the business finder 2015

1

TheR

Whangarei’s Local Business Directory

Free Publication2015/16 Issue

Proud member of:

Accommodation BUILDING Business Commercial Childcare Dining Education Fitness Health IT Marine Motoring Retail Rural SCHOOLS Services Venues Trucking

www.thebusinessfinder.co.nz

2

“connecting our future today”

Whangarei has some of the best broadband in NZ

– now it’s your turn to experience the best

Go to northpowerfi bre.co.nz check the coverage tab to see if

fi bre is at your doorstep.

Choose your preferred broadband provider and

get connected.Connections are free for most

residential premises

northpowerfi bre.co.nzAll enquiries: 0800 667 847

3


Whangarei has some of the best broadband in NZ


Go to northpowerfi bre.co.nz check the coverage tab to see if

fi bre is at your doorstep.

Choose your preferred broadband provider and



northpowerfi bre.co.nzAll enquiries: 0800 667 847

PublishersSJ Hugo Mobile: 021 1726 465 Email: [email protected]

Marguerite Hugo Mobile: 021 0259 0743 Email: [email protected]

Graphic DesignerYolandi TheronMobile: 022 063 8799Email: [email protected]

Sales Mobile: 021 0259 0743Email: [email protected]

Websitewww.thebusinessfinder.co.nzfacebook.com/thebusinessfinderAll advertisements are accepted subject to approval of copy and avail-ability of space and whilst such advertisements are accepted in good faith, the promoters disclaim all liability for trade names, trade marks used by advertisers, the proprietors reserve the right to decline, cancel or omit an advertisement at any time without assigning a reason and no liability will be accepted for loss occasioned by the failure of any advertisement to appear from any cause whatsoever, or for any errors therein. No guarantee can be made on the positioning of the advertisement. All rights reserved. The Business Finder owns all intellectual property surrounding this publication including layout, editorial, display adverts and photographs. No part of this publication may be reproduced, sold or transmitted in any form or by any means, including photocopying and recording without the written permission of the publisher.

The Business Finder team, Schalk Hugo (left), Marguerite Hugo (middle) and Yolandi Theron (right).

from the PublisherMessage

The Business Finder aims to promote Whangarei businesses using combined media solutions in the form of:• An annual, glossy business directory,• Digital signage (TV Screens) and• by featuring business listings in our online

directory – www.thebusinessfinder.co.nz

Whangarei, Heart of the North, The Rei, City of a 100 beaches…

This lovely little piece of land we live on goes by many names but for me, just one - HOME.

Since the last Business Finder published, Whangarei District has gained another spectacular bridge , a beautiful new walkway, Ultrafast broadband, big national franchises, upgrades to roads and infrastruc-ture. Regardless of how spectacular these might be, our biggest asset lies in the 1020 (estimated) new residents that decided to make Whangarei their home.

People who will support the local economy by living here. The Business Finder aims to send some of these newcomers and tourists to your business, highlighting the good service that you provide to the locals.

I often get told that word of mouth is the best form of advertising. I whole heartily agree. People talk. People talk about how good your service is – how bad your service is and how you made them feel as a customer. Advertising gives everybody an equal opportunity to tell the public why they should support you. This is where The Business Finder serves to give you, the con-sumer, the choice of what the local economy has to offer and the opportunity to measure them up against their opposition.

A big thank you to all the brave, loyal business who has chosen to advertise with The Business Finder. Some of you for the first time. Most of you again. We are proud to say that we have grown 25% in the last year. I honestly do appreciate your support!

______________________ Marguerite Hugo Publisher

“We believe that combining these mediums is one of the most efficient and cost effective ways to get in touch with

potential customers”

4

WHANGAREI DISTRICT COUNCIL

EMERGENCY MANAGEMENT

BE PREPAREDLook after yourself and your loved ones

If you want to join the team or just find out more about it contact Victoria Randall, Civil Defence Emergency

Management Officer 09 470 1238 or [email protected]

In an emergency situation, are you prepared? Do you have food and water and resources to look after yourself and your loved ones

up to 3 days without any outside help? This is the reality of a civil defence emergency so it’s

better to be ready!

Be Prepared, Look After Yourself and Your Loved OnesIn an emergency situation, are you prepared? Do you have food and water and resources to look after your-self and your loved ones up to 3 days without any outside help? This is the reality of a civil defence emer-gency so it’s better to be ready!

Do you know the hazards that may affect the Whangarei district? The 3 major hazards for the district are:

• Flooding

• Tsunami

• Pandemic (disease)

Preparing a home and / or get away kit is recommend-ed. Storing water, 3 litres per day per person, torch, firstaidkit,face/dustmasks,essentialmedicinesanda radio with spare batteries are some of the recom-mended items. Looking after pets and animals is also important; make sure you have what you need to look after your animals too.

Northland Tsunami sirens are tested on the Sunday at the beginning and end of Daylight savings at 09.20am. Tsunami sirens mean ‘Seek Further Information’ about the situation so you can make an informed decision on how to respond. In some cases there may not be time to sound sirens, so learn about the natural warning signs of a tsunami, including the ground shaking for longer than a minute, loud roaring sound like a jet engine and the ocean going in and out unusu-ally fast. If you notice any of the natural warning signs, move to higher ground immediately.

There are other hazards which can strike anytime, for further information to help in being prepared here are some useful websites:

National Get Ready Get Thru www.getthru.govt.nzNorthland Regional Councilwww.nrc.govt.nz/civildefenceWhangarei District Councilwww.wdc.govt.nz/CommunitySafetyandSupport/CivilDefenceIf you can’t access the internet and would like to know more enquire at the Council or nearest library or telephone the Council on 09 430 4200.

Civil Defence Northland Facebook page www.facebook.com/civildefencenorthland

5

If you are not sure, always ask for th Ambulance Service first.

