines 3 9 90Deepa Kelkar 5 2 52Deepa Kodur 11 0 19DeepakGopalRaoVudathala 10 11 19DeepakJ.Parayanken 2 9 90Deepak Natarajan 6 0 31Deepak Subramanian 3 3 90Deepika Seth 2 6 91Deepshikha Yadav 3 3 91Deepti Gupta 5 8 52Deepti Sen 5 9 52Dhaval Shah 4 9 52DhruvVohra 2 9 91Dipra Mukhopadhyay 4 6 53Divya Gianchandani 4 6 53Divya Singh 6 9 31

Student Name Y M Page No. Student Name Y M Page No.

Page 63: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

124 125

Divyashree 3 9 91Durga Madhab Dash 3 9 91Dyuti Barma 2 9 91Eaishvarya Sharma 4 9 53Esha Agarwal 2 9 92Farshid Aspan Cooper 3 0 92Gaurabh Gulshan 5 3 53Gaurav Arora 3 10 92Gaurav Chaturvedi 4 0 53Gaurav Ganeriwal 7 5 31Gaurav Nayyar 4 0 53Gaurav P. Sajjanhar 3 7 92Gaurav Pasricha 3 6 92Gaurav Priyadarshi 3 6 92Gaurav Sheoran 10 2 19Gaurav Shukla 11 5 19Gaurav Taragi 3 8 93Gautam Narendra Dalmia 2 6 93Gautam Sharma 2 9 93Gautham Krishnan 3 8 93Gayatri Rajagopal Tampi 3 8 93Geetesh Ahuja 3 7 93Geetika Chhabra 3 11 94Girish Malik 8 9 19Goda Chandrasekhar 8 6 20Gurpreet Singh Bedi 5 2 54Hana Al Fahoum 3 8 94HareshVazirani 2 9 94Hari Krishna Chava 3 9 94HariharanVS 2 9 94Harpreet Kaur 4 8 54Harshika Sarbajna 5 6 54Henna Mehta 3 9 94Hozefa Abbas 4 10 54Ipshita Sinha 3 9 95Ipsita Das 3 9 95JagjeetHarode 3 9 95JaideepSinghChowdhary 5 11 54JainamBharatShah 2 5 95JanakiRamakrishnan 3 3 95JapunAhluwalia 2 9 95JasdeepSinghSoni 4 9 54JayalakshmiJanakiraman 4 6 55JinceJoy 3 8 96JinuPeyeti 4 0 55JuhiDang 2 8 96JulienLevrier 3 9 96Kaja Ahmed Nawaz Mohamed Yusoof 5 9 55Kanika Pandey 5 9 55Kapila Monga 4 9 55Karan Sabharwal 4 7 55Karan Sahni 2 9 96Karan Sood 3 9 96Karn Bhugra 2 8 96Karthik Bhat 4 10 56Karthik Lakshminarayanan 4 3 56Karthik P Kishore 3 9 97KartikeyaJoshi 7 3 31Kaushik Dasgupta 4 7 56Kavita Singh 10 6 20Keisuke Matsumoto 7 0 32Khilan Haria 2 10 97Kimberly Anderson Warriah 4 6 56Komal Gurnani 4 6 56KomalJalan 3 6 97Konpal Rae 7 8 32Kota Ravi Chandra 5 10 56Krishanu Sinha 3 9 97KrishnaVenkataNagaRaoDurbha 14 8 20Kriti 2 9 97Kumar Sunny Raja 5 3 57Kunal Kapur 2 8 97

