security supplies - seton australia · silicone wristbands • greattool for businesses,schoolsand...

SECURITY SUpplIESMaintain and secure your assets with padlocks, lockers, safes and ID cards. Keep your workplace secure with signs, cameras and alarms. Ensure your employees stay safe with ID cards and track visitors with specialised software.

Alarms – Personal & Security .......... 767

Door Locks & Exit Devices .............. 769

Fargo Card Printer ......................... 783

ID Cards & Badge Holders....... 784–785

ID Card & Retractable Key Holders ..................................787

Key Management ................... 777–779

Lanyards .............................. 786, 790

Lockers ........................................776

Locks & Padlocks ................... 774–775

Metal Detectors............................ 765

Mirrors Inspection & Observation ........................ 762–763

Safes – Theft & Fire Resistant .. 780–781

Seals & Security Tape ............ 770–773

Security Equipment ............... 766, 768

Security Markers ........................... 764

Signs .................................... 760–761

Surveillance Cameras ................... 765

Visitor Management Solutions ............................... 782–783

Wristbands ........................... 788–789

CONTENTS

Lace Width Safety Breakaway 100–249 250–499 500 & Up13mm No $1.30 $1.11 $0.91 15mm No 1.39 1.18 0.97 13mm Yes 1.40 1.21 1.01 15mm Yes 1.49 1.28 1.07

TO ORDER Specify Style No. T1174, Lace Type (Woven or Twilll), Lace Width (13mm or 15mm), Finishing (Crimp or Stitch), Lace and Print Colour, Lanyard Attachment, breakaway or standard, specify font or wording or provide logo art in EPS and Quantity.

PRICE (EX GST) Each. Minimum order of 100

For PMS colour match, double-sided printing, other widths and attachments, Please call us for a quote on 1800 65 1173.

NEWCustomised Lanyards

•A convenient way to display identification and promote your brand

•Silk screen print•Print in one colour, on one side of the lace•960mm length with either 13mm or

15mm width

Lace Type Lanyard Attachments

Lace/Print Colours Finishing

Woven LaceTubular shoelace style lace that is comfortable around the neck.

Twill LaceNon stretch lace that is ideal for printing intricate designs

White Orange Navy Blue

Purple Grey

Red Blue Black Yellow Green

Safety Breakaway

Alligator Clip

Swivel Clip (J Hook)

Split Ring

Superior Swivel Clip

Card Holder Strap

Crimp Stitch

To Order, Call us on 1800 65 1173 or Fax 1800 67 8796VB790 | Solutions for a Safe, Secure Workplace!

Security Supplies

Custom Lanyards

•Idealformulti-dayeventsorVIPticketing•Lightweightandultrastretch-resistantformaximumsecurity•Plasticsnaplockingpreventsunauthorisedtransfer•19mmx254mm(WxL)

Plastic Wristbands

TOORDER SpecifyStyleNo.S9943,ColourandQuantity.

PRICE(EXGST) $26.45(1-4),$24.15(5–9),$21.85(10&Up)Perpackof100wristbands.

Silicone Wristbands

•Greattoolforbusinesses,schoolsandcharitiestopromotetheircause

•Siliconematerial•Waterproofandlong-lasting•Reusable•60mmdiameterx12mmwidth

NEW

Blue Fluoro Orange

Red Yellow

Fluoro Pink Green

TOORDER SpecifyStyleNo.T1177,ColourandQuantity.

PRICE(EXGST) $17.80(1-9),$14.40(10-49),$12.21(50&Up)Perpackof10.

Yellow

DayGlow Orange

Red

DayGlow Green

DayGlow Pink

ColoursAvailable:

Solutions for a Safe, Secure Workplace!

Security Supplies | VB789Ask us about our Price Match Guarantee!

Wristbands

•Tear-resistantandnon-stretchTyvek®material•Tamper-evidentadhesiveclosure•Sequentiallynumbered(factoryselected)•Idealforuseineventcrowdmanagementandlargefunctions

•25mmx25mm(WxH)

Tyvek® Wristbands

Ask about our bulk event discounts, Custom logo and print options.

TOORDER SpecifyStyleNo.S9944,ColourorPatternandQuantity.

PRICE(EXGST) $13.80(1-4),$12.65(5–9Packs),$10.35(10&Up)PerPackof100.

ColoursAvailable:

Wristband Width 100–199 200–299 300–399 400–499 500 & Up

19mm $0.32 $0.26 $0.24 $0.23 $0.2225mm 0.37 0.31 0.29 0.28 0.26

TOORDER SpecifyStyleNo.T1176,WristbandWidth(19mmor25mm),WristbandColourandQuantity.

PRICE(EXGST) Each.Minimumorderof100wristbands.

Black

Day Glow Pink

Lime

White

Aqua

Day Glow Orange

Grey

Red

Blue

Gold

Purple

ColoursAvailable:

Black

Day Glow Pink

Lime

White

Aqua

Day Glow Orange

Grey

Red

Blue

Gold

Purple

Yellow

Yellow

Custom Tyvek Wristbands

•Customisationmakeswristbandshardertoreplicate•Tear-resistantandnon-stretchTyvek®material•Blackprint•Tamper-evidentadhesiveclosure•Sequentialnumbered(factoryselected)•255mmlength•SimplysupplyfontandwordingorprovidelogoartinEPSformat

Note: A one time set up charge of $50 applies for the first order of each design.

Checkered

General Admission

Striped

Tiger

Video Game

PatternsAvailable: NEW

NEW

VB788 | Solutions for a Safe, Secure Workplace!

Security Supplies Order online today at www.seton.com.au

Tyvek Wristbands

•Stylishdesign•Easyclipon/offaction•92cmcord•2.5cmimprintablearea•Twistfreefeature•Attachestoabelt

Card Clamp Fitting.

Standard.

ColourOptionsforStandardEndFittingCarabinerReels

Solid:

Blue DarkGrey

BlackWhiteRed

Transparent:

Blue PurpleRedGreen

•Blackvinylcladcase50mmdiameter•600mmstainlesssteelchain•Metalchainandsplitringattachment•Rugged,long,retractablestainlesssteelchainwillkeepkeyssecureandonhandatalltimes

•Madefrom100%recycledmaterial•Perfectforcarryingsecurityandidentificationcards

•Attachestoyourclothingorbelttokeepcardssafeand secure

•Featuresau-clipstrapandnyloncord•Extendableupto88cm

•EasierwaytodisplayyourphotoIDallowingtheconveniencetoeasilyswipeyouridbadge

•Featuresasafetybreakawayclip•FeaturesaU-clipstrapandnyloncord

•Extendableupto96cm

•Durable1200mmkevlarcord•Uniquelockabledesign•Corrosionresistant•Convertiblebeltclip/loopbackattachment

•Uniquelockablefeaturethatincreasesweightcapacity

Metal Chain Retractable

Enviro Friendly ID Retractable

Breakaway Lanyard With Retractable ID Holder

Carabiner Reels

Heavy Duty Key-Bak Retractable

TOORDER SpecifyStyleNo.A38592andQuantity.