AMBULANCE

For emergencies call 111Deaf emergency fax 0800 16 16 10Deaf emergency textphone 0800 16 16 16

Medical Alert Patient Vitals Services 0800 42 62 85

For general enquiries about your emergency ambulance provider Contact: St John

0800 78 56 46

FIRE SERVICES

For emergencies call 111

POLICE

For emergencies call 111

CIVIL DEFENCE

See advertisement on previous page

RESCUE SERVICES

For rescue services call 111

GAS

Vector LimitedDistribution gas mains and services 0800 764 764

Transmission high pressure gas pipelines 0800 734 567

Nova Energy 0800 668 236

ANIMAL EMERGENCIES

SPCA Whangarei (24hr) 09 438 9161

ELECTRIC POWER LINE FAULTS

Northpower Faults and Outages Available 24 hours a day. 0800 10 40 40

Top Energy - Faults (Far North) 0800 867 363

RAILWAY EMERGENCIES

KiwiRail 0800 808 400

ENVIRONMENTAL POLLUTION

Environmental Hotline Northland Regional Council 0800 504 639

HOSPITAL

DHB 09 470 0000

Whangarei Hospital 09 430 4100

COUNCIL

Whangarei District Council 09 430 4200Whangarei Regional Council 09 470 1200Whangarei Library 09 430 4206

COMMUNITCATION

Telecom 0800 366 784

in an emergency

Emergency assistance anytime, anywhere for anyone throughout New Zealand.

CALL 111

Ambulance

Fire

Police

Important Phone Numbers

Emergency Numbers

6

Foreword from Mayor Sheryl Mai

Last year, in association with NorthPower Fibre, Whangarei was the first region in the country to roll out ultra fast broadband (UFB). While the connection between internet usage and your customer experience might not seem obvious, Icanassureyouitisthere,anditissignificant.

As commercial enterprises took advantage of UFB, they stole a march on othersaroundthecountryintheirabilitytooptimizedata,voiceandvideotrafficwithmorecapacity,speedandcontrol.Thishasgreatlyincreasedtheirefficiency, productivity and customer service delivery, which results in greater levels of customer satisfaction.

WhangareiconsumersalsobenefitfromourDistrict’sotherbusinessattractions.WeareclosetoAucklandwithoutthetrafficproblemsassociatedwithgettingaroundabigcity.Pricesstaylowduetocost-effectiveand easy transportation, relatively low rates and zoned commercial and industrial land being affordable and readily available.

We have a foundation of established companies as well as modern and innovative ones, including a wide and growing range of retail outlets, quality eateries, trades’ people, industries and public sector organizations.You’llfindall thebigchainstoresandsupermarketshere,alongsideboutiqueanduniqueartisan shops and markets.

To complete the happy and healthy business picture, our business people are friendly and pride themselves on delivering quality service.

This makes for a memorable customer experience for all the right reasons, and the best way to begin having that experience is to use The Business Finder. Whether you want to locate a business, compare prices or findyourlocalprovider,alltheinformationyouneedisavailableinthiseasy-to-usebook.

Ihopeyoufindreasontouseitwellandoften.Whangareibusinessesarenation-leaders,andyoucanrelyon The Business Finder to lead you to them.

Whangarei Businesses

have led the nation

Mayor Sheryl Mai

Tel: 09 430 4200 Forum North, Rust Avenue [email protected] www.wdc.govt.nz

AccommodationBed & Breakfast page 7Camping page page 7Guest Houses page page 7Holiday Rentals page page 7Hotels page page 7Luxury Tents page page 7Resorts page page 7Self-Catering page page 7Tourism Information page page 7

Beauty & FitnessBeauty Academy page 13Beauty Salons page 13Fitness pages 11,12Hair Salons pages 12-14Make Up pages 13,14Permanent Make Up pages 13,14Skincare pages 13,14Wellness pages 11-14Hypnotheraphy page 12

Building and InfrastructureBuilding Contractors pages 15 - 21Civil Works page 22Decking page 16Renovations pages 15 - 22Road Works page 22Sheds page 20

Building and Home ImprovementAluminium pages 23,24,25Architects page 124Balustrades page 25Bathrooms page 23Blinds page 23Building Material page 23Carpet & Flooring page 23Decking page 26Fencing page 27Maintenance page 27Paving page 27Roofing page 23Security Gates page 23Steel page 23

Timber page 26

Business to BusinessCatering page 29Chamber of Commerce page 31Commercial fit-outs page 30Compliance and fire Safety page 31Document storage solutions page 30Drug and Alcohol testing page 29Hardware and software page 32Hiring page 31

Careers, Education & Youth Childcare Centres pages 34-35Computer Training page 36Homebased Childcare page 35Schools pages 41-42School Uniforms page 42Tertiary Education pages 36-40

Commercial and IndustrialCranes page 48Forklifts page45Rental pages 44, 46Laundry Solutions pages 43, 91,92Tools and machinery page 44

Investment, Legal & InsuranceAccountants page pages 48,51Insurance Brokers pages 49,50Investments pages 47,49, 50,52Car insurance pages 49, 50Lawyers page 51

Marine Angling pages 56-58Camping Equipment page 58Diving pages 53, 54,55, 95Fishing Equipment pages 56-58Marine repair pages 56,57,58Outboards pages 56,57,58

Medical Ambulance Service page 5Antenatal Scan page 66Counselling pages 64-65Depression Hotline pages 64-65Hospitals page 59Marriage Counselling page 64Medical Centres pages 59,60,61,66Ophthalmologist page 62Xrays page pages 59, 66

7Content

Motoring Batteries pages 67, 69, 70, 73Tyres pages 68,69,70,71,73Shocks & Exhausts pages 67 - 73Breakdown & Accident Assistance page 69Dealerships pages 67, 71Engine Repairs pages 67 -73Fitment & Trimming pages 67-73Garages & Service Centre pages 67-73Motor Spares pages 67-73Motorbikes pages 70-71Panelbeaters page 68Parts pages 67-73Rental pages 71, 73Towing Services page 104Windscreens page 68