Kunal Bansal 3 9 98Kunal Garga 2 9 98Kunal Sabharwal 3 0 98Lakshmi Srikanth Koduri 4 10 57Lakshminarayan Iyer 7 11 32Laxmipat Singhi 2 11 98Lekha Ojha 4 6 57Luxsho Logan 7 0 32Madhumita N 3 0 98Madhusudanan Narayanan 5 6 57Mahesh Sridharan 4 3 57Mallika Kodali 3 5 98Manas Sharad Lodhavia 4 8 57ManasviVedhera 4 11 58Manavendra Davar 3 9 99Mandeep 5 10 58Manik Chandra 4 2 58Manika Sahni 4 6 58Manish Kumar 8 0 20Manjari 3 9 99Manjot Kaur 6 1 32Manoj Nuthakki 6 6 32Mansi Khanna 4 9 58MaulekJ.Desai 6 2 33Mayank Agarwal 2 9 99Mayank Bharat 2 10 99Mayank Rajvaidya 6 9 33Mayank Sharma 2 9 99Meenakshi Ganesh 2 10 99Megha Yethadka 3 9 100Meha Raman Grover 4 11 58Mehul Choudhary 1 0 100Mihir Deepak Bhojwani 5 7 59Mihir Shailesh Kamdar 2 3 100Mili Kapoor 2 8 100Mitalee Mulpuru 2 10 100MithilenduKumarJha 3 9 100Mohit Mittal 8 0 20Mohit Soni 4 9 59Monil Rameshchandra Ruparel 4 9 59Mrinalini Sinha 3 6 101Mrityunjay Singh 4 3 59Mudita Chauhan 3 8 101Mukta Karandikar 8 0 20MushtaqJamal 6 2 33Nadeesh Ramachandran 6 7 33Nalin Kumar Sharma 5 9 59Namit Bhandari 4 5 59Namita Pant 6 9 33Namrata Kohli 2 8 101Namrata Mehra 8 6 21NamrathaJagadish 2 10 101Narendra Kumar 6 9 33Natasha Sood 3 0 101Navdeep Gupta 3 9 101Navendu P Dogra 3 9 102Navin Kasa 4 9 60NavneetJSharma 3 2 102Navniet Sekera 11 0 21Neeharika Chenna 2 9 102Neelakash Murty 6 4 34Neeti Mishra 3 7 102Neha 2 8 102Neha 2 9 102Neha Mansukhani 6 0 34Neha Wadhawan 4 7 60Neil Ashok Taskar 6 4 34Nidhi Batra 1 9 103Nidhi Trehan 7 8 34Nihar Thanawala 6 0 34Niharika Kishore 4 6 60Nikhil Alok Goenka 3 2 103

Student Name Y M Page No. Student Name Y M Page No.

Nikhil Gupta 3 10 103Nikhil Mehta 5 9 60NikhilVerma 4 9 60Nikita Pandey 2 11 103Niloy Sadhu 5 5 60Nirajana Mishra 6 5 34Nirav Shah 1 9 103Nischinth Keshav 6 11 35Nishant Gogia 6 3 35Nishchay Chadha 3 10 103Nitesh Batra 6 9 35Niteshkumar Lalji Dudhia 8 0 21Nithin B Ramachandra 6 9 35Nithin Srinivasan 4 9 61NitinHarishJethanandani 6 8 35Nitin Mohta 3 7 104Nitin Raj 7 8 35Nitin Umanath Dubey 6 7 36Nivesh Seth 3 9 104Padmasini Renga Bashyam 5 10 61Pallavi Gupta 5 8 61Pankhuri Sakhuja 2 10 104Parikshit Deshpande 5 8 61Parshav Mathur 4 9 61Parth Awasthi 4 9 61Parthsarthi . 7 9 36ParulJindal 2 9 104Parul Srivastava 8 10 21Pawan Kumar 5 2 62Payal Bhuptani 3 9 104PearlJain 3 9 104Piyush Deepak Nahar 5 9 62Piyush Singh 3 9 105Prabhu Ramadas 3 10 105Prachee Dubey 5 0 62Pramod Menon 4 10 62Pranav Rastogi 3 1 105Prasanna Tantri Laxminarayana 5 11 62PrasannaVigneshVGanesan 5 5 62Prasanthy Gurugubelli 2 9 105Prashant Singh Sankhla 5 8 63PrashanthVenkatesh 4 9 63Prasoon Pallav 6 6 36PratibhaVaishnavi 2 9 105Preeti Kumar 2 8 105Preeti Pateria 8 3 21Prerak Bhatia 3 9 106PrernaJain 5 10 63Prerna Singh 3 9 106Pritika Idnani 4 3 63Priyanka Baxi 3 2 106Priyanka Malik 2 10 106Priyanka Mishra 2 10 106Priyanko Basu 3 11 106Puneet Gupta 9 7 21PuneetJain 5 6 63Puneet Makkad 4 8 63Rachit Rungta 5 9 64Raghav Bahl 4 7 64Raghavendra D 4 9 64Raghuram Ananthasayana 3 9 107RaghuveerVeeramachaneni 2 9 107Rahul Arora 3 4 107RahulJain 3 9 107RahulJustin 5 6 64Rahul Malik 3 2 107Rahul Prasad 3 5 107Rahul Rajappa 5 6 64Rajat Agarwal 2 9 108Rajat Sehrawat 5 3 64Rajat Sud 7 8 36Rajesh Daruka 5 9 65