PRICE(EXGST) $20.90Each.



TOORDER SpecifyStyleNo.T1200,Colour(BlackorBlue)andQuantity.


TOORDER SpecifyStyleNo.S9395,ColourandQuantity.

PRICE(EXGST) $2.45(1-99),$1.70(100&Up)



Reinforced ID Retractable Card Holder•Reinforcedstrapandcordmakingitmoredurablethanstandardretractables

•Beltclipatbackforeasyattachment•Extendableupto900mm

NEW

ColoursAvailable:

Black Blue



To Order, Call us on 1800 65 1173 or Fax 1800 67 8796Solutions for a Safe, Secure Workplace!

Security Supplies | VB787

Retractable Key And Card Holders

Colours Available:

Red RoyalBlue

Green BlackNavyBlue

White

Swivel Hook

Split Key Ring

Clip•Classic flat lanyard combined with safety breakaway design stopping lanyards becoming a safety hazard

•Available with clip, key ring or swivel hook end fitting•Polyester lanyard with plastic breakaway joints that snap apart

under stress and easily join back together for re-use

•Easily identify visitors on your grounds•15mm twill lanyards•4 different prints (visitor, staff, security and contractor) •Lanyards are combined with safety breakaway design

stopping lanyards becoming a safety hazard

•Great add on to our pre-printed lanyards•Visitors, contractors, security personnel or even

staff can be identified at once•Comes with pre-punched slot for lanyard and clip attachments

Breakaway Lanyards

Pre-Printed Lanyards

Pre-Printed Cards

TO ORDER Specify Style No. T0103, Style, Colour and Quantity.

PRICE (EX GST) $1.60 (30–149), $0.79 (150 & Up) Per Lanyard. Min Order 30.

TO ORDER Specify Style No. T0646, Print (Visitor, Staff, Security And Contractor) and Quantity.

PRICE (EX GST) $18.50 Per Pack of 10 and per style.

TO ORDER Specify Style No. T0788, Legend and Quantity.

PRICE (EX GST) $15.95 Per Pack Of 10 Per Style.


Security Supplies Ask us about our Price Match Guarantee!

Lanyards And Pre-Printed Cards

Portrait.

Landscape.

Fluro Orange.

•HoldsandprotectsmultipleproximityandbadgeIDcards•Constructedfromthick,flexiblevinyl•Availablein“soft”and“heavyduty”versions•Slotclosuresatthefrontandbackoftheholdertolockincardswhenusedwithlanyards

•Fitsanysizearm•Flexibleidentificationsolution•Alsoavailableinhi-visfluorescentorangefornightworkers•Cleararmbandholdersareavailablewithanavyblueband•Maximuminsertsizeis60x86mm

•Noclipsorpinstodamageclothing•Durablevinylholdersareheldinplacebyashieldedmagnetsotheywon’terasemagneticstripsonidandcreditcards

•Doublepocketholdersallowforversatilityandconvenience

Proximity Card Holders

Arm Band Badge Holders

Magnetic Card Holders

Style No. Format Vinyl 1–199 200–499 500 & UpA32322 Portrait Soft $0.79 $0.67 $0.57A32323 Landscape Soft 0.79 0.67 0.57A32324 Portrait Heavy Duty 1.05 0.94 0.79A32325 Landscape Heavy Duty 1.05 0.94 0.79

TOORDER SpecifyStyleNo.andQuantity.

PRICE(EXGST) Each.

For Lanyards, see pages 790.

Style No. Description 1–99 100 & UpA22187 Clear Arm Band Badge Holder $6.95 $4.95A22188 Fluro Orange Arm Badge Holder 7.20 5.50


PRICE(EXGST) Each.

Style No. Format 10–99 100 & UpA34186 Single Pocket Vertical $2.20 $1.55A34187 Double Pocket Vertical 2.45 1.90


PRICE(EXGST) EachHolder(Minimum10).


Security Supplies | VB785Order online today at www.seton.com.au

ID Card Holders

Portrait.

Landscape.

Slide Ejector.

Thumb Notch.

•BlackUVpremiumqualitycardholder•Dualformatbadgecanbehunginlandscapeorportraitorientation

•Dualsidedholds2cards•Eachsidehascliporlanyardattachment

•Holderprotectscardswhilemakingiteasytoremovefor use

•Rigiddesignprotectsproximitycardfrombending•Choosefromstandardthumbnotchcut-outorpremiumholderwithslideejectortominimiseslidingfriction

•Fitsupto2creditcardsizedcards•PolycarbonatedispenserwithfrostyfinishhelpspreventUVraysfromfadingcards

•ProtectexpensiveIDandproximitycards•Sturdyplasticholdersholdupto2standardthicknesscreditcardsizedcards

•Madeofclearmouldedplasticwithaslottoaccommodatealanyardorcardclip

•Tamper-evidentpermanentlockcase•Dimensions:54x85.7mm(WxL)

Centered slot and holes for attaching lanyard or clip (see pages 786).

•Tamperproofcardandkeytohelppreventlossormisuse•ProtectsIDcardfromtampering•Endpiecesnapsintolockcardsinside

Dual Sided Deluxe Card Holder

Card Dispensers Permanent Locking Card Case

Premium Lockable Card Holder


PRICE(EXGST) $10.95PerPackof10.

TOORDER SpecifyStyleNo.T0694,Orientation(LandscapeorPortrait),Style(WithorWithoutaKey)andQuantity.


Style No. Format Insert Removal 1–99 100–249 250 & UpA32316 Portrait Side Thumb Notch $1.65 $1.40 $1.10A32318 Portrait Top Slide Ejector 2.40 2.10 1.85A32319 Landscape Side Slide Ejector 2.40 2.10 1.85


PRICE(EXGST) Each.

TOORDER SpecifyStyleNo.A32320(Portrait)orA32321(Landscape)andQuantity.

PRICE(EXGST) $21.50(1–10),$18.50(11–19),$17.20(20&Up).Pack10.


Security Supplies

ID Card Holders

Fargo C50 PVC Card Printing System•UsetheFargoC50Printertoprintcosteffective,highqualitycards

•FargoC50printerisbackedbyatwoyearwarranty•IncludeseasytouseAsureIDsolocardsoftwaretodesignyourourowncards

•Manageyourdatausingtheinternaldatabase•AssureIDSoftwarecomeswith2yearfreetechnical support

NEW

Part No. Description PriceA44550 Fargo C50 Solo Package $1,599.00A41601 Full Colour Ribbon - Roll of 250 99.00A36997 Standard CR80 PVC cards - Pack of 100 23.00A41602 Cleaning Kit 45.95


PRICE(EXGST) Each.

Description Fargo C50 Solo PackageA44550

Fargo C50 card printer Yes

Colour ribbon - EZ cartridge 1 ribbon (100 cards)

Ultracard premium PVC cards 100 cards

Web camera Yes

Asure ID® card personalisation software with 2-year Asure ID Protect Plan

Yes (Solo Edition)

Card personalisation software user requirements

• Requires simple-to-use card personalisation software

• Require 200 records or less• Require 8 card fields or less including images, text,

variable data• Basic card design features• No third party database integration

Printer Specifications•Edgetoedgesingle-sidedcolourorblackprinting•24secondsprintspeedforafullcolourcard•AcceptsCR79/CR80PVC,adhesiveandrewritablecards

•Hoppercapacity50input/30output•USBinterface



Fargo Card Printer

A26911

Remove liner...

and press badge together.

