statistical machine translation - lxmls 2020lxmls.it.pt/2015/talk_luciaspecia_lxmls.pdf ·...

126
Introduction SMT Evaluation Success stories Conclusions Statistical Machine Translation Lucia Specia [email protected] LxMLS 2015 18 July 2015 Statistical Machine Translation 1 / 71

Upload: others

Post on 31-Jul-2020

47 views

Category:

Documents


0 download

TRANSCRIPT

Page 1: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Statistical Machine Translation

Lucia Specia

[email protected]

LxMLS 201518 July 2015

Statistical Machine Translation 1 / 71

Page 2: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Outline

1 Introduction

2 SMT

3 Evaluation

4 Success stories

5 Conclusions

Some slides from Wilker Aziz, Kevin Knight, Philipp Koehn, Adam Lopez

Statistical Machine Translation 2 / 71

Page 3: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Outline

1 Introduction

2 SMT

3 Evaluation

4 Success stories

5 Conclusions

Statistical Machine Translation 3 / 71

Page 4: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Introduction

MT has been around since the early 1950s

Increasingly popular since 1990: statistical approaches

Software toolkits to build translation systems from data,e.g. Moses, cdec

Availability of large collections of data, e.g. Europarl,TAUS data

More processing power

Increasing demand for (cheap) translations - Google: 1billion translations requests/day for 200 million users

Funding for research worldwide

Exciting time for MT!

Statistical Machine Translation 4 / 71

Page 5: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Introduction

MT has been around since the early 1950s

Increasingly popular since 1990: statistical approaches

Software toolkits to build translation systems from data,e.g. Moses, cdec

Availability of large collections of data, e.g. Europarl,TAUS data

More processing power

Increasing demand for (cheap) translations - Google: 1billion translations requests/day for 200 million users

Funding for research worldwide

Exciting time for MT!

Statistical Machine Translation 4 / 71

Page 6: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Introduction

MT has been around since the early 1950s

Increasingly popular since 1990: statistical approaches

Software toolkits to build translation systems from data,e.g. Moses, cdec

Availability of large collections of data, e.g. Europarl,TAUS data

More processing power

Increasing demand for (cheap) translations - Google: 1billion translations requests/day for 200 million users

Funding for research worldwide

Exciting time for MT!

Statistical Machine Translation 4 / 71

Page 7: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Introduction

MT has been around since the early 1950s

Increasingly popular since 1990: statistical approaches

Software toolkits to build translation systems from data,e.g. Moses, cdec

Availability of large collections of data, e.g. Europarl,TAUS data

More processing power

Increasing demand for (cheap) translations - Google: 1billion translations requests/day for 200 million users

Funding for research worldwide

Exciting time for MT!

Statistical Machine Translation 4 / 71

Page 8: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Introduction

MT has been around since the early 1950s

Increasingly popular since 1990: statistical approaches

Software toolkits to build translation systems from data,e.g. Moses, cdec

Availability of large collections of data, e.g. Europarl,TAUS data

More processing power

Increasing demand for (cheap) translations - Google: 1billion translations requests/day for 200 million users

Funding for research worldwide

Exciting time for MT!

Statistical Machine Translation 4 / 71

Page 9: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Introduction

MT has been around since the early 1950s

Increasingly popular since 1990: statistical approaches

Software toolkits to build translation systems from data,e.g. Moses, cdec

Availability of large collections of data, e.g. Europarl,TAUS data

More processing power

Increasing demand for (cheap) translations - Google: 1billion translations requests/day for 200 million users

Funding for research worldwide

Exciting time for MT!

Statistical Machine Translation 4 / 71

Page 10: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Introduction

MT has been around since the early 1950s

Increasingly popular since 1990: statistical approaches

Software toolkits to build translation systems from data,e.g. Moses, cdec

Availability of large collections of data, e.g. Europarl,TAUS data

More processing power

Increasing demand for (cheap) translations - Google: 1billion translations requests/day for 200 million users

Funding for research worldwide

Exciting time for MT!

Statistical Machine Translation 4 / 71

Page 11: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Introduction

MT has been around since the early 1950s

Increasingly popular since 1990: statistical approaches

Software toolkits to build translation systems from data,e.g. Moses, cdec

Availability of large collections of data, e.g. Europarl,TAUS data

More processing power

Increasing demand for (cheap) translations - Google: 1billion translations requests/day for 200 million users

Funding for research worldwide

Exciting time for MT!

Statistical Machine Translation 4 / 71

Page 12: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

The task of Machine Translation (MT)

The boy ate an apple

O menino comeu uma maca

BUT

He said that the bottle floated into the cave

? Dijo que la botella entro a la cueva flotando

虽然 北 风 呼啸 , 但 天空 依然 十分 清澈 。

However , the sky remained clear under the strong north wind .

Statistical Machine Translation 5 / 71

Page 13: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

The task of Machine Translation (MT)

The boy ate an apple

O menino comeu uma maca

BUT

He said that the bottle floated into the cave

? Dijo que la botella entro a la cueva flotando

虽然 北 风 呼啸 , 但 天空 依然 十分 清澈 。

However , the sky remained clear under the strong north wind .

Statistical Machine Translation 5 / 71

Page 14: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

The task of Machine Translation (MT)

The boy ate an apple

O menino comeu uma maca

BUT

He said that the bottle floated into the cave

? Dijo que la botella entro a la cueva flotando

虽然 北 风 呼啸 , 但 天空 依然 十分 清澈 。

However , the sky remained clear under the strong north wind .

Statistical Machine Translation 5 / 71

Page 15: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Challenges in MT

Lexical ambiguity

Syntactic ambiguity

Pronoun resolution

Structural divergences

Idioms

e.g. He finally kicked the bucket at the hospital→ Ele finalmente bateu as botas no hospital

Multi-word expressions

e.g. Do take the long waiting list for organ donation in thiscountry into account→ Considere a longa lista de espera para doacao de

orgaos neste paıs

Statistical Machine Translation 6 / 71

Page 16: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Challenges in MT

Lexical ambiguity

Syntactic ambiguity

Pronoun resolution

Structural divergences

Idioms

e.g. He finally kicked the bucket at the hospital→ Ele finalmente bateu as botas no hospital

Multi-word expressions

e.g. Do take the long waiting list for organ donation in thiscountry into account→ Considere a longa lista de espera para doacao de

orgaos neste paıs

Statistical Machine Translation 6 / 71

Page 17: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Outline

1 Introduction

2 SMT

3 Evaluation

4 Success stories

5 Conclusions

Statistical Machine Translation 7 / 71

Page 18: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Statistical Machine Translation

Statistical Machine Translation (SMT): “learn” how togenerate translations from data

Formalised early 1990s by IBM, but idea is much older:

Warren Weaver (1949)

When I look at an article in Russian, I say: “This is reallywritten in English, but it has been coded in some strangesymbols. I will now proceed to decode.”