Real EstateEstate Agents page 25Letting Agents page 25Property Management & Investment page 24

Retail Brewing Supplies pages 75,76Catering Supplies pages 74,77Clothing pages 75, 107Confectioners pages 74,75,78Corporate Gifts and Promotional Items pages 74, 78Couture page 75Florists page 76Garden Accessories page 77Gift Shop pages 76,77,78Home furnishing page 75Kids and Baby Clothes pages 75,107Pet Products pages 75 -76

Retirement Retirement homes pages 80-81

Disability supplies pages 65, 81

Rural Equipment for sale pages 82 - 85Maintenance and repair pages 82-85Farm Insurance page 84Fencing page 83Water Services page 85Rural advise and support page 85Solar Products page 85

Services Offered Bus and coach service page 103Commercial and Industrial hireage (Bottom right-hand page advert)Corporate Clothing page 87, 91, 93Corporate Gifts page 91Funeral Services page 89Graphic Design pages 88, 91, 92Printing and Signage pages 88,91,92,93Security pages 86,90Telecommunications pages 5,89,99Libraries page 5Council page 5Recycling page 102,117Pets pages 5, 76Poison Information Centre page 5Police Stations page 5Telecommunications page 5Traffic Department page 5

Sport, Leisure and AdventureGolf Courses page 108Diving page 95Paintball page 95Rugby Clubs page 95Tree hopping page 94

TechnologyCellular Services page 96Communications pages 96-99Computer Networks pages 96-97Computer Sales & Retail page 96Computer Services pages 96-99Computer Software pages 96-97Computer Training pages 96-99Internet Service Providers pages 98-99

TruckingCourier Service pages 100, 103Bus and coach service page 103Breakdown & Accident Assistance page 104Dealerships page 102Employment page 103Manufacturing page 101Parts page 102Towing Services page 104Scrap Metal page 101Support and Advice page 103Traffic Solutions page 102

8 Content

2

Source: www.wdc.govt.nz/PlansPoliciesandBylaws

Content

TheR

Venue and Event CentresVenues pages 109-110

Rooms for hire pages 109-110

Weddings & Functions Bridal party wear page 107Caterers pages 29, 106Catering Supplies page 74, 78,106,107, 108Florists page 76Music page 107Party Hire pages 106, 107, 108

Dining Catering page 106Coffee Shops pages 112-114Deli page 114Fine Dining page 111Pizzerias pages 112, 123Pubs pages 112, 113, 123Restaurants pages 106 -114, 123Sport Bars pages 113, 123Take-Aways pages 112-114

Competitions Pages 115-116

Maps Pages 118-119

Telephone Directory Pages 120 121

2015 Calendar Page 122

9

Whangarei District Medium Projection

Shop LocalEat LocalEnjoy Local

“

“Support the local businesses who

support the area where you live, work and play.

It takes YOU tostart the trend.

10

African Safari Experience www.africansafariexperience.co.nz 240 Tirohanga Road, Kawakawa

09 404 0255

Asure Cherry Court Motor Lodgewww.cherrycourt.co.nz35 Otaika Road

09 438 3128

Discovery Settlers Hotel Whangareiwww.discoveryhotelswhangarei.co.nz61 Hatea Drive

09 438 2699

Flames International Hotel www.flameshotel.co.nz 8 Waverly Street, Onerahi

09 436 2107

Fountain Lodge Motelwww.fountainlodgemotel.co.nz17 Tarewa Road

09 438 3532

Motel Sixwww.motelsix-whangarei.co.nz153 Bank Street

09 438 9219

Kingsgate Hotel Whangareiwww.millenniumhotels.co.nz9 Riverside Drive

09 438 0284

Lodge Bordeauxwww.lodgebordeaux.co.nz361 Western Hills Drive

09 438 0404

Pilgrim Planet Guesthouse Whangareiwww.pilgrimplanet.co.nz63 Hatea Drive

09 459 1099

The Riverbank Homestay and B&[email protected]

09 946 0074

The Grand Hotelwww.grandhotel.co.nz‎2 Bank Street

09 438 4279

Whangarei TOP 10 Holiday Parkwww.whangareitop10.co.nz24 Mair St, Kensington

09 437 6856

Whangarei Central Holiday Park (formerly Alpha Holiday Park)www.whangareicentralholidaypark.co.nz34 Tarewa Rd, Morningside

09 438 6600

Accommodation

12 Beauty & FitnessBeauty & Fitness

E n d o r p h i n ’s … t h e Feel-Good MoleculeHave You Had Your Share Today?Endorphin’s are certain chemi-cals that can cross through the gaps between neurons and pass along messages from one to the next. There is a huge va-riety of endorphins and science is just beginning to tap into and understand information about their different functions and pur-poses.There is however one thing that we already know about endor-phin’s and that is their ability to make us feel oh-so-good.Certain stimuli such as food, pain or sex cause your hypothal-amus to call for endorphin’s and the cells in your body that house them heed the call. The oh-so-good feeling we associate with endorphin’s is created when they lock into “opioid receptors” (spe-cial receptor cells) and block the transmission of pain signals pro-ducing a euphoric feeling similar to opiates.Endorphin’s are personal…mean-ing that each person has differ-ent amounts of endorphin’s and what triggers an endorphin rush in one person could very well be totally absent in another.We often associate endorphin’s with “runner’s high” or strength training, but endorphin’s come into play every day. We can get a shot of endorphin’s just by eating a hot chili pepper as the endorphin’s come to our aide to ease the pain.Exercising to reduce stress or a depressed mood is powerful be-cause of the endorphin’s that are released that make us feel good. Even taking a nice long walk in nature makes us feel better so you can imagine what some challenging exercise would do as it forces the release of feel-good endorphin’s. In fact, when-ever you find that your mood is less than desirable, or you seem down in the dumps for any rea-son at all, challenging exercise is the key to getting back on track.