•Sign-insystemsimplifiessecuritycontrol•Idealforsmall,mediumorlargebusinessesforvisitor access control

•TIMEbadge®Technologyensuresyourpassesexpireafter 24hours

•Featuresonepackof25badgesheets(300badges),onepackof25carbon-backedlogsheets(300individuallogs)andoneclipboard

•Theeasiestwaytoissuesecurebadges•Pre-assembledtime–dependentbadges•Noeffortrequired•Quickandconvenient•Dimensions:76x50mmSimply remove liner from the FRONTpart and press onto the BACKpart to activate the expiration process. There is no simpler way to protect the security of your workers. Badge readily accepts pen or markers.

Expiring Visitor Sign-In System

ONEstep TIMEbadge®

Style No. Description PriceA26911 Visitor Sign-In System $199.00A26912 300 Visitor Badges (25 Sheets) 1,025.00 A26913 300 One-Day "V" Timespots 73.00A29431 25 Visitor Logsheets (300 Records) 54.00


PRICE(EXGST) Each.

Style No. Description Qty PriceA26820 ONEstep TIMEbadge "Vendor" 500 $194.00A26821 ONEstep TIMEbadge "Temporary" 500 194.00A26822 ONEstep TIMEbadge "Contractor" 500 194.00

TOORDER SpecifyStyleNo.,HeaderTextandQuantity.

PRICE(EXGST) PerPack.

1. Signin – Visitors sign in at the front office

2. Affixbadge – Visitor wears label for easy identification

3. Createautomaticlog – Signing in creates identical duplicate record

4. Maintainprivacy– Label liner hides log copy from subsequent visitors

•Visitorpassesandlogbook in one•Wireboundregistrybookwithself-adhesivepaperpasses

•Passesmeasure88x45mm

•Theeasywaytotrackimportantvisitorinformation•Usetorecordvisitorstoyourpremises•Aquickandeasywaytoaccountforvisitorsinanemergency

•Attractive50pagebookholds1,000entries

Visitor Pass Registry Book Visitor Log Book

TOORDER SpecifyStyleNo.A34180(Standard)orA34181(Sign-OutStyle)andQuantity.

PRICE(EXGST) $82.30PerBook(Standard500Passes,Sign-OutStyle400Passes).





Visitor Sign-In Systems

•Electroniclockdigitalkeypad•LCDscreenlightsupwhenenteringyourpin•Lasercutsteeldoor•Designfeaturesincludeaninteriorlightwhichcomesonwhendoorisopenedandafeltliningtoprotectyourbelongings

•IncludesintuitiveLCDscreen•Featuresaddedprotectionwithreinforcedhinges,wallsanddoor•Keyareasareimpact-testedandreinforcedwithhardenedsteel•Dimensions:External:520x350x360mm(HxWxD),Internal:510x337x290mm(HxWxD),Doorwallthickness:8mmBodywallthickness:3mm,Weight:36.7kg

•Electroniclockwithdigitalkeypad•Reinforcedsteelconstruction•Concealedfixingpointsandmountingboltsincluded•Internal(LED)lightsource•Armouredsteelplatesprotectinglockingmechanism•Dimensions(HxWxD):ExternalDimensions:200x480x350mm,InternalDimensions:190x467x280mm(HxWxD)

•Onehourfireresistanceandtestedtowithstandintenseheatandhumidity

•Intelligentdigitalsecuritykeypad•1–48hourstotallockdownmode•Re-settable4–12digitalusercode•Emergencybatterycapability•16mmsteellockingboltsandhingesareprotectedwith18mmsteeldog-bolts

A scramble number input enables personal codes to be hidden within longer sequences of numbers, whilst additional access codes can be set for one time use, ensuring privacy no matter who is in the room when accessing your safe.

This purpose designed laptop safe is fitted with a digitally operated lock, a reinforced steel door and hinge and 22mm diameter motorised locking bolts for maximum security of your company assets and data. It comes complete with concealed fixing points and mounting points, operating instructions and 2 override keys.

* Additional freight charges may apply to this product.

Keeping passports, birth certificates, deeds, cards, cash and keys in a safe makes them easier for you to find, but not for thieves.Easy to operate with resettable personal code with 100,000+ possible combinations, easy to read backlit display and low battery warning.

Professional Safe

Yale Laptop Safe

Yale Fire-Rated Document Safe





Style No. Description Size (H x W x D mm)* Capacity (Litres) PriceA37798 Yale Document Safe – Medium 308 x 410 x 342 mm 16.3 $710.00A37799 Yale Document Safe – Large 420 x 352 x 433 mm 25.3 770.00A37800 Yale Document Safe – Extra Large 522 x 404 x 440 mm 36.9 815.00


PRICE(EXGST) Each.

* Size relates to external dimensions.



Safes

TO ORDER Specify Style No. A35796 and Quantity.

PRICE (EX GST) $30.80 Each.





•Keep your cash and other valuables safe and secure

•Sturdy steel construction•Dimensions: 300 x 230 x 90mm

(L x W x D)

•Deposit safe with deposit hatch •24 litre capacity •Anti-fishing device to protect deposits •Key or electronic lock

•Compact safe for the home or office•Door is made of 4mm-thick steel•18mm diameter steel bolts secure door•Removable shelf•Fitted with chubbsafe’s electronic lock•Features a steel door and body with dual plated

steel moving boltwork•Ideal security safe for home and office use•Dimensions: 250 x 350 x 250mm •Weight: 11kg•Capacity: 16L

•68 litre capacity•Internal hanging rail fits 60 files•Lockable and taper proof •Can be stacked when lid is closed•Dimensions: 630 x 450 x 315mm

(L x W x H)

Security Lock Boxes

Omega Safe

AIR15 Safe

Security Crate

Style No. Description PriceA37779 Deposit Safe – Keyed Lock $920.00A37780 Deposit Safe – Electronic Lock 1,025.00

TO ORDER Specify Style No. and Quantity.

PRICE (EX GST) Each.

Ideal for protecting valuables, important documents or equipment when not in use.

DimeNSioNS (H x W x D): External: 455 x 340 x 380Internal: 240 x 325 x 305Max deposit size: 80 x 265 x 220



Safes And Secure Storage

Colours Available:

Black Yellow Red Blue Green White

Colours Available:

Red Blue

Style No. Description PriceA26887 Key Box w/ Glass Panel, Hammer And Chain $35.95A26888 Replacement Glass 10.20A38819 Key Box w/ Acrylic Panel, Hammer And Chain 35.95A38820 Replacement Acrylic 10.20



•Makes keys accessible yet deters casual use•Rugged steel boxes finished in red•Comes in either glass or acrylic panels•Supplied with hammer, chain and 2 keys•Replacement panels available in glass or acrylic for

separate purchase•Dimensions: 150 x 120 x 80mm

•These tags are colour coded•Made from flexible moulded plastic•Available in 6 colours•Comes with blank adhesive write-on paper labels

for imprinting•Dimensions: 114 x 119mm (L x W)

•Efficient and convenient•Seals with zip security seal•Keep contents secure•Made from flame retardant

material with double stitched seams

•Dimensions: 254 x 254mm

Emergency Key Box

Reusable Key Tags

Security Wallets

TO ORDER Specify Style No. M4858 and Quantity.