Inspired by WWII code-breaking, and Shannon’sInformation TheoryApproach was not feasible with early computers

Statistical Machine Translation 8 / 71

Page 19: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Statistical Machine Translation

Statistical Machine Translation (SMT): “learn” how togenerate translations from data

Formalised early 1990s by IBM, but idea is much older:

Warren Weaver (1949)

When I look at an article in Russian, I say: “This is reallywritten in English, but it has been coded in some strangesymbols. I will now proceed to decode.”

Inspired by WWII code-breaking, and Shannon’sInformation TheoryApproach was not feasible with early computers

Statistical Machine Translation 8 / 71

Page 20: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Noisy Channel Model

Noisy Channel Model

Idea developed to model communication (Shannon)

e.g. communication over an imperfect phone line

want to recover original message (here word) on basis ofdistorted signal received (here noisy word)

Statistical Machine Translation 9 / 71

Page 21: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Noisy Channel Model & SMT

Output depends probabilistically on input

To translate French (F ) into English (E ):

Given a French sentence F , search for English sentence E ∗

that maximises P(E |F )

Statistical Machine Translation 10 / 71

Page 22: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Noisy Channel Model & SMT

Find English sentence that maximizes P(E |F ), i.e.

E ∗ = argmaxE

P(E |F )

= argmaxE

P(E)·P(F |E)P(F )

Bayes Rule

P(F ) constant across different E , so:

E ∗ = argmaxE

P(E ) · P(F |E ) drop P(F)

Statistical Machine Translation 11 / 71

Page 23: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Noisy Channel Model & SMT

Find English sentence that maximizes P(E |F ), i.e.

E ∗ = argmaxE

P(E |F )

= argmaxE

P(E)·P(F |E)P(F )

Bayes Rule

P(F ) constant across different E , so:

E ∗ = argmaxE

P(E ) · P(F |E ) drop P(F)

Statistical Machine Translation 11 / 71

Page 24: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Noisy Channel Model & SMT

Find English sentence that maximizes P(E |F ), i.e.

E ∗ = argmaxE

P(E |F )

= argmaxE

P(E)·P(F |E)P(F )

Bayes Rule

P(F ) constant across different E , so:

E ∗ = argmaxE

P(E ) · P(F |E ) drop P(F)

Statistical Machine Translation 11 / 71

Page 25: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Noisy Channel Model & SMT

Find English sentence that maximizes P(E |F ), i.e.

E ∗ = argmaxE

P(E |F )

= argmaxE

P(E)·P(F |E)P(F )

Bayes Rule

P(F ) constant across different E , so:

E ∗ = argmaxE

P(E ) · P(F |E ) drop P(F)

Statistical Machine Translation 11 / 71

Page 26: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Noisy Channel Model & SMT

Find English sentence that maximizes P(E |F ), i.e.

E ∗ = argmaxE

P(E |F )

= argmaxE

P(E)·P(F |E)P(F )

Bayes Rule

P(F ) constant across different E , so:

E ∗ = argmaxE

P(E ) · P(F |E ) drop P(F)

Statistical Machine Translation 11 / 71

Page 27: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Noisy Channel Model & SMT

E ∗ = argmaxE

P(E |F ) = argmaxE

P(E ) · P(F |E )

Decomposition of P(E |F ) to P(E ) · P(F |E ) breaks theproblem in two parts:

P(F |E ) worries about picking E words that were likelyused to generate F — faithfulnessP(E ) worries about picking E words that are likely to besaid in English and that fit together — fluency

P(E ) and P(F |E ) can be trained independently: morereliable model

Statistical Machine Translation 12 / 71

Page 28: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Noisy Channel Model & SMT

E ∗ = argmaxE

P(E |F ) = argmaxE

P(E ) · P(F |E )

Decomposition of P(E |F ) to P(E ) · P(F |E ) breaks theproblem in two parts:

P(F |E ) worries about picking E words that were likelyused to generate F — faithfulnessP(E ) worries about picking E words that are likely to besaid in English and that fit together — fluency

P(E ) and P(F |E ) can be trained independently: morereliable model

Statistical Machine Translation 12 / 71

Page 29: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Main Components for Translation (F 7→ E )

Translation model (TM): P(F |E )

Faithfulness: TMs created from (large) parallel texts

Language model (LM): P(E )

Fluency: LMs created from large (fluent) targetlanguage texts

A Decoder: (argmax)

Search algorithm to find E ∗

Statistical Machine Translation 13 / 71

Page 30: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Main Components for Translation (F 7→ E )

Translation model (TM): P(F |E )

Faithfulness: TMs created from (large) parallel texts

Language model (LM): P(E )

Fluency: LMs created from large (fluent) targetlanguage texts

A Decoder: (argmax)

Search algorithm to find E ∗

Statistical Machine Translation 13 / 71

Page 31: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Main Components for Translation (F 7→ E )

Translation model (TM): P(F |E )

Faithfulness: TMs created from (large) parallel texts

Language model (LM): P(E )

Fluency: LMs created from large (fluent) targetlanguage texts

A Decoder: (argmax)

Search algorithm to find E ∗

Statistical Machine Translation 13 / 71

Page 32: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - P(F |E )

Requires a sentence-aligned bilingual corpus

e.g. European/Canadian/Hong Kong parliaments,subtitles, Bible, Web Crawl

Can we estimate P(F |E ) from entire sentences?

Statistical Machine Translation 14 / 71

Page 33: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - P(F |E )

Requires a sentence-aligned bilingual corpus

e.g. European/Canadian/Hong Kong parliaments,subtitles, Bible, Web Crawl

Can we estimate P(F |E ) from entire sentences?

Statistical Machine Translation 14 / 71

Page 34: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Break sentences into smaller units: words

Learn translation probabilities by word aligning asentence-aligned corpus:

Zenish

Uh usehUh jejjeYiguo useh

English

A homeA gardenI arrived home

Statistical Machine Translation 15 / 71

Page 35: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Break sentences into smaller units: words

Learn translation probabilities by word aligning asentence-aligned corpus:

Zenish

Uh usehUh jejjeYiguo useh

English

A homeA gardenI arrived home

Statistical Machine Translation 15 / 71

Page 36: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Break sentences into smaller units: words are a goodstarting pointLearn translation probabilities by word aligning asentence-aligned corpus:

Zenish

Uh usehUh jejjeYiguo useh

The same word happens in source 1 and 3

English

A homeA gardenI arrived home

Statistical Machine Translation 16 / 71

Page 37: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Break sentences into smaller units: words

Learn translation probabilities by word aligning asentence-aligned corpus:

Zenish

Uh usehUh jejjeYiguo useh

Could we expect the same in the target side?