Rajiv Baheti 5 7 65Rajiv Bhargava 23 3 22Rajnish Kumar 8 1 22Rakesh Krishnan 2 9 108RamachandranAV 7 11 36Ravi Agnihotri 5 6 65Ravitej Sriram 2 9 108Ridhi Kumar 2 7 108Rishabh Chopra 4 2 65Rishi Gupta 1 0 108Rishi Raj Singh 14 3 22Rishi Suri 4 0 65Ritesh Kumar Sharma 5 9 65Rohaan Kapoor 4 6 66Rohan Dayal 6 9 36Rohit Bahadur 4 9 66Roopa Datla 7 8 37Roopan Aulakh 5 9 66Roshal Dsa 4 2 66RoshanVictorJosephD’Souza 5 6 66Saad Ahmed 5 3 66Saba Bhamidipati 9 0 22Sachin Kumar Somani 4 9 67SaiPrasadVishwanathan 2 7 108Sai Swaroop Thota 4 3 67Saket Giri 4 6 67Salil Das 4 7 67SambhavJain 3 10 109Sameer Mehta 5 9 67Samhita Das Sharma 3 9 109Samyajit Das 3 9 109Sandeep Goel 5 11 67Sandeep Gupta 3 9 109Sandeep Ramakrishnappa 5 8 68Sandeep Salunkhe 3 3 109SandhyaVenkateshBoyapati 2 4 109Sandip Chaudhuri 5 9 68Sangeeth Aloysius 4 9 68Sangeetha Narasimhan 8 8 22Sanjeev A Nichani 5 1 68Sanjeev Bhalla 5 9 68Sanjeev Sharma 6 5 37Sanjit Singh Paul 4 8 68Santhosh Shankar 5 8 69Santosh Narayanan Kutty 7 3 37Santosh Narasimhan Panambur 6 9 37Santosh Reddy Nigudagi 4 7 69Santosh S Kumar 4 8 69Sarabjit Singh Dua 4 8 69Sarath Chandran 4 9 69Satish Kumar Subramani 4 10 69Satyajit Mallick 3 8 110Saumya Chandra 2 9 110SaurabhJain 2 10 110SaurabhJhamb 4 7 70Saurabh Roy 3 8 110Saurabh Sood 6 5 37SaurabhVerma 4 11 70Saurav Atri 4 9 70Sawan Sethi 4 3 70Sayak Dey 4 8 70Shailendra Hegde 3 9 110ShailendraNathJha 3 9 110Shailesh Lohia 3 10 111Shally Gupta 4 7 70Shalu Birbal Bhanwariya 3 9 111Sharon Abraham 4 2 71Shashi Ketu 5 5 71Shashvat Rai 2 2 111Shashwat Nigam 3 10 111Shaun Nicholas Lobo 3 8 111Sheetal Singh 7 9 37

Student Name Y M Page No. Student Name Y M Page No.

Page 64: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

126 127

Sheshadri Mookherjee 2 8 111Shikha Gupta 2 9 112Shikha Sharma 2 9 112Shilpa Shah 2 10 112Shivam Gupta 4 6 71Shivang D Dave 5 7 71Shivani Sharma 2 9 112Shreyans Daga 5 8 71Shruti Purohit 4 9 71Shubhadipa Sarkar 3 9 112Shubhasish Chattoraj 2 9 112Shubhra Maji 5 8 72Shuchita Pai 3 5 113Shukti Das 4 9 72Shuvashish Chatterjee 4 8 72Shyam Sunder Subramanian M 3 10 113Siddharth Rajiv Nair 5 9 72Siddharth Raman Singh 4 11 72Siddhartha Chatterji 7 11 38SiddharthaJain 2 10 113Sidhant Srivastava 2 7 113Sidharth Malhotra 3 10 113Simerjeet Singh 7 8 38Simrandeep Singh Parmar 4 8 72SindhuVKakade 4 8 73Sireesha Dandu 4 9 73SivakumarVenkataPabolu 6 5 38Smita Singla 2 9 113SmithaVijendraPurohit 5 5 73Sombit Bhattacharyya 2 9 114Somi Rai 4 11 73Sonal Dubey 3 10 114Sourabh Kukreja 6 8 38Sourav Sekhar 3 5 114Sowmya Ramakrishnan 4 9 73Sreeram Ramachandran 3 7 114Sri Krishna Chaitanya Gujjar 4 9 73SridharVishwanathan 3 7 114Srikanth Chandrasekhar 10 0 22Srikiran Srinivasa Raghavan 11 0 23Srinath Gaddam 5 5 74Srinivas Goutham Ramkumar 7 0 38Sriraman Pattabiraman 3 6 114Srishti Bakshi 2 10 115SrividyaVaranasi 3 6 115Subhadip Majumder 11 6 23Subhash Harishchandra Sumithra 4 8 74Subhashini Prasad 3 10 115Suchita Rao Ketineni 3 0 115Sudarshan Dujari 7 6 38Sudeep Laad 4 8 74Sudhir Aray 7 1 39Sudhir Sharma 5 7 74Sudip Ajit Shah 5 6 74Suhas Khullar 4 4 74Sujata Ramachandran 8 1 23Sukanya Chakraborty 3 8 115Suman Mohanty 4 9 75Sumit Khurana 10 9 23Sumit Kumar 2 6 115Sumit Maheshwari 4 9 75Sumit Sachdeva 5 8 75Sundeep Reddivari 3 6 116Suparna Dasgupta 3 11 116Supriyo Mukhopadhyay 9 8 23Suraj Kamath 6 9 39Surbhi Sachin Sawant 6 1 39SuryankaJatain 3 10 116Sushama 2 9 116Sushmita Sharma 4 8 75Swaraj Shergill 2 4 116Swathi Brahma 8 2 23