However, research has shown that the euphoric feeling that one experiences affectionately called “runner’s high” cannot be achieved by light-to-moderate weight training or cardiovascu-lar exercise. Only when heavy weights are used or the training incorporates sprinting or some other anaerobic exertion can “runner’s high” be experienced.Basically “runner’s high” occurs when the body crosses over to an anaerobic state from an aero-bic state and it suddenly finds itself enough oxygen to satisfy the muscles and cells crying out for it.There are so many benefits to working out and staying ac-tive on a regular basis. Not only will you experience and enjoy toned muscles, a kicking metabolism, increased sleep quality and strong immune sys-tem, but you’ll notice that you are less stressed, less anxious and just plain happier with oo-dles of energy. Studies done at Arizona State University show that exercise actually works bet-ter than meditation, relaxation, music therapy and education for releasing stress and dealing with anxiety. And, because chal-lenging exercise also helps us to sleep better, when we wake we’re ready to tackle the world with confidence.So, the next time your mood is not up to snuff…you’re feeling down in the dumps, depressed or anxious about something don’t reach for the medicine cab-inet…try a challenging workout instead. Not only does exercise change the shape of your body for the better, it has the power to change your outlook on life to a positive one. You’ll not only be healthier but you’ll be happier…you’ll feel better not just for the moment but for days on end.So, what are you waiting for? Your happiness is just a workout away.Carolyn Hansen Fitnesswww.carolynhansenfitness.com

Anytime Fitness 93-95 Walton Street anytimefitnesswhangarei.co.nz

09 438 8863

Combs ‘n’ Co Onerahi Road, Onerahi

09 436 0727

Huddleston Hypnotherapy1 James Street www.huddlestonhypnotherapy.co.nz

09 438 5367

13Beauty & FitnessBeauty & Fitness

Alpha Cuts

3/485 Kamo Road, Kamo

09 435 1833

Persona Spa 1 Dent Street www.personaspa.co

09 430 7377

6

To advertise on our website www.thebusinessfinder.co.nz

Please call or [email protected]

021 025 90743

14

Charlotte Dawn

426 Kamo Road www.charlottedawn.com

09 435 6597

Activ8 Northland16 Porowini Avenue www.activ8nz.co.nz

0508 228 488

Beauty & FitnessBeauty & Fitness

15

Building and Infrastructure

proudly sponsored by

09 430 0162www.paci�chomes.co.nz

Design and build specialistsFirst home and investmentsRetiring and downsizing

16 Building and Infrastructure

Pacific Homeswww.pacifichomes.co.nz

09 430 0162

BBS Timbers 27 Kioreroa Road www.bbstimbers.co.nz

09 438 9358

Latitude Homes 54 Casey Road, One Tree Point www.latitudehomes.co.nz

09 430 3065

GJ Gardner www.gjgardner.co.nz

09 437 5666



021 025 90743

17Building and Infrastructure Building and Infrastructure

Why Do I Need Insulation in my home?Next to proper air sealing, insulation is arguably the most important feature that contributes to your comfort and your home’s overall energy efficiency. Without proper insulation, your home needs larger, more expensive heating and cooling devices to keep you comfortable and those devices need to work harder, consuming more electricity, gas, or oil and costing you money. Think of insulation as the blanket for your home.

Where is Insulation Located and How Much Do I Need?Ideally, insulation surrounds the living area of your home forming a barrier between the living area and outdoor temperature extremes. In the energy efficiency field this is often referred to as the “building envelop”. Understanding where these barriers are (and are not) in your home and whether those barriers are sufficient is one of the top jobs of an energy auditor. Temperatures permitting, en-ergy auditors use an infrared camera to “see into” your home to identify those areas that have no or insufficient insulation.

What Type Insulation Should I Use?The type of insulation you use depends on a number of factors including:• Material Cost• Labour Cost• Accessibility of the Area to be Insulated• Material Characteristics Fiberglass Batts are typically used in new construction and in areas that are easily accessible, such as an attic.

Blown-in Cellulose (recycled/treated paper) is ideal for closed wall cavities and atop existing attic insulation.

Foam Panels are ideal as exterior building sheathing and within the band joists of your basement.

Spray or Injected Foam is ideal to fill around plumbing and electrical penetrations and band joists. Spray Foam is doubly effective as an air-sealer in these applications.

www.ccicenter.org

18

What you should ask about builders’ qualifications and trade organisations.Checking the builders’ qualificationsSome people who have been building for many years may not be qualified, i.e. they may not have done an appren-ticeship and/or trade certificate courses, but they may be very good at what they do. However, anyone can pick up a hammer and call themselves a builder without any skills or training. It would be wise to ask the builders what train-ing and qualifications they have.

Licensing of building practitionersYou can now check an electronic public register to see if your builder or tradesperson is a licensed building practi-tioner.

Being licensed provides you with an assurance that the practitioner has shown they have the skills, knowledge and experience to meet government-backed national standards.

You must use a licensed practitioner for certain important building and design work on your home (in much the same way you would hire an electrician or plumber).

Trade organisationsThere are two main trade organisation for builders, the New Zealand Certified Builders Association (CBANZ) and the Registered Master Builders Association(RMBA).