English

A homeA gardenI arrived home

Statistical Machine Translation 17 / 71

Page 38: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Break sentences into smaller units: words

Learn translation probabilities by word aligning asentence-aligned corpus:

Zenish

Uh usehUh jejjeYiguo useh

English

A homeA gardenI arrived home

useh = homeStatistical Machine Translation 18 / 71

Page 39: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Break sentences into smaller units: words

Learn translation probabilities by word aligning asentence-aligned corpus:

Zenish

Uh usehUh jejjeYiguo useh

What about the contexts?

English

A homeA gardenI arrived home

Statistical Machine Translation 19 / 71

Page 40: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Break sentences into smaller units: words

Learn translation probabilities by word aligning asentence-aligned corpus:

Zenish

Uh usehUh jejjeYiguo useh

English

A homeA gardenI arrived home

We can align them: Yiguo = I; Yiguo = arrived; Uh = A

Statistical Machine Translation 20 / 71

Page 41: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Break sentences into smaller units: words

Learn translation probabilities by word aligning asentence-aligned corpus:

Zenish

Uh usehUh jejjeYiguo useh

English

A homeA gardenI arrived home

Reuse this knowledge to align more sentences: Uh = A

Statistical Machine Translation 21 / 71

Page 42: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Break sentences into smaller units: words

Learn translation probabilities by word aligning asentence-aligned corpus:

Zenish

Uh usehUh jejjeYiguo useh

English

A homeA gardenI arrived home

And the context again: jejje = garden

Statistical Machine Translation 22 / 71

Page 43: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Word-alignment:

Identify correspondences between two languages at theword level

Basis for word-based SMT, first step for other approaches

Alignment learned via Expectation Maximization (EM)

Start with all alternative word alignments as equallylikelyObserve across sentences that Zenish useh often links toEnglish home

Increase probability of this word pair aligningKnock-on effect: update alignment of other words

Iteratively redistribute probabilities, until they identifymost likely links for each word (convergence)

Statistical Machine Translation 23 / 71

Page 44: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Word alignment commonly done using IBM Models 1-5

IBM 1 is a straightforward application of EM, includingthe alignment to null token (deletion)

Finds translation probabilities for words in isolation,regardless of their position in parallel sentence

IBM 2-5 improve these distributions by considering:

Position of words in target sentence are related toposition of words in source sentence (distortion model)Some source words may be translated into multipletarget words (fertility of the words)Position of a target word may be related to position ofneighbouring words (relative distortion model)

Statistical Machine Translation 24 / 71

Page 45: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Word alignment commonly done using IBM Models 1-5

IBM 1 is a straightforward application of EM, includingthe alignment to null token (deletion)

Finds translation probabilities for words in isolation,regardless of their position in parallel sentence

IBM 2-5 improve these distributions by considering:

Position of words in target sentence are related toposition of words in source sentence (distortion model)Some source words may be translated into multipletarget words (fertility of the words)Position of a target word may be related to position ofneighbouring words (relative distortion model)

Statistical Machine Translation 24 / 71

Page 46: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

Word alignment commonly done using IBM Models 1-5

IBM 1 is a straightforward application of EM, includingthe alignment to null token (deletion)

Finds translation probabilities for words in isolation,regardless of their position in parallel sentence

IBM 2-5 improve these distributions by considering:

Position of words in target sentence are related toposition of words in source sentence (distortion model)Some source words may be translated into multipletarget words (fertility of the words)Position of a target word may be related to position ofneighbouring words (relative distortion model)

Statistical Machine Translation 24 / 71

Page 47: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

IBM1 produces a probabilistic dictionary based on entireparallel corpus:

uh a 0.90uh home 0.05uh garden 0.05useh a 0.03useh home 0.95useh I arrived 0.02jejje a 0.30jejjje garden 0.70yiguo I arrived 0.80yiguo home 0.20

Higher models estimate other probabilities: fertility,position, etc.

Statistical Machine Translation 25 / 71

Page 48: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Translation Models - Word-based SMT

At translation (decoding) time

For a new sentence to translate, take the set of translationsthat jointly maximise the whole translation probability

E ∗ = argmaxE

P(F |E )

What about the fluency in the target language?

Statistical Machine Translation 26 / 71

Page 49: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Language Models - Word-based SMT

Language model: P(E )

E ∗ = argmaxE

P(F |E ) · P(E )

Different translation options and different word orders arepossible, some are more likely to happen in E

P(E ) = probability of strings E based on relativefrequencies in a large corpus of language E

Statistical Machine Translation 27 / 71

Page 50: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Language Models - Word-based SMT

Language model: P(E )

E ∗ = argmaxE

P(F |E ) · P(E )

Different translation options and different word orders arepossible, some are more likely to happen in E

P(E ) = probability of strings E based on relativefrequencies in a large corpus of language E

Statistical Machine Translation 27 / 71

Page 51: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Language Models - Word-based SMT

E.g.:

Given the new sentence: “Yiguo la ta jejje”

Assume new dictionary entries: la = at; ta = the

Translation model could generate many possibletranslations, e.g.:

I arrived at the aI arrived at the gardenhome at the ahome at the gardenthe a at I arrived...

Score each of them according to P(E)

Statistical Machine Translation 28 / 71

Page 52: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Language Models - Word-based SMT

E.g.:

Given the new sentence: “Yiguo la ta jejje”

Assume new dictionary entries: la = at; ta = the

Translation model could generate many possibletranslations, e.g.:

I arrived at the aI arrived at the gardenhome at the ahome at the gardenthe a at I arrived...

Score each of them according to P(E)

Statistical Machine Translation 28 / 71

Page 53: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Language Models - Word-based SMT

E.g.:

Given the new sentence: “Yiguo la ta jejje”

Assume new dictionary entries: la = at; ta = the

Translation model could generate many possibletranslations, e.g.:

I arrived at the aI arrived at the gardenhome at the ahome at the gardenthe a at I arrived...