Swathi Parthasarathi 2 6 116Swetha Balasubramanian 2 7 117TanushreeJana 6 2 39Tanvi Kapoor 2 9 117Tanya Gupta 2 9 117Tara Anand 6 6 39Taru Bazaj 2 7 117Tarun Bhambra 2 4 117Thilak Ramanathan Subramanian 3 9 117Toshit Bharara 2 10 118Treasa Tomy 2 9 118TressaJoy 2 9 118Tushar Agarwal 5 8 75Tushar Bhatia 4 11 75Uday Sanganeria 5 11 76Udayan Dasgupta 3 10 118Ujjaval Gupta 3 3 118Umesh Shankar Saha 3 8 118UnniV 3 8 119Uttam Kumar Tripathi 2 9 119VaibhavArren 4 7 76VaibhavBadjatya 3 6 119VaibhavShah 2 6 119VaniMalik 3 8 119VarunChadha 3 9 119VarunHanda 4 0 76VarunJalan 2 10 120VarunRaiBansal 4 8 76VedhavalliS 4 0 76VeenaKondaveeti 2 9 120VenkataKrishnanMukundarajan 4 6 76VenkateshChannaraj 6 9 39VenkateshRangan 3 1 120VibhaAdlakha 2 9 120VibhaNaryan 3 9 120VibhutiGupta 3 0 120VijayRao 5 8 77VikasGarikipati 3 5 121VikasSaroha 4 8 77VikasShah 3 5 121VikramBeri 2 8 121VikramPradeepkumarBagepalli 3 7 121VinayHukumchand 4 2 77VinayPamnani 4 6 77VinayakKaushalThakur 2 8 121VineethGururaj 5 8 77VinodChinni 5 0 77VinodSubramanianSundaram 5 7 78VipinGupta 8 1 24VishalChadha 2 11 121VishalMotwani 5 7 78VishalSharma 5 9 78VisheshSethi 4 5 78VisweswaranGowrisankaran 5 6 78VivekanandaChowdharyKolla 13 6 24VivekSekar 4 3 78VivekShrivastava 5 5 79VivekSingh 11 0 24VivekVikramSingh 5 5 79VivekVishal 5 9 79Yamini Chandrashekhar Yavarna 3 9 122Yamini Tandon 2 6 122Yash Kumar 2 11 122Yoganand Sundararajan 6 6 40Yomika Ghanshyam Agarwal 2 9 122Yuvraj Chadha 5 8 79Zubin Gokhroo 3 9 122

Student Name Y M Page No. Student Name Y M Page No.

Page 65: POISED - placement.isb.eduplacement.isb.edu/Recruiter/StudentProfile_2010.pdf · Age distribution Avg 27 yrs 35 and above 1% 30 - 35 13% 72% Below 25 14% Work experience Avg 5 yrs

128

Governing Board

Indian School of Business, Gachibowli, Hyderabad - 500 032, IndiaPh:+914023007000,23187420,Fax:+9123007030,Email:[email protected],www.isb.edu/placement