Certified Builders AssociationSome qualified builders may be members of the Certified Builders Association of New Zealand (CBANZ) which only accepts people who are qualified to CBANZ specifications, i.e. they have:• Completed their apprenticeship in carpentry prior

to 1980 and have remained actively engaged as a builder; or

• A Trade Certificate or Advanced Trade Certificate in Carpentry, or Carpentry and Joinery (or today’s equivalent), or a National Certificate or National * Certificate Advanced in Carpentry; or


19

Keith Hay Homes 4 Great North Roadwww.keithhayhomes.co.nz

09 435 1511

Rob Littlejohn Builder 1/318 Western Hills Drivewww.roblittlejohnbuilder.co.nz

09 430 0851

IDEAL Buildings 5 Bounty Place, Otaika www.idealbuildings.co.nz

09 438 8844

Fulton Hogan 21 Hewlett Street www.fultonhogan.com

09 470 0700

Bella Homes [email protected]

09 438 6399

Rob Littlejohn BUILDER 1998Ltd.

Residenti al (call in and see our range of plans) Architectural Renovati ons & Additi ons Commercial

Phone (09) 4300 851 or Mobile 0274 780 190

www.roblitt lejohnbuilder.co.nz

For all your building needs

Build right... Build strong... BuildROB LITTLEJOHN

• A Certificate in Building (NZCB); or• Any recognised overseas qualification.

Members have a Code of Practice which provides standards for all the stages of the building process. The Code requires builders to:• Only quote for a project if they have the time to take it on.• Have sufficient insurance cover for the contract.• Provide a 10-year Homefirst Builders Guarantee.• Arrange a date to return to deal with any defects which

may have arisen during the first few months of you living in the house.

Members are also bound by a Code of Ethics and Conduct which covers things like acting at all times with honesty and integrity, and complying with the law and industry standards of conduct prescribed in the Code. If you think your certified builder has acted outside the Code of Ethics and Conduct, you can make a written complaint to the CBANZ. This does not apply to contractual disputes for which you should apply the dispute provisions in the contract.

Building and Infrastructure Building and Infrastructure

20

YARD SAVER GARDEN SHEDS ARE AVAILABLE AT IDEAL BUILDINGS

We are specialists in the design and construction of garages, cottages, and sleepouts

The Ideal ExperienceWith 46,000 buildings and 50+ years under our professional builders’ belts Ideal is one of New Zealand’s most recognized and respected building companies.

We use quality components including genuine NZ Steel Colorsteel

We can customise a building to suit your needs and site

Advantages of buying new:• Home owner benefits include;

• Low maintenance

• Brick and tile

• New build warranties

• Personal colour choice options

• New modern appliances

• Blank canvas for landscaping

From an investor’s perspective• Low maintenance

• Top notch insulation

• Latest spec wiring and plumbing

• New build warranties

• Easy to maintain while rented out

• No further capital expenditure needed to achieve top market rent return

www.pacifichomes.co.nzPhone: 09 430 0162


21Building and Infrastructure

22

21 Hewlett Street, Port Whangarei

Phone 09 470-0700 w w w . f u l t o n h o g a n . c o m

• Earthworks• Drainlaying • Road Construction• Asphalt Surfacing

• Civil Works• Design & Build Service• Chip Sealing• Driveways & Carparks

“Fulton Hogan is celebrating 80 years in the transport infrastructure, water, energy, mining and land development sectors. We’ve earned our stripes building the backbone of New

Zealand’s roading network while making our mark on roading projects across Australasia”

Roading and Civil Engineering Services

“WE’RE PROUD TO HAVE HELPED SHAPE BOTH THE CITY OF WHANGAREI AND THE NORTHLAND REGION FOR OVER 20 YEARS”

Connecting Communities, Road Maintenance, Civil Construction and Traffic Management for NorthlandWe build and maintain the roads, rail, ports, airports, bridges, parks and property developments which make up connected, functioning towns and cities. We construct and maintain the vast networks of pipes and drains below ground which supply potable water, energy and fuel and manage waste, keeping communities healthy and live-able. We’ve been making our mark for more than 80 years across New Zealand and Australia. While times and technology have changed, what will never change is the way we work.Jules Fulton and Bob Hogan set out to create a business based on honesty, trust, respect, safety and teamwork. It worked for them and still works for us today. Fulton Hogan has earned a reputation for always doing what we say.Connecting Communities.Fulton Hogan provide comprehensive services for the communities of Northland from its two bases in the province, at Whangarei and Kaitaia. With over 25 years’ experience as a supplier of contracting services in Northland, we understand the needs of the communi-ties of New Zealand’s most northern region and are able to provide services tailored to meet those needs.Road Maintenance and Civil Construction.Fulton Hogan is one of Australasia’s most experienced road con-tractors, from design to construction, surfacing, maintenance and operation. Eighty years ago we started building roads and it’s still the backbone of our business. With over 90% of our work coming

from repeat customers, it’s clear our experience and relationships count. Fulton Hogan provide civil construction, road maintenance and an emergency response capability in Northland. The commu-nity benefits from routine road maintenance tasks such as street sweeping, maintenance of signage and minor road repairs. We also rapidly deploy our teams after major incidents or extreme weather events to do whatever is required, such as slip repairs and road reinstatement to ensure there is as little interruption as possible to people’s lives. We don’t just look after the State Highways and local authority roads. We can maintain private roads and provide products and services to repair your domestic driveway or commer-cial car park.Managing Northland’s TrafficIn concert with our road maintenance services, Fulton Hogan also have great experience in providing traffic management. Communi-ties are kept safe and traffic moving as we quickly react to any haz-ards on the road network, setting up graphics and road markings to reflect changed driving conditions. We work with government agen-cies and local authorities to devise traffic management systems around events such as construction projects and major sporting occasions to reduce congestion, keeping the people of Northland moving and negating any impact on the region’s productivity. If your event needs traffic management then give us a call.

www.fultonhogan.com


23Building and Infrastructure

24

Mitre 1046 Porowini Avewww.mitre10.co.nz

09 430 4009

Cleanscape134 Lower Dent Streetwww.cleanscape.co.nz

09 972 7625

Fairview Windows and Doorswww.fairviewcreations.co.nz

0800 386 6784

The Property Wizard 15 Gumdigger Place www.propertywizard.co.nz

09 430 8672

Northland Specialty Glass 48 Riverside Drive www.northlandspecialtyglass.co.nz

09 945 4794

The windowto your worldTalk to Fairview Window Creations, ph 0800 386 6784.fairviewcreations.co.nz