Score each of them according to P(E)

Statistical Machine Translation 28 / 71

Page 54: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Language Models - Word-based SMT

P(E ) = P(e1, e2, e3, · · · , en)= P(e1)P(e2|e1) · P(e3|e1, e2) · · ·P(en|e1, · · · , en−1)

Difficult to have reliable estimates for whole sentences →break it down into smaller sequences: n-grams

Markov assumption: only the previous n-1 wordsmatter for predicting a word. For trigram models, n = 3

' P(e1) · P(e2|e1) · P(e3|e1, e2) ·P(e4|e2, e3) · · ·P(en|en−2, en−1)

Statistical Machine Translation 29 / 71

Page 55: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Language Models - Word-based SMT

Relative frequencies to compute these probabilities. E.g.trigrams:

P(e3|e1, e2) = count(e1e2e3)count(e1e2)

P(garden|at, the) = count(at the garden)count(at the)

For candidate: I arrived at the gardenP(I |Start) · P(arrived |Start, I ) · P(at|I , arrived) ·P(the|arrived , at) ·P(garden|at, the) ·P(End |garden, the)

Smoothing, back-off models, etc. to improve over relativecounts

Statistical Machine Translation 30 / 71

Page 56: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Language Models - Word-based SMT

Relative frequencies to compute these probabilities. E.g.trigrams:

P(e3|e1, e2) = count(e1e2e3)count(e1e2)

P(garden|at, the) = count(at the garden)count(at the)

For candidate: I arrived at the gardenP(I |Start) · P(arrived |Start, I ) · P(at|I , arrived) ·P(the|arrived , at) ·P(garden|at, the) ·P(End |garden, the)

Smoothing, back-off models, etc. to improve over relativecounts

Statistical Machine Translation 30 / 71

Page 57: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Learning Language Models - Word-based SMT

Relative frequencies to compute these probabilities. E.g.trigrams:

P(e3|e1, e2) = count(e1e2e3)count(e1e2)

P(garden|at, the) = count(at the garden)count(at the)

For candidate: I arrived at the gardenP(I |Start) · P(arrived |Start, I ) · P(at|I , arrived) ·P(the|arrived , at) ·P(garden|at, the) ·P(End |garden, the)

Smoothing, back-off models, etc. to improve over relativecounts

Statistical Machine Translation 30 / 71

Page 58: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Word-based SMT – Limitations

Difficult to word-align, and hence learn a TM, forlanguages with different words orders

Considering all possible word orders – too costly, toonoisyPoor reordering model

Fertility/n-m alignments: Some languages may havedifferent notions of what counts as a word

Donaydampfshiffahrtsgesellschaftskapitaenskajuetenschluesseloch

The keyhole of the door of the cabin of the captain of a steamshipcompany operating on the Danube

Statistical Machine Translation 31 / 71

Page 59: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Word-based SMT – Limitations

Difficult to word-align, and hence learn a TM, forlanguages with different words orders

Considering all possible word orders – too costly, toonoisyPoor reordering model

Fertility/n-m alignments: Some languages may havedifferent notions of what counts as a word

Donaydampfshiffahrtsgesellschaftskapitaenskajuetenschluesseloch

The keyhole of the door of the cabin of the captain of a steamshipcompany operating on the Danube

Statistical Machine Translation 31 / 71

Page 60: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT

Most popular approach since early 2000s

No voy1 a la2 casa3 → I am not going1 to the2 house3

it seems to1 me2 → me1 parece2

Je1 ne vais pas2 a la3 maison4 → I1 am not going2 to the3 house4

Eu1 sinto saudade de voce2 → I1 miss you2

I1 miss you2 → Eu1 sinto sua falta2

natuerlich1 hat2 John3 spass am4 spiel5 → of course1 John2 has3 funwith the4 game5

More intuitive and reliable alignments

Account for reordering within the phrasesPhrases can still be reordered

Can we directly estimate phrase translation probabilitydistribution from a parallel corpus using EM?

Too many possible phrase pairs

Statistical Machine Translation 32 / 71

Page 61: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT

Most popular approach since early 2000s

No voy1 a la2 casa3 → I am not going1 to the2 house3

it seems to1 me2 → me1 parece2

Je1 ne vais pas2 a la3 maison4 → I1 am not going2 to the3 house4

Eu1 sinto saudade de voce2 → I1 miss you2

I1 miss you2 → Eu1 sinto sua falta2

natuerlich1 hat2 John3 spass am4 spiel5 → of course1 John2 has3 funwith the4 game5

More intuitive and reliable alignments

Account for reordering within the phrasesPhrases can still be reordered

Can we directly estimate phrase translation probabilitydistribution from a parallel corpus using EM?

Too many possible phrase pairs

Statistical Machine Translation 32 / 71

Page 62: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT

Most popular approach since early 2000s

No voy1 a la2 casa3 → I am not going1 to the2 house3

it seems to1 me2 → me1 parece2

Je1 ne vais pas2 a la3 maison4 → I1 am not going2 to the3 house4

Eu1 sinto saudade de voce2 → I1 miss you2

I1 miss you2 → Eu1 sinto sua falta2

natuerlich1 hat2 John3 spass am4 spiel5 → of course1 John2 has3 funwith the4 game5

More intuitive and reliable alignments

Account for reordering within the phrasesPhrases can still be reordered

Can we directly estimate phrase translation probabilitydistribution from a parallel corpus using EM?

Too many possible phrase pairs

Statistical Machine Translation 32 / 71

Page 63: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT

Most popular approach since early 2000s

No voy1 a la2 casa3 → I am not going1 to the2 house3

it seems to1 me2 → me1 parece2

Je1 ne vais pas2 a la3 maison4 → I1 am not going2 to the3 house4

Eu1 sinto saudade de voce2 → I1 miss you2

I1 miss you2 → Eu1 sinto sua falta2

natuerlich1 hat2 John3 spass am4 spiel5 → of course1 John2 has3 funwith the4 game5

More intuitive and reliable alignments

Account for reordering within the phrasesPhrases can still be reordered

Can we directly estimate phrase translation probabilitydistribution from a parallel corpus using EM?

Too many possible phrase pairs

Statistical Machine Translation 32 / 71

Page 64: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT

Most popular approach since early 2000s

No voy1 a la2 casa3 → I am not going1 to the2 house3

it seems to1 me2 → me1 parece2

Je1 ne vais pas2 a la3 maison4 → I1 am not going2 to the3 house4

Eu1 sinto saudade de voce2 → I1 miss you2

I1 miss you2 → Eu1 sinto sua falta2

natuerlich1 hat2 John3 spass am4 spiel5 → of course1 John2 has3 funwith the4 game5

More intuitive and reliable alignments

Account for reordering within the phrasesPhrases can still be reordered

Can we directly estimate phrase translation probabilitydistribution from a parallel corpus using EM?

Too many possible phrase pairs

Statistical Machine Translation 32 / 71

Page 65: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT

Most popular approach since early 2000s

No voy1 a la2 casa3 → I am not going1 to the2 house3

it seems to1 me2 → me1 parece2

Je1 ne vais pas2 a la3 maison4 → I1 am not going2 to the3 house4

Eu1 sinto saudade de voce2 → I1 miss you2

I1 miss you2 → Eu1 sinto sua falta2

natuerlich1 hat2 John3 spass am4 spiel5 → of course1 John2 has3 funwith the4 game5

More intuitive and reliable alignments

Account for reordering within the phrasesPhrases can still be reordered

Can we directly estimate phrase translation probabilitydistribution from a parallel corpus using EM?