PRICE (EX GST) $69.90 (1–4), $62.00 (5–9), $49.50 (10 & Up)Per Pack of 100 like colour tags. Ok to assort packs for best price.

TO ORDER Specify Style No. S8682 and Quantity.

PRICE (EX GST) $42.50 (1–4), $37.50 (5–9), $35.50 (10 & Up) Each Wallet.

Security Wallet Clip Seal •Can be used with security wallet•Printed sequential numbers •Allows for an audit train if number is

recorded and tracked•Seal is easily removed by hand


PRICE (EX GST) $159.00 per pack of 1000.

NEW



Key Management

The combination lock eliminates the need for carrying an extra key.

•Smooth,curveddoorsopenmorethan90°allowingeasyaccess

•Manufacturedfromdurable,lightweightaluminium•Pre-drilledforeasyfitting•Suppliedwith6colourcodedkeyclipsinmixedcolours•Purposebuilt,heightadjustablekeyrailsinsert•4sizestochoosefrom

•Keepkeyssecureonsite•Accommodatesmostkeyringsortags

•28hookcabinetwithcombinationlock

•Canbemountedtoawallor partition

•Steelconstructedcabinetshaveatexturedputtypowdercoatedfinishandcomesuppliedwithwhiteovalkeytags

•Dimensions:195x85x35mm(WxHxD)

•Organisetheflowofkeyswhileadding security•Choosefromfoursizesandavarietyofkeycapacities•Keycontrolsystemcomeswithwhite,durable,vulcanisedfibrekeytagsandacabinetlockwithtwokeys

•Cabinetsaremadeof0.7mmthicksteel–20gaugebodiesand18gauge doors

•Keepreturnedkeyssecure•Accommodatesmostcardandtraditionalkeytypes

•Includestwoaccesskeys•Madefromdurable,powdercoated metal

•Dimensions:195x85x35mm(WxHxD)

Aluminium Key Cabinets

Hook Key Cabinet

Wall Key Cabinet

Key Drop Box

Style No. Description Size (W x H x D) PriceA26883 12 Key Cabinet 185 x 310 x 125mm $102.90A26884 36 Key Cabinet 310 x 315 x 125mm 185.00A26885 54 Key Cabinet 310 x 315 x 125mm 256.00A26886 72 Key Cabinet 427 x 315 x 125mm 310.00


PRICE(EXGST) Each.

TOORDER KEYCLIPPACKS:SpecifyStyleNo.S9858andQuantity.






Style No. Description PriceA35820 Wall-Mounted Cabinet – 30 Key Capacity $195.00A35821 Wall-Mounted Cabinet – 80 Key Capacity 386.00A35824 Wall-Mounted Cabinet – 240 Key Capacity 668.00A35823 Wall-Mounted Cabinet – 160 Key Capacity 510.00


PRICE(EXGST) PerCabinet.

TOORDER KEYCLIPPACKS:SpecifyStyleNo.S9858andQuantity.



Security Supplies

Key Management

Colours Available:

Red Light Blue

Yellow GreenOrange Black

Belt Clip.

Cable.

Shackle.

Closing Tool.

Crimping Tool.

Cutting Tool.

•Restrict access and unauthorised key removal•Ideal for fire and police departments, prisons, armoured vehicles and more•Unique tubular locks are extremely durable•Choose from 2 styles and 6 colours

•Ensure your keys are absolutely secure•Solid stainless steel 4mm diameter rings with interlocking

ends provide maximum security•Sealing tool ensures rings cannot be removed unless cut

with bolt cutters•Withstands more than 350kg of force•Ring is engraved with unique serial number for

identificationUse rings to hang keys, workshop tools, medical equipment and other items requiring close monitoring.Easy-to-use, ergonomically designed tools use mini rollers, vice like grips and pressure handles to close and crimp ring to seal. Closing Tool pulls the ring closed and locks it in place; Crimping Tool then squeezes the connection where the two ends of the ring meet to create a permanent seal.Cutting Tool eliminates the need for bolt cutters for removal cuts through ring but will not cut anything else; ring cannot be re-used once cut. Tools Are Sold Separately

Cable Key Kop™

Nylon coated stainless steel aircraft cable with a stainless steel spring cover to prevent abrasion and kinking. Available in 200mm and 400mm cable lengths.

Shackle Key Kop™

Unique shackle style uses a 4mm stainless steel rod in either a loop (38 x 30mm) or ring (50mm dia) configuration. Shackle withdraws completely from lock body so keys may be removed from either end.

Tactical Belt Clip:For easy use with Key Kop – simply slide onto belt and hook the rings into place. Protective clip prevents ring from sliding off.

Key Kop™ Locking Key Ring

Tamper-Proof Key Rings

Style No. Description Size PriceS9859 * Cable Key Kop 200mm $46.50S9860 Cable Key Kop 400mm 51.40S9861 Loop Shackle Key Kop 38 x 30mm 39.90S9862 Ring Shackle Key Kop 50mm Dia. 44.90A29274 Tactical Belt Clip - 20.90



* Not available in Red.

Style No. Description Type Key Capacity 1–9 10–49 50 & UpA34194 25mm Dia. Ring 14 $7.78 $7.06 $6.13A34195 40mm Dia. Ring 22 8.34 7.57 6.54A34196 50mm Dia. Ring 30 9.06 8.19 7.16A34197 75mm Dia. Ring 46 9.94 9.00 8.19A34198 100mm Dia. Ring 66 10.82 9.79 8.70A34199 Closing Tool Tool - 56.65 - -A34200 Crimping Tool Tool - 199.00 - -A34201 Cutting Tool Tool - 199.00 - -


PRICE (EX GST) Each Ring or Tool.

For tamper evident labels, see page 803.

Ring is engraved with a unique serial number.