Anil Ambani*Group Chairman and CEO Reliance Anil Dhirubhai Ambani Group

Bernard Arnault Chairman and CEO, LVMH

Rahul Bajaj* Chairman, Bajaj Auto Limited

Manvinder S Banga Operating Partner Clayton, Dubilier & Rice, LLC

Scott Bayman Former President and CEO, GE India

Riley Bechtel Chairman and CEO, Bechtel Group, Inc

Lloyd C Blankfein Chairman and CEO The Goldman Sachs Group, Inc

Sally Blount Dean, Kellogg School of Management

Ronnie Chan Chairman Hang Lung Development Company

Purnendu Chatterjee* Chairman, The Chatterjee Group

Keki Dadiseth* Chairman, Omnicom India

Michael S Dell Chairman of the Board, Dell Inc

Yogesh Deveshwar* Chairman, ITC Limited

Jurgen Fitschen Member of the Group Executive Committee Deutsche Bank AG

Adi Godrej* Chairman, The Godrej Group

Prabhu Goel Founder and Chairman, Signet Solar Inc

Rajat Gupta* Chairman, ISB; Senior Partner Emeritus McKinsey & Company, Inc

Vinita Gupta Founder, Quick Eagle Network

Vinod Gupta Founder and CEO, infoGROUP, Inc

Urs Hofmann Managing Director, Credit Suisse Group

Donald Jacobs Dean Emeritus Kellogg School of Management

Dipak Jain Former Dean, Kellogg School of Management

Uday Khemka Director, SUN Group of Companies

Vinod Khosla General Partner Kleiner Perkins Caufield & Byers

Chanda Kochhar* CEO, ICICI Bank Ltd

Bon-Moo Koo Chairman LG Chemical Ltd. / LG Electronics Inc.

Uday Kotak* Executive Vice Chairman and Managing Director Kotak Mahindra Bank Limited

Andrew Likierman Dean, London Business School

Arjun Malhotra Chairman and CEO, Headstrong Corporation

Harish Manwani* President, Asia & Africa Unilever Plc; Chairman, Hindustan Unilever Limited

Kiran Mazumdar Shaw* Chairman and Managing Director Biocon India Limited

Aman Mehta Former Chief Executive Officer, HSBC Limited

Heinz-Werner Meier Chairman of Management Board and Senior Vice President Sanofi - Aventis Deutschland GmbH

Victor Menezes Former Senior Vice Chairman, Citigroup

Lakshmi Mittal* President and CEO, ArcelorMittal

Rakesh Bharti Mittal* Vice Chairman, Bharti Enterprises

Sunil Bharti Mittal* Chairman and Managing Director Bharti Enterprises

Yoshihiko Miyauchi Chairman and CEO, Orix Corporation

Mark Moody-Stuart Director, HSBC Holdings Plc

James Murdoch Non-Executive Director and Chairman British Sky Broadcasting

Pawan Munjal* Managing Director and CEO Hero Honda Motors Limited

Sunil Kant Munjal* Managing Director Hero Corporate Services Limited

Shiv Nadar* Founder, HCL Technologies Limited

N R Narayana Murthy* Chief Mentor, Infosys Technologies Limited

Lakshmi Narayanan* Vice Chairman, Cognizant

Sanjay Nayar* CEO, KKR India

Vikram S Pandit Chief Executive Officer, Citigroup Inc

Deepak Parekh* Chairman, HDFC

Rajendra Pawar* Chairman, NIIT Limited

Teh Kok Peng President, GIC Special Investments Pte Limited

G V Prasad* Vice Chairman and Chief Executive Officer Dr Reddy’s Laboratories Ltd

N Prasad* Group Chairman, VANPIC

Atul Punj* Chairman, Punj Lloyd Limited

Srini Raju* Managing Director and Co-Founder Peepul Capital

Ajit Rangnekar Dean, Indian School of Business

Girish Reddy* Founder, Prisma Capital Partners LP

Syam Prasad Reddy* Chairman and Managing Director Indu Projects Ltd

Thomas Robertson Dean, The Wharton School

Arun Sarin Former Chief Executive Vodafone Group Plc

James Schiro Chief Executive Officer Zurich Financial Services

Ajay Shah Founder and CEO, Shah Capital Partners

Analjit Singh* Chairman and Managing Director Max India Limited

K P Singh* Chairman of the Board, DLF Limited

Pramath Raj Sinha* Founding Dean, Indian School of Business; Founder and Managing Director 9.9 Mediaworx Pvt Ltd

Charles Miller Smith Chairman of the Board, Scottish Power Plc

Martin Sorrell Chief Executive Officer, WPP Group Plc

Mallika Srinivasan* Vice Chairman Tractor and Farm Equipment Limited

Sanjay Subhedar General Partner, Storm Ventures

Rana Talwar Chairman, Sabre Capital Worldwide

Daniel Vasella Chairman of the Board Novartis International AG

Romesh Wadhwani CEO and Managing Partner Symphony Technology Group

Jacob Wallenberg Deputy Chairman Skandinaviska Enskilda Banken

Arshad Zakaria President and CEO New Vernon Capital LLC

Peter Zencke Executive Board Member, SAP AG

*Also member of the Executive Board