Too many possible phrase pairs

Statistical Machine Translation 32 / 71

Page 66: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT

Most popular approach since early 2000s

No voy1 a la2 casa3 → I am not going1 to the2 house3

it seems to1 me2 → me1 parece2

Je1 ne vais pas2 a la3 maison4 → I1 am not going2 to the3 house4

Eu1 sinto saudade de voce2 → I1 miss you2

I1 miss you2 → Eu1 sinto sua falta2

natuerlich1 hat2 John3 spass am4 spiel5 → of course1 John2 has3 funwith the4 game5

More intuitive and reliable alignments

Account for reordering within the phrasesPhrases can still be reordered

Can we directly estimate phrase translation probabilitydistribution from a parallel corpus using EM?

Too many possible phrase pairs

Statistical Machine Translation 32 / 71

Page 67: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT

Most popular approach since early 2000s

No voy1 a la2 casa3 → I am not going1 to the2 house3

it seems to1 me2 → me1 parece2

Je1 ne vais pas2 a la3 maison4 → I1 am not going2 to the3 house4

Eu1 sinto saudade de voce2 → I1 miss you2

I1 miss you2 → Eu1 sinto sua falta2

natuerlich1 hat2 John3 spass am4 spiel5 → of course1 John2 has3 funwith the4 game5

More intuitive and reliable alignments

Account for reordering within the phrasesPhrases can still be reordered

Can we directly estimate phrase translation probabilitydistribution from a parallel corpus using EM?

Too many possible phrase pairs

Statistical Machine Translation 32 / 71

Page 68: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Phrases from word alignments

Extract phrase pairs that are consistent with WA

Phrase: sequence of tokens, not linguistically motivated

WA produced by IBM Models, like before, only once

reanudacion del perıodo de sesionesresumption

ofthe

session

1 resumption ↔ reanudacion

2 of the ↔ del

3 session ↔ perıodo de sesiones

Statistical Machine Translation 33 / 71

Page 69: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Phrases from word alignments

Extract phrase pairs that are consistent with WA

Phrase: sequence of tokens, not linguistically motivated

WA produced by IBM Models, like before, only once

reanudacion del perıodo de sesionesresumption

ofthe

session

1 resumption ↔ reanudacion

2 of the ↔ del

3 session ↔ perıodo de sesiones

Statistical Machine Translation 33 / 71

Page 70: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Phrases from word alignments

Extract phrase pairs that are consistent with WA

Phrase: sequence of tokens, not linguistically motivated

WA produced by IBM Models, like before, only once

reanudacion del perıodo de sesionesresumption

ofthe

session

1 resumption of the ↔ reanudacion del

2 of the session ↔ del perıodo de sesiones

3 resumption of the session ↔ reanudacion del perıodo desesiones

Statistical Machine Translation 34 / 71

Page 71: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Phrases from word alignments

Extract phrase pairs that are consistent with WA

Phrase: sequence of tokens, not linguistically motivated

WA produced by IBM Models, like before, only once

reanudacion del perıodo de sesionesresumption

ofthe

session

1 resumption of the ↔ reanudacion del

2 of the session ↔ del perıodo de sesiones

3 resumption of the session ↔ reanudacion del perıodo desesiones

Statistical Machine Translation 34 / 71

Page 72: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Phrases from word alignments

Extract phrase pairs that are consistent with WA

Phrase: sequence of tokens, not linguistically motivated

WA produced by IBM Models, like before, only once

reanudacion del perıodo de sesionesresumption

ofthe

session

1 resumption of the ↔ reanudacion del

2 of the session ↔ del perıodo de sesiones

3 resumption of the session ↔ reanudacion del perıodo desesiones

Statistical Machine Translation 35 / 71

Page 73: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Phrase probabilities

1 Extract phrase pairs from word aligned parallel corpus√

2 Extract counts of those phrases from large parallelcorpus (MLE):

φ(f |e) =count(f , e)

count(e)

3 Store phrases and their probabilities in a phrase table

Probabilistic dictionary of phrases

Statistical Machine Translation 36 / 71

Page 74: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Weighing components

E ∗ = argmaxE

P(F |E ) · P(E )

Rewriting equation for phrases:ps. LM (P(E )) remains the same: computed for n-grams

e∗ = argmaxe

∏Ii=1 φ(fi |ei) ·

∏|e|i=1 P(ei |e1 · · · ei−1)

Which component is more important?

P(F |E ) or P(E ) ?

Depends on size/quality of corpus, language-pair, etc.

In generative model: components equally important

Statistical Machine Translation 37 / 71

Page 75: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Weighing components

E ∗ = argmaxE

P(F |E ) · P(E )

Rewriting equation for phrases:ps. LM (P(E )) remains the same: computed for n-grams

e∗ = argmaxe

∏Ii=1 φ(fi |ei) ·

∏|e|i=1 P(ei |e1 · · · ei−1)

Which component is more important?

P(F |E ) or P(E ) ?

Depends on size/quality of corpus, language-pair, etc.

In generative model: components equally important

Statistical Machine Translation 37 / 71

Page 76: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Linear model

Weigh components for a given task (parallel corpus):

e∗ = argmaxe

[I∏

i=1

φ(fi |ei)λφ ·

|e|∏i=1

P(ei |e1 · · · ei−1)λLM ]

Applying log (simpler to compute):

e∗ = argmaxe

exp[ λφ

I∑i=1

log φ(fi |ei) +

λLM

|e|∑i=1

logP(ei |e1 · · · ei−1)]

Statistical Machine Translation 38 / 71

Page 77: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Linear model

Model

e∗ = argmaxe

exp∑n

i=1 λihi(f, e)

Components

1 PLM

2 φ

Weights

1 λLM2 λφ

Feature Functions

1 h1 = logPLM

2 h2 = logφ

Benefits

1 Extensible

2 Weights can be tuned, i.e., learned from examples

Statistical Machine Translation 39 / 71

Page 78: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Linear model

Model

e∗ = argmaxe

exp∑n

i=1 λihi(f, e)

Components

1 PLM

2 φ

Weights

1 λLM2 λφ

Feature Functions

1 h1 = logPLM

2 h2 = logφ

Benefits

1 Extensible

2 Weights can be tuned, i.e., learned from examples

Statistical Machine Translation 39 / 71

Page 79: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Linear model

Model

e∗ = argmaxe

exp∑n

i=1 λihi(f, e)