Key Management

Colours Available:

YellowRedBlue Green

•Tough polyethylene material – highly vandal resistant •Three different sizes can be stacked and nested with

marked fixing points•Locked hinge can withstand 3200N •Rustproof and waterproof•Suitable for corrosive environments such as mining,

petrochemical, agriculture and waste management•Label position and air vents on all sizes •Retro fit sloping top available •Maximum stacking height 1800mm

•High grade mild steel construction •Powdercoated with germ guard anti-bacterial paint•Pre-drilled for nesting •Fitted with camlocks •High quality glossy appearance•Locker internal dimensions: 150 x 163 x 360mm (H x W x D)

Rustproof Mix And Match Lockers

Personal Items Locker Units

Style No. Description Size (H x W x D) Weight 1–4 5–9 10 & UpT0605 Plastic Locker – Small 450 x 320 x 460mm 5.2 kg $405.00 $386.00 $355.00T0606 Plastic Locker – Medium 600 x 320 x 460mm 8 kg 460.00 435.00 405.00T0607 Plastic Locker – Large 900 x 320 x 460mm 8.9 kg 525.00 510.00 470.00

A38226 Sloping Top (Fits Small, Medium And Large Size) 150 x 320 x 460mm 1.75 kg 135.00 129.00 118.00



Style No Description Size (H x W x D) Weight PriceA38227 20 Locker Unit – 5 Rows x 4 Columns 940 x 900 x 380 55 kg $1,530.00* A38228 20 Locker Unit – 10 Rows x 2 Columns 1800 x 450 x 380 58 kg 1,620.00*A38229 28 Locker Unit – 7 Rows x 4 Columns 1285 x 900 x 380 68 kg 2,210.00*A38230 40 Locker Unit – 10 Rows x 4 Columns 1800 x 900 x 380 94 kg 2,800.00*



* Additional freight charges may apply.



Lockers

Colours Available:

RedBlue GreenBlack

Colours Available:

Red SilverBlue Green

•Strong and corrosion resistant•Lightweight•Variety of colours to choose from•50mm shackle diameter

•3-pin combination •Lightweight aluminium construction•30mm padlock body width •4.8mm shackle diameter•Ideal for securing luggage and lockers

Aluminium Industrial Grade Padlocks

Colour Finish Combination Padlocks

•High quality, industrial grade•Renowned for reliable performance•5 pin brass padlock with pin tumbler mechanism•Hardened steel shackle and 45mm lock

Compact Brass Padlock

Also available in keyed alike sets. Call us for a quote.



A20551 A36779

•User-friendly padlock offers standard to medium security options

•Features hardened steel shackles•Available in 3 pin dial combination or 4 pin re-settable

combination lock for additional security

Combination Padlocks

Style No Description PriceA36779 3-Pin Dial Combination Lock $21.00A36778 3-Pin Combination – 8mm Shackle 50.95A20551 4-Pin Combination – 9mm Shackle 57.65



TO ORDER Specify Style No. T0459 and Quantity.


TO ORDER Specify Style No. T0458, Colour and Quantity.




Security Padlocks

Prevent theft by locking unattended trailers.

•5pin,doubleboltedpadlockwithextrahardshackleforextrasecurity

•Sealedlockkeepswaterandmudout,makingitperfectforuseoutdoors

•Madefromnon-corrosivematerials•Shockabsorbingcasingpreventsscratches

•Theultimateinpadlocksecurity•Stainlesssteelbodyensuresahighlevelofcorrosionresistance

•5pintumblercylinderandhardenedsteelshackleofferahighsecuritysolutionforshedsandcontainers

•Dimensions:Shackle10mmdia.Body70mmdia.

High Security Diskus Padlock

•Manufacturedtoensuresuperiorprotectionforextremeforceapplications

•Featuresahardenedsteel5-pintumbler•Suitableforuseonsmallapplicationssuchasvendingmachinesandlargeapplicationslikesitecontainers

•Dimensions:70x18x50mm

•Rustandcorrosionresistant•Guardagainttrailertheft•Idealforcontractors,tradesmenandlandscaperstoguardagainsttrailertow-awaytheft

•Madefromchromeplates,thezincdiecastlockbodyresistsrustandcorrosion

•Fits47.6mmand50.8mmballdiametersforReese,Fulton, Valley,Attwood®Putnam,Marvel,Ideal,Acme,Dutton-lainsonandUFP

•Advancedlockingsystemresistspickingandprying

Solid Brass Monobloc Padlocks Universal Coupler Locks

Outdoor Padlock







Style No. Padlock Body Width PriceA20552 45mm $24.00A36780 50mm 34.95


PRICE(EXGST) Each.



Padlocks

•Highlyaggressivesilverreversematerial•Breaksintopieceswhenremoved•Serialnumbersarenumberedatmanufacturer•Size:125x175mm

•VOIDOPENappearsonpackagewhensealsremoved•Weatherresistant•Greatforcartonandplasticpackaging•Numbered,logoandbarcodecomestandard•Size:85x25mm

•HiddentamperevidenceSEcurItyVOIDappearswhen removed

•Idealforarchiveboxesandpackaging•50mlong

•totallyremovable•Whenremovedleavesnoadhesiveresidueon applied surface

•Weatherresistant•Numbered,logoandbarcodecomestandard•Size:110x30mm

Self Destruct Paper Label

Secure Void Seals

Total Transfer Security Tape

Non-Residue Voiding Seal

tOOrDEr SpecifyStyleNo.A40333andQuantity.

PrIcE(EXGSt) $402.00PerrollOf500Labels.


PrIcE(EXGSt) $423.00PerrollOf1000Seals.


PrIcE(EXGSt) $27.00Eachroll.


PrIcE(EXGSt) $478.00PerrollOf1000Seals.



Tamper Evident Labels And Tape

•Quickandeasytoremovebytwistingatbreak-pointon spear

•Hingespringsopentoshowevidenceoftampering•Easytoclose,onehandedoperation•Numberedatmanufacturer•Idealforfirstaidcabinets,meterboxesandbarcarts

Springlok Padlock

•SCECapprovedandISO17712/C-TPATcompliant•Uniqueplasticcoatedboltseal•Dualflexiblewireandsteelshaft•Pullstrengthover1,000kg•Stampingonnutonly•Canonlyberemovedwithboltcutters

One Seal

TOORDER SpecifyStyleNo.T0787,Colour(Blue,Green,Orange,Red,Yellow)andQuantity.

PRICE(EXGST) $409.00PerPack1000.

TOORDER SpecifyStyleNo.T0775,Colour(Blue,Green,Orange,White,Yellow)andQuantity.


TOORDER SpecifyStyleNo.T0776,Colour(Blue,Green,Red,Yellow)andQuantity.


•C-TPATcomplianthighsecurityseal•Plasticcoatingwillshowevidenceoftamperingwhilealsoprotectingagainstcorrosion

•Patentedlockingmechanismprovideseasylockingandahightensilestrength

•Lasermarkednumberingonbothboltandbody•Tensilestrength:1300kg

Snapper Seal


Security Supplies

Security Seals

•Extralargetabforadditionalinformation•Self-locking•Securegrippingprongs•Idealforpalletcages,plasticcontainers•Averagepullapartforceis49kg

•Easytoapplyadjustablestrapseal•Roundtailforsmoothinsertion•TheBI-LOKisusedforavarietyofapplicationslikesealingmeters

•9–11kgpullstrength

Grip Rip Seal Bi-Lock Seal

•Integratedbreakpointforeasyremoval•Lockingchamberensurespropersealingengagement•Numberedatmanufacture•Averagepullapartforceis16kg

•Polypropylenebodyblushestorevealsignsoftampering•Canbeusedonmeters,drums,doors,scales,bags,luggage,toteboxes,barcarts,pouchesandmore

•Heatstampedwith7digits•Factorychoosesstartingnumber

Polylock II Plastic Padlock Seal



TOORDER SpecifyStyleNo.T0773,Colour(Blue,Orange,Red,White,Yellow)andQuantity.