BENCHTOPS WARDROBESSHOWER & SECURITY DOORS

Building and Home Improvements

25

BEST SERVICE BEST PRICE ON ANYTHING GLASSBalustradesShowersBroken WindowsSplashbacks

NORTHLANDSPECIALTYGLASS LTDWHANGAREI

0800 8 glass. 24 HRSERVICE

[email protected]

Registered Master Builders AssociationBuilders may belong to the Registered Master Builders Association (RMBA).To qualify for membership Registered Master Builders must meet the following criteria:Either• A minimum of six years building experience, comprising

completion of a carpentry apprenticeship, or a relevant tertiary building related qualification (e.g. B.Arch, B.Eng, NZCB, NZCQS, NZCE, NZCD); and have at least three continuous years as a builder in business on their own account, and/or in day-to-day management of a building business; or

• A minimum of eight years continuous building experience, comprising at least five years as a builder contractor in business on their own account, and/or in day-to-day man-agement of a building business, whether having completed any formal examinations or not.

The RMBA has a Constitution and Code of Conduct, which Registered Master Builders must comply with at all times.Registered Master Builders offer a third party written guaran-tee on all new homes and renovations, which provides cover for:• loss of deposit.• non-completion of work.• materials, workmanship and structural matters.(NOTE: conditions apply to the above.)To become approved as a Registered Master Builder, the person or company has to provide trade references from their bank, accountant and trade merchants proving they are fi-nancially responsible and can run a business. They must also provide examples of their work for inspection. Once registered they are inspected several times a year by the RMBA mobile service team.

Building and Home Improvements Building and Home Improvements

26

A. Cnr Porowini Ave And Poto StPo Box 10193, Te Mai, Whangarei P. 09 438 0192 | F. 09 438 0196

E. [email protected] W. gasworksandplumbing.co.nz

GAS WORKS &PLUMBING LIMITEDSUPSUPPLYPLY I, INSTNSTALLALL && SERSERVICVICEE

& PLUMBERS GASFITTERS

SPECIALISINGIN ALL WATER HEATING &HOME HEATING SOLUTIONSCALL FOR FREE/NO OBLIGATION ADVICE/QUOTE ON ALL YOUR PLUMBING & GASFITTING NEEDS InIn

W.EE. In

- PROCESSINGNORTHLAND LOGS IN NORTHLAND

Northpine’s products are made exclusively from pine grown in Northland because it’s stronger, denser and stiffer than pine grown anywhere else in New Zealand. This ensures Northpine’sprducts always perform exceptionally well in structural applications.

Whatever the job, it deserves only the highest quality timber. Ensure your merchant or builder supplies only Northpine products.

Building and Home Improvements

27

Ph 09 435 5044

DrivewaysFootpaths and CurbingFloors and YardsPod Flooring and ComponentsSteel Mesh etcConcrete ToolsColoured ConcreteCrushed Recycled ConcreteExposed AggregateFarmsheds and Feedpads etc.

Ready Mix Certified Concrete 10 Hiko Rd,Kamo

[email protected] www.virginconcrete.co.nz

Northpine

34 Cove Road, Waipu www.northpine.co.nz

09 432 1155

Gasworks and Plumbing Cnr Porowini Ave and Poto Stwww.gasworksandplumbing.co.nz

09 438 0192

Virgin Concrete

10 Hiko Road, Kamo www.virginconcrete.co.nz

09 435 5044

Fencing Services

113 Lower Cameron Street

09 438 9330

Building and Home Improvements Building and Home Improvements

29

Established since 2001, we are fastearning a reputation for wonderfulfood and excellent service. Expectthe best!

Big or small let our passionate,experienced and creative cateringteam make your function a success.

From finger food to a fully servicedformal dinner, Absolute will deliver agreat service and product.

Corporate catering or private wepride ourselves on tailoring ourservice and menus to best meet yourneeds.eds.

Establishedearning a refood and excthe best!

Big or smallexperienceteam make

The team at Absolute Caterers arededicated to making your special day one to remember

Located in the Toll StadiumOkara Drive, Whangareiwww.absolutecaterers.co.nz or call 09 470 2595

Business to Business

Debbie Gurr 11 Herekino Street, Whangarei 09-438 4103

Absolute Caterers Okara Drive, Toll Stadiumwww.absolutecaterers.co.nz

09 470 2595

Armourguard Security

7B First Avenue www.armourguard.co.nz

09 438 1639

TDDA

11 Herekino Street www.tdda.com

09 438 4103

To advertise in The Business Finderplease contact

Marguerite Hugo on 021 025 90743 or

email: [email protected]

30

DB Interiors 21-23 Gumdigger Place

0800 999 000

Caughey & Dignon Document [email protected] www.cdldocumentsolutions.co.nz

09 430 2323

Essential Insurances www.essentialinsurances.co.nz

0272 455 133

FireCo [email protected]

0275 437 106

Northland Business Systems 131 Cameron Street www.nbsystems.co.nz

09 438 1639

Discover the LOCAL solution for your secure document storage and destruction needs.