Components

1 PLM

2 φ

Weights

1 λLM2 λφ

Feature Functions

1 h1 = logPLM

2 h2 = logφ

Benefits

1 Extensible

2 Weights can be tuned, i.e., learned from examples

Statistical Machine Translation 39 / 71

Page 80: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Linear model

Model

e∗ = argmaxe

exp∑n

i=1 λihi(f, e)

Components

1 PLM

2 φ

Weights

1 λLM2 λφ

Feature Functions

1 h1 = logPLM

2 h2 = logφ

Benefits

1 Extensible

2 Weights can be tuned, i.e., learned from examples

Statistical Machine Translation 39 / 71

Page 81: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Linear model

Model

e∗ = argmaxe

exp∑n

i=1 λihi(f, e)

Components

1 PLM

2 φ

Weights

1 λLM2 λφ

Feature Functions

1 h1 = logPLM

2 h2 = logφ

Benefits

1 Extensible

2 Weights can be tuned, i.e., learned from examples

Statistical Machine Translation 39 / 71

Page 82: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Linear model

Common additional components h(f, e):

Direct phrase translation probabilities: φ(e|f ) extractedjust like φ(f |e)

Distance-based phrase reordering:d(starti − endi−1 − 1), for every phrase φ(fi |ei)

Exponential decaying cost function d(x) = α|x |

x = starti − endi−1 − 1: is there a gap in the translationbetween two source phrases?

Phrase penalty: constant ρ for each phrase produced;ρ < 1 to favour fewer, but longer phrases (more fluent)

Etc: ∼ 15 popular components/features

Statistical Machine Translation 40 / 71

Page 83: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Linear model

Common additional components h(f, e):

Direct phrase translation probabilities: φ(e|f ) extractedjust like φ(f |e)

Distance-based phrase reordering:d(starti − endi−1 − 1), for every phrase φ(fi |ei)

Exponential decaying cost function d(x) = α|x |

x = starti − endi−1 − 1: is there a gap in the translationbetween two source phrases?

Phrase penalty: constant ρ for each phrase produced;ρ < 1 to favour fewer, but longer phrases (more fluent)

Etc: ∼ 15 popular components/features

Statistical Machine Translation 40 / 71

Page 84: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Linear model

Decoder remains similar, now with weights associated tocomponents

Discriminative model: learn λ weights such as tominimise error in small corpus

Statistical Machine Translation 41 / 71

Page 85: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Decoding

e∗ = argmaxe

∑ni=1 λihi(f, e)

Search problem: finding the best scoring translationaccording to the model

Translation is build in sequence (left to right)Input words may be covered out of sequence (allow forreordering)

Statistical Machine Translation 42 / 71

Page 86: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Decoding

All phrases matching source words selected from phrasetable. E.g.:

J’ ai les yeux noirs .I have the eyes black .

me has them eye dark ,I have eyes espresso !I am the eyes somber .I did some black eyes .I had black eyes .I have black eyes .

black eyes I have .

Decoder selects phrases whose combination (in a givenorder) yields the highest score acc to the linear model

Statistical Machine Translation 43 / 71

Page 87: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Decoding

Incrementally construct translation hypotheses by trying outseveral possibilities:

Generating target words in sequence, from left to right

Computing the (so far) overall log-linear model scorefor each hypothesis

Pruning search space via heuristics. e.g:

Distortion limit - at most 4 positions different fromsource orderKeep only partial hypothesis that are promising, e.g.model score is close to that of the best partialhypothesis so far

Approximate search, e.g. stack-based beam search

Statistical Machine Translation 44 / 71

Page 88: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Decoding

Incrementally construct translation hypotheses by trying outseveral possibilities:

Generating target words in sequence, from left to right

Computing the (so far) overall log-linear model scorefor each hypothesis

Pruning search space via heuristics. e.g:

Distortion limit - at most 4 positions different fromsource orderKeep only partial hypothesis that are promising, e.g.model score is close to that of the best partialhypothesis so far

Approximate search, e.g. stack-based beam search

Statistical Machine Translation 44 / 71

Page 89: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Decoding

Search space

Hypothesis

Covered source words

Target (output) words

Model scoreStatistical Machine Translation 45 / 71

Page 90: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Phrase-based SMT - Tuning Parameters

Apply decoder with uniform weights to produce ann-best list of translations (e.g. top 1,000 translations)

er geht ja nicht nach hause → he does not go homeRank Translation φ(e|f ) φ(f |e) lex(e|f , a) lex(f |e, a) WP PLM Error

1 it is not under house -9.93 -19.00 -5.08 -8.22 -5 -32.22 0.82 he is not under house -7.40 -16.33 -5.01 -8.15 -5 -34.50 0.63 it is not a home -12.74 -19.29 -5.08 -8.42 -5 -28.49 0.64 it is not to go home -10.34 -20.87 -4.38 -13.11 -6 -32.53 0.85 it is not for house -17.25 -20.43 -4.90 -6.90 -5 -31.75 0.86 he is not to go home -10.95 -18.20 -4.85 -13.04 -6 -35.79 0.67 he does not home -11.84 -16.98 -3.67 -8.76 -4 -32.64 0.28 it is not packing -10.63 -17.65 -5.08 -9.89 -4 -32.26 0.89 he is not packing -8.10 -14.98 -5.01 -9.82 -4 -34.55 0.6

10 he is not for home -13.52 -17.09 -6.22 -7.82 -5 -36.70 0.4

Iteratively adapt weights to re-rank n-best translations,e.g. to make 7 appear at the topError acc. to evaluation metric (BLEU) against reftranslationMERT, PRO, MIRA...

Statistical Machine Translation 46 / 71

Page 91: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Hierarchical and Syntax-based SMT

PBSMT has trouble with long-distance reorderings

Alternative approaches to bring structure and linguisticknowledge into the transfer rules of phrase table

Statistical Machine Translation 47 / 71

Page 92: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Hierarchical and Syntax-based SMT

PBSMT has trouble with long-distance reorderings

Alternative approaches to bring structure and linguisticknowledge into the transfer rules of phrase table

Statistical Machine Translation 47 / 71

Page 93: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Hierarchical SMT - Motivation

Introduce structure into phrase-based SMT models to dealwith long-distance reordering

Ich

wer

de

Ihn

en

die

ents

pre

chen

den

An

mer

ku

ng

en

au

sha

nd

igen

Ishallbepassingontoyousomecomments

Statistical Machine Translation 48 / 71

Page 94: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Hierarchical SMT - Motivation

Introduce structure into phrase-based SMT models to dealwith long-distance reordering

Ich

wer

de

Ihn

en

die

ents

pre

chen

den

An

mer

ku

ng

en

au

sha

nd

igen

Ishallbepassingontoyousomecomments

How can we get a phrase forshall be passing on?