TOORDER SpecifyStyleNo.T0774,Colour(Blue,Green,Red)andQuantity.




Security Seals

•Australiandesignedandmanufactured•Grippingspikesforaddedsecurity•Manufacturedfromnylon•Consecutivelynumberedwith6digits

•Manufacturedfrompolypropylene•Idealforsmallbags,cashtins,chemicaldrums•Packedinmatsof10,boxesof1000•Averagebreakingstrengthis16kg•Factorychoosesstartingnumber•Dimensions:Overalllength:240mm,Operationallength:140mm,Flagsize:51x19mm

•S.C.E.CApproved•Highstrengthmetallockingchamber•Integralmetalclipprovideshighlevelofsecurity•Idealforuseonlargebagsorcages•Averagepullapartforceis40kg•Factorychoosesstartingnumber

•Approvedforuseonfireextinguishersandmedical cabinets•Doublewalllockingchamberdesignprotectsagainsttamperingattempts

•Morethan20lockingpositions•Averagepullapartforceis6.5kg

Custom Pulltight Seal

Pull Grip Numbered Seal S-Grip Seal

Pulltite Seal

TOORDER SpecifyStyleNo.T0772,Colour(Blue,Green,Red,White,Yellow)andQuantity.

PRICE(EXGST) $438.00PerPackOf1000Seals.One-TimeSetUpCustomCharge$65.00.

Style No. Description PriceT0768 Pull Tite Plain seals $256.00T0769 Pull Tite Numbered seals 305.00


PRICE(EXGST) Each.

TOORDER SpecifyStyleNo.T0770,Colour(Blue,RedYellow)andQuantity.






Pulltight Seals

*Back-check cushions slows the opening movement of the door prior to reaching final open position. Mandatory on all fire doors.

•Theperfectsolutionforhightrafficareasorwheresecurityaccesscontrolisessential

•Availableinthreestyles•Standard,withback-checkorwithholdarmopen•Featuresincludeadjustablelatchingandclosingspeed

•CompliestoAustralianStandardAS1905.1:1997,EN1125:1997,AS2331.3.1:1980,AS4145.2:1993

•Lockwood9000seriespanicexitdeviceassistsinaquickevacuationintheeventofanemergency

•Simplesingleactionrequiredtoopendoor•Anessentialaccessdeviceforsafeexitofabuilding•Availableaseitherarimforstandarddoorsorverticaltypefortalldoors

•Exitbytouchbartosuitupto900mmwidedoor

Door Closer

Panic Exit Devices

A18814A18815

•CompliestoAS4145.2-2008•Lockwood’smechanicaldigitalDXlockscontrolaccessinareaswheresecurityisparamount

•Keylesslockingmechanism•Patentedtechnology,easytoinstallanduse•Lightcommercialapplication•Nowiringorbatteriesrequired

Mechanical Digital Locks

FEATURES INCLUDE:1 x New modern styling gives a rounded organic shape1 x Stainless steel heavy gauge springs for superior durability in the clearing mechanism1 x Newly patented Anti-Sensory Feature removes the possibility to detect the active code

by touch1 x Easy re-coding with the non-reversible tumblers, ensuring that re-coding is correctly

carried out before the lock is re-fixed.

Style No. Description PriceA18814 Mechanical Digital Rimlock – Keyless Lock $439.00A18815 Mechanical Digital Tubular Latch – Keyless Lock 275.00


PRICE(EXGST) Each.Installationinstructionsincluded.

Style No. Description PriceA18812 Rim Exit Device $498.00A18813 Vertical Rod Type Device 730.00


PRICE(EXGST) Each.Installationinstructionsincluded.

Style No. Description PriceA18809 Door Closer – Standard $60.50A18810 Door Closer w/ Back-Check 60.50A18811 Door Closer w/ Hold Arm Open 76.95


PRICE(EXGST) Each.Installationinstructionsincludedwithtemplate.

For Emergency Exit Signs, see pages 339–342.



Door Accessories

High Powered Xenon Bulb. Anti-roll Bar.

Non Slip Grip.

Permanent twist on/off.

Tactical Switch/ Momentary on/off.

•Polyethylenelightweightbumpcap•Idealforsecurity,buildingandeventaccesscontrolstaff•Protectsagainstheadbumpsandscalplacerations•WithnewLEDlight(requires2xAAbatteries)

•Optionalscrew-ontrafficwand•51Lumensofcleanbrightlight,ensuremaximumcommunicationvisibility

•Runtimeof15hours,willoutlastafullworkshift,includingover-time

•Lightweightpolymerbodyiscorrosionproof,resistanttoextremetemperaturesandweather resistant

•Poweredby4xAAbatteries(notincluded)•Length:31.7mm

•Highpowerbeamwithlithiumbatteries•Constantonandmomentaryswitch•Non-slipgripwithanti-rollfeature•Includesholster,batteriesandsparebulb($30value)•Durableanodisedaluminiumcase•Offers93lumensofbrilliantwhitelight•Perfectforsecurityandlawenforcement•Dimensions:127x31mm(LxW)•Weight:320g

•Increasevisibilityofyoursecuritystaffdayornight•Lightweightvestshaveafrontvelcroclosure•Designprovideshighvisibilitywhileallowingairflowforcomfort

•Securityinhi-visprintcentredintherearofvestandonthefrontlefthandchest

•Idealforsecurity,buildingandeventaccesscontrolstaff

Security LED Bumper Cap

Recoil™ LED Traffic Wand

Tactical Xenon Light

Hi-Vis Security Vest



TOORDER SpecifyStyleNo.T0719,Size(Small–5XL)andQuantity.


Kit Contains:1 x Recoil™ LED1 x Traffic Wand4 x Coloured Discs





TOORDER REPLACEMENTBULBS:SpecifyStyleNo.A21799andQuantity.

PRICE(EXGST) $19.90Packof2.

Holster.



Security Equipment

•Easy-to-useripcordorslideactivationofalarm–earpiercing130+dB

•Doublesasakeyringsoisalwaysonhandtoprotectagainstattack

•Handytorchtolightupcarordoorkeyhole•Compact–70x35mm•12Vbatteryincluded

Bodyguard Mini Keyring Alarm With Torch



•Alarmsoundsoninactivityafteraspecifiedtimeperiod•Idealforuseinwarehouses,buildingsites,anywherepeopleareworkingremotelyoralone

•Activates130dBsirenafter4minutesofimmobilityandsoundsalarmaminutelater

•Uniquebuilt-instrobetorchalarmflashesbrightlywhenactivatedtoattractattention

•Ripcordactivation•130dBsiren•Convenienttestbuttonfacility•Fittedwithahandybelt/keyringclip•Batteryincludedprovidingupto4hourscontinuoususe

Man-Down Alarm

Bodyguard Personal Attack Alarm With Torch And Strobe Light





2 alarms in 1.