Phone: 09 430 2323 Email: [email protected]

WE OFFER: Document Storage Document Destruction Scan on Demand

We urge you to consider the security of your documents – if your current storage needs are

being met elsewhere, bring them home and have them at your fingertips with

CDL Document Solutions.

www.cdldocumentsolutions.co.nz


Creating Vibrant Workspaces

www.dbinteriors.co.nz [email protected]

Come and visit our showroom 21-23 Gumdigger Place, Whangarei

Ph: 09 435 0057

Commercial fitout specialists

Northland owned and operated since 1966

From Design to Completion

Your vision Our concept

31

Building Compliance + Fire Safety

Locally owned and operated

Bertus van Buuren0275 437 [email protected]

M: E:


NZ Chambers of Commerce Northland aspires for a region that has a high wage, high growth economy. An economically and culturally vibrant region ac-companied by city which is front of mind for national businesses wishing to relocate and supported by a network of smaller economically sustainable and equally vibrant business communities within North-land’s smaller urban centres. If this aspiration can be achieved then this can underpin a whole range of social well-beings and ensure that Northland youth have employment and our household incomes at least match of not betters other regions.

It will require strong and courageous leadership from within local government and a truly business friendly environment.

Business growth requires sufficient rewards to justify the risk and part of the enabling process should be reducing the risk exposure that will in turn encourage private sector investment.

Making it easier for all businesses to do business helps create a district that attracts more productive business and inward investment. Business-friendly can be defined as the explicit attempts by local governments, their partners

(including central government) and private sector organisa-tions to reduce the regulatory and non-regulatory barriers, costs, risks and uncertainties in all forms of commercial activity to stimulate and support local business growth, local business reten-tion, and attraction of new business to the local area.

Are you paying too much for your personal insurance, business insurance and ACC levies?

Are you too busy to run around getting quotes for the cover you know you need?

Then let us take the hassle out of getting or reviewing insurance!

FOR A FREE NO OBLIGATION QUOTEcall Nicki Spence NOW on 0272 455 [email protected] www.essentialinsurances.co.nz


32

Have you have ever taken out a mortgage, bought a car, or owned a business? If you have, then it’s almost guaranteed that you also have had at least one insur-ance policy as well. Insurance is one of those things that most people are aware can be useful, they probably have one or two (or five or six) policies, and they are also probably largely unaware of what they are ACTUALLY covered for!We’ve all heard the horror stories: people who have paid premiums for years then make a claim, only to be told that either their policy didn’t cover that or that because they had a pre-existing health condition it had never actually been covered in the first place! Unfortunately this can happen- but if you use a good adviser (also known as a broker), this can be avoided, and if you have to claim, they can also help to make that process as smooth as possible- reducing the stress you will face at what is usually already a stressful time.So why have insurance at all?In a nutshell, it’s all about how much risk you want to have in your life. For exam-ple- you own a house with a $100000 mortgage, and you choose not to take out life insurance to cover the mortgage should you die. You are choosing to take all the risk yourself- so if you do pass away, the debt either has to be taken on by someone else or the house sold to pay back the debt. If you have family that you want to inherit the house, do you want them to inherit the debt as well? If you don’t, then a life insurance policy is a sim-ple way to make sure that they inherit a debt free property- a nice legacy to leave if you aren’t around anymore.

What types of insurance are there?Broadly speaking, there are 3 types- insur-ance on people, insurance on property, and insurance on business. At Essential Insurances we specialise in the last two- insuring people and businesses (including farms). We can choose from at least four different insurance companies to make sure you get the best possible cover specific to your situation. Why use an insurance adviser (also known as a broker)?A good adviser will do exactly that- ad-vise. They also can save you A LOT of money- the difference in premiums between companies can vary hugely, and also there may be different ways to cover you that can work out a lot cheaper! They will usually have an initial consultation with you to get an understanding of you and your situation, then come back with a recommendation for the cover that they suggest- then it is up to you to decide if you want to take that advice! As the saying goes ‘the devil is in the detail”- and that DEFINITELY applies to insur-ance policies. Speaking from a personal perspective, I make a point of constantly reading policy documents- not only from companies that I represent, but as many other companies as I can, so I always know as much as possible about what is available in NZ. This is so that I can then tell you (for example) which company will be the best one to be with if you are wor-ried about getting a malignant melanoma. I can also tell you which companies are easiest to meet the criteria of a heart attack for (and therefore be able to claim successfully), and which company is best to take out medical insurance with if you want to be able to get the latest anti-cancer drugs that are not funded by PHARMAC- up to $300,000 per year! This

means that once I get an idea from you of what is important to you, I can then recommend not only the best type of insurance cover for you, but also the best company to go with. What else does an adviser do?A good adviser won’t just sell you insur-ance and disappear- they will be with you for the life of the policy. At Essential Insurances, we start by getting to know you and about your priorities and situa-tion. We will then show you our recom-mendation, and help you decide what the best option is for you- maybe everything we’ve suggested, maybe just a bit, but we’ll NEVER push you into something you don’t completely believe is right for you and your budget! We’ll make the applica-tion process as easy as possible, and once your new cover is in place, we’ll even make sure your old cover is cancelled. Then usually once a year we will contact you to make sure all your cover is still at the right levels- because sometimes it may need to be increased or changed, but often it needs to be reduced as debt levels fall and children leave the nest. And in the unfortunate event that you need to make a claim, we are your first point of contact- and we will work REALLY hard to make sure that everything runs as smoothly as possible, because you don’t want extra stress at an already stressful time!So if this has got you thinking that you should look at your insurance options, please call or text me (Nicki Spence) on 0272455133, email me on [email protected], or check out our website for more information at www.essentialinsurances.co.nz


33Business to Business

34

CEW Wilkinson Ave, Kamowww.cew.ac.nz

09 435 0889

Elim Christian 16 Porowini Avenuewww.elimchildcare.org.nz

09 430 3050

Koru Kids Preschool152 Bank Street

09 430 8804

Kingdom Kidz22 Ngunguru Road

09 459 5552

Bright Stars

25 Moody Avenuewww.brightstars.co.nz

09 459 4255

Free pickup from and around Whangarei152 Bank Street, WhangareiPhone: 09 430 8804 I email: [email protected] 121 9997 I www.korukids.co.nz

Preschool for children age between 2 to 5 years old.

Sessional or full time; 20 free hours for 3 to 5 years old....no optional charges.