Statistical Machine Translation 49 / 71

Page 95: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Hierarchical SMT - Motivation

Introduce structure into phrase-based SMT models to dealwith long-distance reordering

Ich

wer

de

Ihn

en

die

ents

pre

chen

den

An

mer

ku

ng

en

au

sha

nd

igen

Ishallbepassingonto Xyou Xsome Xcomments X

How can we get a phrase forshall be passing on?

We cannot, unless we get toyou some comments along

Statistical Machine Translation 50 / 71

Page 96: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Hierarchical SMT - Motivation

Introduce structure into phrase-based SMT models to dealwith long-distance reordering

Ich

wer

de

Ihn

en

die

ents

pre

chen

den

An

mer

ku

ng

en

au

sha

nd

igen

Ishallbepassingontoyousomecomments

How can we get a phrase forshall be passing on?

We cannot, unless we get toyou some comments along

Unless we replace all thosewords by a variable

Statistical Machine Translation 51 / 71

Page 97: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Hierarchical SMT - Motivation

shall be passing on to you some commentsl

werde Ihnen die entsprechenden Anmerkungenaushandigen

shall be passing on to you some commentsl

werde Ihnen die entsprechenden Anmerkungenaushandigen

shall be passing on Xl

werde X aushandigenStatistical Machine Translation 52 / 71

Page 98: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Hierarchical SMT - basics

Learnt from word-aligned parallel corpora in the same way asbefore

Based on the fact that language has recursive structures

Phrases within other phrases treated as nonterminals:replaced by X

No linguistic constraints added - yet, some structure

Statistical Machine Translation 53 / 71

Page 99: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Hierarchical SMT - basics

Learnt from word-aligned parallel corpora in the same way asbefore

Based on the fact that language has recursive structures

Phrases within other phrases treated as nonterminals:replaced by X

No linguistic constraints added - yet, some structure

Statistical Machine Translation 53 / 71

Page 100: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Hierarchical SMT - basics

shall be passing on to you some commentsl

werde Ihnen die entsprechenden Anmerkungenaushandigen

shall be passing on X1 some commentsl

werde X1 die entsprechenden Anmerkungenaushandigen

shall be passing on X1 X2

lwerde X1 X2 aushandigen

Statistical Machine Translation 54 / 71

Page 101: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Hierarchical SMT - phrase-table

[X ]→ shall be passing on X1 X2 | werde X1 X2 aushandigen

[X ]→ shall be passing on X3 | werde X3 aushandigen

[X ]→ to you | Ihnen

[X ]→ some comments | die entsprechenden Anmerkungen

[X ]→ to you some comments | Ihnen die entsprechendenAnmerkungen

Learn a bilingual (synchronous) set of context-free rules onhow to translate F→E

Statistical Machine Translation 55 / 71

Page 102: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Syntax-based SMT

Hierarchical models are not very informative (Xs) andsuffer from an exponential number of rules

Syntax-based SMT: uses linguistic categorise to labelnodes

Syntactic parser at pre-processing time for at least onelanguage (the other could have Xs)

Learn a bilingual (synchronous) set of linguisticallyinformed context-free rules on how to translate F→E

Rules extracted acc to word-alignment, constrained byheuristics for syntax

Statistical Machine Translation 56 / 71

Page 103: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Syntax-based SMT

S

PRP

J’

VP

VB

ai

NP

DT

les

NN

yeux

JJ

noirs

S

PRP

I

VP

VB

have

NP

JJ

black

NN

eyes

J’ ai les yeux noirsIhaveblackeyes

Standard constraints on rule construction:

Single nonterminal on the left

Consistent with word-alignment

Nonterminals on the right must alignone-to-one

Statistical Machine Translation 57 / 71

Page 104: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Syntax-based SMT

Grammar

PRP → J’ | I

JJ → noirs | black

NP → les yeux JJ | JJ eyes

VP → ai NP | have NP

S → PRP VP | PRP VP

Decoding becomes a (probabilistic) parsing problem!

Statistical Machine Translation 58 / 71

Page 105: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Outline

1 Introduction

2 SMT

3 Evaluation

4 Success stories

5 Conclusions

Statistical Machine Translation 59 / 71

Page 106: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

MT evaluation metrics

For developers/researchers:

Measure progress over time

Compare MT systems

Tune model parameters

Quality =

Close to human translation

N-gram matching between system output and one ormore reference (human) translations

Statistical Machine Translation 60 / 71

Page 107: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

MT evaluation metrics

BLEU: BiLingual Evaluation Understudy

Most widely used metric

Matching of n-grams between MT and Ref: rewardssame words in equal order

Ref: the Iraqi weapons are to be handed over to the armywithin two weeks

MT: in two weeks Iraq’s weapons will give to the army

1-gram precision: 6/102-gram precision: 3/93-gram precision: 3/8

BLEU =(∏3

n=1 pn) 1

3

BLEU =(

610 ∗

39 ∗

28

) 13 = 0.368

Statistical Machine Translation 61 / 71

Page 108: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

MT evaluation metrics

BLEU: BiLingual Evaluation Understudy

Most widely used metric

Matching of n-grams between MT and Ref: rewardssame words in equal order

Ref: the Iraqi weapons are to be handed over to the armywithin two weeks

MT: in two weeks Iraq’s weapons will give to the army

1-gram precision: 6/102-gram precision: 3/93-gram precision: 3/8

BLEU =(∏3

n=1 pn) 1

3

BLEU =(

610 ∗

39 ∗

28

) 13 = 0.368

Statistical Machine Translation 61 / 71

Page 109: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Outline

1 Introduction

2 SMT

3 Evaluation

4 Success stories

5 Conclusions

Statistical Machine Translation 62 / 71

Page 110: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Interest in MT beyond academia

Government: U.S. (intelligence purposes); EU(societal/political/commercial purposes):

EU spends more than 300Me on human translation /year: 23 official languages (253 language pairs) in 2011

End-users: Google Translate, Bing Translator, etc.

Language industry: considerable savings with MT

Customised SMT: KantanMT, AsiaOnline, etc.

Statistical Machine Translation 63 / 71

Page 111: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Commercial interest in MT

Autodesk: productivity test (post-editing of MT) [Aut11]

2-day translation vs post-editing, 37 participants

In-house Moses (Autodesk data: software)

Time spent on each segment

Statistical Machine Translation 64 / 71

Page 112: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Commercial interest in MT

Intel - User satisfaction, unedited MT

Translation is good if customer can solve problem

MT for Customer Support websites [Int10]

Overall customer satisfaction: 75% for English→Chinese95% reduction in costProject cycle from 10 days to 1 dayCustomers in China using MT texts were more satisfiedwith support than natives using original texts (68%)!