Personal Security Alarms

KIT CONTAINS:1 x External control panel1 x Siren1 x Movement activated sensor1 x Portable on/off alarm remote control unit

•Affordablesecuritysystemwithoutamonitoringservice•Easywirelessinstallation•Kitsuppliedwithmountinghardware•DIYwirelessremotecontrolledsecuritysystem•Sensordetectsmotionwithinan8mradiusandhasascanangleof1200

•Hand-heldUVlampwithstrap•Idealtocheckformarksonproperty•Providingawidebeamtoscanitemsquicklyandeffectively•DetectsUVsecuritypenmarkings

•UVmarkerpensareasimple,easytouseandeconomicaltheftdeterrent

•Idealformarkinganyvaluableproperty•ContainsspecialUVsensitiveinkthatshowsupunderultra-violetlight

•Penhasabullettipandstrokewidthof1.5–3mm

Wireless Alarm System

UV Light

UV Marker Pen








Security Supplies

Alarm Systems

A26901 A26902

A19436

A39482

A39483

A39484

•Looksjustliketherealthing,indistinguishablefrom“live”cameras•Economicaldeterrentagainsttheftandvandalism•Nowiring–installsinminutes

•Detectthepresenceofmetalwithoutfail•Batteryoperated,easytouse•EssentialforhighriskareasoreventsEnsure your facility is safe and secure and prevent any unauthorised objects entering or leaving your building. With a simple sweep across the body or bag, the metal detector can identify many objects – big and small.

Polifer*:The Piezo sound and red LED light effectively indicates the presence of metals. Automatic tuning. Supplied with a convenient safety wrist strap (Not for food purposes).

SuperWand**:Comfortable, ergonomic grip ideal for extend use. 240mm (L) scan area means you can cover large areas in a single sweep. Choice of audible or silent vibrate/LED alarm signal. One-touch button operation and 3 coloured LED indicator lights.

TacticalHand-Held**:Rugged, compact, sealed waterproof design with moulded rubber grip. Silent operation for maximum discretion. Bright LED flashlight for low light and night operations.

Internal Dome Surveillance Cameras•ProfessionalappearancedummycamerawithredflashingLED•Kitcomeswithtwohigh-visibilitywarningstickers,andincludesallnecessaryhardware

•Nocablesarerequiredforoperation,

Internal Surveillance Cameras•Largeinteriordecoycamerahasavisiblereplicaautoirislens,redLEDflashinglightandrealistic

•Anexcellentvisualdeterrenttointruders,burglarsandvandals.

External Surveillance Cameras•Theindoor/outdoorreplicainfraredCCTVcameraismodelledonpopularday/nightinfrared

•weatherproofcamerasascommonlyusedintheCCTVindustry.•Camerahasinfra-redLEDs,aflashingredLED‘monitoringin-operation’andwarninglight.

•Outdooruse,thevisibleinfra-redLEDsgivetheimpressionthatthisprofessionallookingcameradetectsinthedark

Simulated Surveillance Cameras

Hand-Held Metal Detectors

Style No. Description PriceA39482 Internal Dome Surviellance Camera $59.95A39483 Internal Surveillance Camera 72.00A39484 External Surveillance Camera 95.90


PRICE(EXGST) Each.

Style No. Description PriceA19436 Polifer Metal Detector $310.00A26901 Super Wand Metal Detector 365.00A26902 Tactical Hand Held Detector 330.00


PRICE(EXGST) Each.

*Uses 9V Battery, not included. Supplied with European AC adaptor not for use in Australasia. **Uses 9V Battery included with this item. Supplied with European AC adaptor not for use in Australasia.



Cameras And Metal Detectors

ARMS OUT TO SIDE

STAND HERE

A26893 A26895

A26897

A26894

A26896 A26898

•Giveclearindicationofwhereyouwantsomeonetostand

•Highlyvisible,deepdyed,brightyellowfootprintsprintedontoablackmat

•Hardwearingnylonyarnsetontoasmoothrubbernon-slipback

•Eyecatchingsoyourmessagewon’tbemissed

•Anti-slipsurfaceenhancessafety

•Idealforwarehouses,factoriesandoutdoorareas

•Dimensions:350x500mm

Security Floor Mat

Security Floor Markers

Style No. Description Size PriceA26899 Footprints Only Mat 585 x 890mm $149.00A26900 Footprints And Wording Mat 760 x 915mm 205.00


PRICE(EXGST) Each.



Black And White – Numbered. Coloured Bars – Un-numbered.

•Mountsnexttodoorframesforaddedsecurity•Choosefromtwostylesforquickandeasyidentification•Blackandwhiteversionismadefromreflective,highquality,durablevinyl

•Colouredversionismadefromself-adhesive,non-reflectivevinyl

•Idealforservicestations,receptionareasorbanks

Height Indicator Tape

Style No. Description Size (W x H) 1–5 6 & UpA18816 Black And White – Numbered Each 38 x 920mm $24.00 $19.95A20503 Coloured Bars – Un-Numbered Pk Of 5 25 x 410mm 29.95 21.20


PRICE(EXGST) Each.



Security Markers

•Ahighsecuritysolutiontoobservationandsurveillance•Rock,bulletandshatterresistant•Idealforprisonsandotherhighsecurityapplications•Indoorandoutdoormodelsavailable•160˚Wide-angleconvexdesignensuresthemaximumfieldofvisionpossible

•Comeswithadjustableswivelmountingbracketforeasyinstallation

•Designedtomakesecurityandsafetycheckssimpleandeasy•Extendsyourvisionwithoutcausinginjurytoyourback•Useundervehicles,machineryhighorhiddenshelvingareas•Designedinconjunctionwithpolice,armedforcesandsecuritygroups

•Availableasroundconvexorflatsquareshapesandintwosizes•Allmirrorscomeequippedwithadjustableswivelandhandlethatcanextendupto1300mm

•Strongmagnetfortemporaryfixing•Availablein12and24voltmodels•Ensuresmachineryiseasilyseen•Perfectforuseonheavyvehiclesandmachinery

Indoor/Outdoor Polycarbonate Convex Mirrors

Inspection Safety Mirror

Magnetic Base Rotating Beacon

Style No. Description Size 1–4 5–9 10 & UpA12295 Round Convex Mirror w/ Wheels 200mm Dia. $155.00 $139.50 $125.50A12296 Round Convex Mirror w/ Wheels 300mm Dia. 220.00 198.00 178.20A24693 Square Flat Mirror w/ Wheels 200mm Dia. 135.00 121.50 109.35A24694 Square Flat Mirror w/ Wheels 300mm Dia. 169.00 152.10 137.00


PRICE(EXGST) Each.

Style No. Voltage 1–5 6–9 10 & UpA33018 12 Volt $172.00 $145.00 $132.00A33019 24 Volt 172.00 145.00 132.00


PRICE(EXGST) Each.