Statistical Machine Translation 65 / 71

Page 113: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Commercial interest in MT

Intel - User satisfaction, unedited MT

Translation is good if customer can solve problem

MT for Customer Support websites [Int10]

Overall customer satisfaction: 75% for English→Chinese

95% reduction in costProject cycle from 10 days to 1 dayCustomers in China using MT texts were more satisfiedwith support than natives using original texts (68%)!

Statistical Machine Translation 65 / 71

Page 114: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Commercial interest in MT

Intel - User satisfaction, unedited MT

Translation is good if customer can solve problem

MT for Customer Support websites [Int10]

Overall customer satisfaction: 75% for English→Chinese95% reduction in costProject cycle from 10 days to 1 dayCustomers in China using MT texts were more satisfiedwith support than natives using original texts (68%)!

Statistical Machine Translation 65 / 71

Page 115: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Other uses of MT+PE

WIPO: MT for patent translation

PATENTSCOPE: customised Moseshttps://www3.wipo.int/patentscope/translate/translate.jsf

United Nations uses same workflow as WIPOEuropean Commission

Customised Moses for all EU languages [EC-13]

Technology free of charge to any PA in an EU country, orin an EU institution or agencyhttp://ec.europa.eu/dgs/translation/translationresources/machine_translation/index_en.htm

Statistical Machine Translation 66 / 71

Page 116: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Other uses of MT+PE

WIPO: MT for patent translation

PATENTSCOPE: customised Moseshttps://www3.wipo.int/patentscope/translate/translate.jsf

United Nations uses same workflow as WIPO

European Commission

Customised Moses for all EU languages [EC-13]

Technology free of charge to any PA in an EU country, orin an EU institution or agencyhttp://ec.europa.eu/dgs/translation/translationresources/machine_translation/index_en.htm

Statistical Machine Translation 66 / 71

Page 117: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Other uses of MT+PE

WIPO: MT for patent translation

PATENTSCOPE: customised Moseshttps://www3.wipo.int/patentscope/translate/translate.jsf

United Nations uses same workflow as WIPOEuropean Commission

Customised Moses for all EU languages [EC-13]

Technology free of charge to any PA in an EU country, orin an EU institution or agencyhttp://ec.europa.eu/dgs/translation/translationresources/machine_translation/index_en.htm

Statistical Machine Translation 66 / 71

Page 118: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

MT for communication

Skype Translator

Microsoft’s speech to speech translation

Pipeline:

Data cleaningPre-processing (named entity recognition)Speech recognitionSMTSpeech generation

Strong interaction componenthttps://www.microsoft.com/translator/skype.aspx

Statistical Machine Translation 67 / 71

Page 119: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Outline

1 Introduction

2 SMT

3 Evaluation

4 Success stories

5 Conclusions

Statistical Machine Translation 68 / 71

Page 120: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Conclusions

(Cheap) translation is in high demand, which cannot besupplied by human translators

MT quality is good for some languages, types of texts,applications

Popular approaches:Most language pairs: phrase-based SMT is sufficientLanguage pairs with long-distance reordering:syntax-based SMT does better

Possible improvements from:More information: linguistic (local and global),contextualBetter methods: fully discriminative, deciphering,DNNs, exact search

SOA? DNNs are a promising direction to better modelcontext, long-distance dependencies

Statistical Machine Translation 69 / 71

Page 121: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Conclusions

(Cheap) translation is in high demand, which cannot besupplied by human translators

MT quality is good for some languages, types of texts,applicationsPopular approaches:

Most language pairs: phrase-based SMT is sufficientLanguage pairs with long-distance reordering:syntax-based SMT does better

Possible improvements from:More information: linguistic (local and global),contextualBetter methods: fully discriminative, deciphering,DNNs, exact search

SOA? DNNs are a promising direction to better modelcontext, long-distance dependencies

Statistical Machine Translation 69 / 71

Page 122: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Conclusions

(Cheap) translation is in high demand, which cannot besupplied by human translators

MT quality is good for some languages, types of texts,applicationsPopular approaches:

Most language pairs: phrase-based SMT is sufficientLanguage pairs with long-distance reordering:syntax-based SMT does better

Possible improvements from:More information: linguistic (local and global),contextualBetter methods: fully discriminative, deciphering,DNNs, exact search

SOA? DNNs are a promising direction to better modelcontext, long-distance dependencies

Statistical Machine Translation 69 / 71

Page 123: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Conclusions

(Cheap) translation is in high demand, which cannot besupplied by human translators

MT quality is good for some languages, types of texts,applicationsPopular approaches:

Most language pairs: phrase-based SMT is sufficientLanguage pairs with long-distance reordering:syntax-based SMT does better

Possible improvements from:More information: linguistic (local and global),contextualBetter methods: fully discriminative, deciphering,DNNs, exact search

SOA?

DNNs are a promising direction to better modelcontext, long-distance dependencies

Statistical Machine Translation 69 / 71

Page 124: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Conclusions

(Cheap) translation is in high demand, which cannot besupplied by human translators

MT quality is good for some languages, types of texts,applicationsPopular approaches:

Most language pairs: phrase-based SMT is sufficientLanguage pairs with long-distance reordering:syntax-based SMT does better

Possible improvements from:More information: linguistic (local and global),contextualBetter methods: fully discriminative, deciphering,DNNs, exact search

SOA? DNNs are a promising direction to better modelcontext, long-distance dependencies

Statistical Machine Translation 69 / 71

Page 125: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

Statistical Machine Translation

Lucia Specia

[email protected]

LxMLS 201518 July 2015

Statistical Machine Translation 70 / 71

Page 126: Statistical Machine Translation - LxMLS 2020lxmls.it.pt/2015/Talk_LuciaSpecia_LxMLS.pdf · Statistical Machine Translation Statistical Machine Translation (SMT): \learn" how to generate

Introduction SMT Evaluation Success stories Conclusions

References I

Autodesk.

Translation and Post-Editing Productivity.In http: // translate. autodesk. com/ productivity. html , 2011.

Machine translation.

In Anabela Pereira, editor, Languages and Translation, http: // ec. europa. eu/ dgs/ translation/publications/ magazines/ languagestranslation/ documents/ issue_ 06_ en. pdf . Directorate-Generalfor Translation, 2013.

Intel.

Being Streetwise with Machine Translation in an Enterprise Neighborhood.In http: // mtmarathon2010. info/ JEC2010_ Burgett_ slides. pptx , 2010.

Statistical Machine Translation 71 / 71