Style No. Description Size PriceA24738 Polycarbonate – Indoor 305mm Dia. $295.00A24739 Polycarbonate – Indoor 457mm Dia. 380.00A24740 Polycarbonate – Indoor 660mm Dia. 495.00A24741 Polycarbonate – Indoor 762mm Dia. 640.00A24742 Polycarbonate – Indoor 915mm Dia. 810.00A24743 Polycarbonate – Outdoor 305mm Dia. 315.00A24744 Polycarbonate – Outdoor 457mm Dia. 415.00A24745 Polycarbonate – Outdoor 660mm Dia. 530.00A24746 Polycarbonate – Outdoor 762mm Dia. 685.00A24747 Polycarbonate – Outdoor 915mm Dia. 850.00A24846* Post Mount Attachment For Convex Mirror - 35.65


PRICE(EXGST) Each.

* For post-mounted mirrors, select the appropriate size mirror and add A24846 (post mount attachment)



Security Mirrors

Full Domes: can be suspended on chains or fastened directly to the ceiling to provide a 360˚ view. Ideal at four-way intersections. Includes D rings for ceiling attachment with screws

Half Domes: use the half domes for 180˚ view. Reduces the risk of collision at corner intersections. Comes with pre drilled holes. Screws or adhesive not included.

Quarter Domes: Use quarter domes for 90˚ view. Ideal for vision around corners, aisles, blind spots and/or entry and exit areas. Comes with pre drilled holes. Screws or adhesive not included.

•Helppreventaccidentsatintersectionsanddetertheft

•Lightweightacrylicmirror,easytoinstallwallmountabledesign

•Suitableforindooruse•Availableinsevensizes•Allmirrorscomewithinstallationinstructionsandwallmountbracket

•Durableandscratchresistantacrylicconvexmirrors

•Offerexcellentsafetyandsecurity

•Ballandswivelplateareattacheddirectlytothemirrortoreduceweightandcostlyinstallations

•Allmirrorscomewithinstructionsforinstallationandtelescopicarm

•Heavy-dutymountingbracketssupplied

•Idealforviewinglargeareasoroverheadobservation

•Useindoorsinoffices,hospitals,retail,receptionorindustrialareas

•Choosefromthreestyles

Economy Convex Safety Mirrors

Indoor Convex Mirrors

Dome Mirrors

Style No. Size 1–4 5–9 10 & UpA32976 305mm Dia. $119.00 $113.00 $107.00A32977 457mm Dia. 151.00 143.00 136.00A32978 609mm Dia. 239.00 227.00 215.00A32979 667mm Dia. 255.00 242.00 230.00A32980 762mm Dia. 343.00 326.00 309.00A32981 812mm Dia. 367.00 348.00 331.00A32982 914mm Dia. 415.00 394.00 374.00


PRICE(EXGST) Each.

Style No. Size 1–4 5–9 10 & Up A32987 457mm Dia. $279.00 $265.00 $251.00A32988 609mm Dia. 359.00 341.00 324.00A32989 812mm Dia. 583.00 554.00 526.00A32990 914mm Dia. 639.00 607.00 576.00A32991 1016mm Dia. 687.00 652.00 620.00


PRICE(EXGST) Each.

Style No. Size 1–4 5–9 10 & Up A32992 457 x 300mm $143.00 $136.00 $129.00A32993 660 x 300mm 215.00 204.00 194.00A32994 914 x 300mm 407.00 386.00 367.00


PRICE(EXGST) Each.

Style No. Size 1–4 5–9 10 & Up A32995 457mm $175.00 $166.00 $158.00A32996 660mm 255.00 242.00 230.00A32997 812mm 335.00 318.00 302.00A32998 914mm 415.00 394.00 374.00A32999 1016mm 495.00 470.00 446.00


PRICE(EXGST) Each.

Style No. Description Size 1–4 5–9 10 & UpA32983 Convex Mirror 300mm Dia. $183.00 $174.00 $ 165.00A32984 Convex Mirror 660mm Dia. 295.00 280.00 266.00A32985 Convex Mirror 760mm Dia. 391.00 371.00 353.00A32986 Indoor Rectangular Mirror 610 x 400mm 431.00 409.00 389.00


PRICE(EXGST) Each.

Buy more, save more. Call our quotes department for details.



Security Mirrors

Highly visible and informative.

S6321 S0183S6556 S6569 S6559

S6319 S6568 S6567 S6557 S6558

T0497 T0498

ALL VEHICLESMUST STOP AT

SECURITY GATE

S6544S6566S6560T0492 T0490

T0495 T0496

ALL VISITORS ARE SUBJECT

TO INSPECTION

T0493 T0494T0491

See page 513 for details.

Recycled polypropylene is commonly made into bins, pallets, sheeting and trays.

Size 1–5 6–9 10 & Up300 x 450mm $40.25 $36.30 $32.70450 x 600mm 48.75 43.90 39.50

TO ORDER Specify Style No., Size and Quantity.


Size Material 1–5 6–9 10 & Up250 x 180mm Self Adhesive Vinyl $20.80 $18.75 $16.90300 x 450mm Polypropylene 40.25 36.30 32.70300 x 450mm Metal 42.60 38.50 34.50





Security Signs

•Made from polypropylene•Serves as a ‘to the point’ statement of

your security policy

•Provides economical visual deterrent•Make vandals and criminals think twice•Ideal for use in covert areas where cameras are

not clearly visible•Comes in 3 materials to suit your requirements -

self-adhesive vinyl, polypropylene and metal

Security Notice Signs

Surveillance Signs

S0336

S0337

S0338

S0340

S0339

S0341

A21665 A21666 A21667

A26856

A26859

A26857

A26860

A26858

A26861

A21668 A21669 A21670

A21659 A21660 A21661 A21662 A21663 A21664

Internal View: Sign Transparent.

External View: Sign Visible.

T0480

T0485

T0481

T0486

T0482

T0487

T0483

T0488

T0484

T0489

See page 513 for details.


PRICE (EX GST) $39.40 (1–5), $34.15 (6 & Up) Pack of 5.



Size Material 1–5 6–9 10 & Up250 x 180mm Self Adhesive Vinyl $20.80 $18.75 $16.90225 x 300mm Polypropylene 33.90 30.50 27.50225 x 300mm Metal 38.80 34.90 31.40300 x 450mm Polypropylene 40.25 36.30 32.70300 x 450mm Metal 42.60 38.50 34.50450 x 600mm Polypropylene 48.75 43.90 39.50450 x 600mm Metal 51.35 46.30 41.70

TO ORDER Specify Style No., Size, Material and Quantity.

PRICE (EX GST) Per SIgn. OK to assort for best price.


Security Supplies

Signs And Labels

•Provides a highly visible warning to trespassers

•Ideal for use in windows or areas near surveillance equipment

•Convenient size, available in packs of five

•Made from self-stick vinyl and measure 110 x 150mm in size

•Communicate your security message•Without limiting window visibility•Readable on front side – see through from the back•Adhesive backed and measure 250 x 180mm in size

•Ensure your staff and visitors know what areas are off limits

Security/Surveillance Window Labels

See-Thru Security Labels

Restricted Area Signs

security supplies - seton australia · silicone wristbands • greattool for businesses,schoolsand...

Documents