Structured school readiness programme for 4 years old

to help with transition to school.

Careers, Education and Childcare

To advertise in The Business Finderplease contact

Marguerite Hugo on 021 025 90743 or

email: [email protected]

35Careers, Education and Childcare

Back2Nature Childcare www.back2naturechildcare.co.nz

09 435 3672

Seedlings Homebased Childcareseedlingschildcare@icloud.comwww.seedlingschildcare.co.nz

09 556 1275

BJ’s Childcare Services15 Moody Avenue www.bjschildcare.co.nz

0800 459 1778

www.back2naturechildcare.co.nz

Fantastic childcare in selected educatorshomes, free ECE hours and WINZ subsidies,Nature School Programme, educational outings!

Office: 09 435 3672 Jenny: 021 212 8387

EducatorsJoin a family orientated group if you are

pasionate about children and nature withgreat educational support.

Tel: 09 5561275 Mobile: 027 733 2780

Kia Hawes

childc re

Seedlingsh omeb a s e d

www.seedlingschildcare.co.nz [email protected]

Grown at home, nurtured by nature

36

Te Wananga o Aotearea12 Murdoch Crescent www.twoa.ac.nz

0800 355 553

Regent Training Centre29 Maunu Road [email protected]

09 430 3240

Smith and [email protected]

021 346 791

NorthTecwww.northtec.ac.nz

0800 162 100

Advance Training 35 Robert Street www.militaryprepschool.co.nz

09 438 2825 We are currently ENROLLING

STUDENTS now for our full year Youth Guarantee courses. These

courses are FEES FREE.

If you are aged between 16 and 20 come and check out what we are

offering or contact us now about how we can help you with your future

direction

FEES FREE

What we can offer: Small Class numbers - Gain NZQA qualifications

Friendly environment - One to One sessions

35 Robert Street, Level 3, Spire House Building (09) 438 2825 Email [email protected]


37

Contact us to enrol today!

Supportive education to gain NCEA or National Certificates

• ZERO fees for 16-19 year olds• FREE transport may be available• Gain qualifications practically• Courses on offer: - Automotive - Building - Computing - Forestry/Rural - Hopsitality - Panel Beating

Walk Before An ExamIt’s been proven that exercise can boost your memory and brain power. Research proves that about 20 minutes exercise before an exam can improve brain performance.


38

GO FARStay close

Noho tata, haere tawhiti

Freephone:0800 162 100 www.northtec.ac.nz Refer to our website for terms and conditions

Programmes on offer in 2015 include:• Accounting

• Agribusiness

• Agriculture

• AppliedArts

• AppliedWriting

• ArchitectureandBuildingTechnology

• AutomotiveEngineering

• BeautyTherapy

• Business

• BusinessAdministrationandComputing

• CivilEngineering

• CommericalTransport

• Conservation

• Construction

• Cookery

• DigitalArts

• ElectricalEngineering

• EnvironmentalManagement

• Forestry

• FoundationStudies

• Hairdressing

• HealthandSafety

• Horticulture

• HospitalityManagement

• HuntingandPestControl

• MechanicalEngineering

• MentalHealthandAddictions

• Nursing

• Painting(Trades)

• Science

• SocialServices

• SportandRecreation

• SustainableRuralDevelopment

• ToituTeReo(Mäorilanguage)

• ToiTeWai-ngaharu(Mäoriarts)

• TravelandTourism

• VisualArts

• Welding

Ifstudyingandgainingskillsareonyourto-dolistfor2015,takealookatwhatNorthTechastooffer.

Whether you’re a school leaver, a second-chance learner getting back into the classroom, or planning to start the degree you’ve always wanted to do, NorthTec has an option that will work for you.

Our programmes are hands-on, with plenty of practical learning, and our class sizes are small enough to feel as though you’re among whänau.

If you’re looking for your next step in life, see how NorthTec can help you get there.

Make 2015 your year!

Enquire about student loans and scholarships

39

GO FARStay close

Noho tata, haere tawhiti

Freephone:0800 162 100 www.northtec.ac.nz Refer to our website for terms and conditions

Programmes on offer in 2015 include:• Accounting

• Agribusiness

• Agriculture

• AppliedArts

• AppliedWriting

• ArchitectureandBuildingTechnology

• AutomotiveEngineering

• BeautyTherapy

• Business

• BusinessAdministrationandComputing

• CivilEngineering

• CommericalTransport

• Conservation

• Construction

• Cookery

• DigitalArts

• ElectricalEngineering

• EnvironmentalManagement

• Forestry

• FoundationStudies

• Hairdressing

• HealthandSafety

• Horticulture

• HospitalityManagement

• HuntingandPestControl

• MechanicalEngineering

• MentalHealthandAddictions

• Nursing

• Painting(Trades)

• Science

• SocialServices

• SportandRecreation

• SustainableRuralDevelopment

• ToituTeReo(Mäorilanguage)

• ToiTeWai-ngaharu(Mäoriarts)

• TravelandTourism

• VisualArts

• Welding

Ifstudyingandgainingskillsareonyourto-dolistfor2015,takealookatwhatNorthTechastooffer.

Whether you’re a school leaver, a second-chance learner getting back into the classroom, or planning to start the degree you’ve always wanted to do, NorthTec has an option that will work for you.

Our programmes are hands-on, with plenty of practical learning, and our class sizes are small enough to feel as though you’re among whänau.

If you’re looking for your next step in life, see how NorthTec can help you get there.

Make 2015 your year!

Enquire about student loans and scholarships

Learn close to home!NorthTec is Northland’s largest tertiary education provider, with learning centres throughout the region. We offer a wide range of programmes from foundation to degree level.

Our main campus is based in Raumanga, Whangarei, and we have learning centres at Kerikeri, Kaitaia, Räwene and Kaikohe, as well as community-based sites across the Northland region and in the Rodney district.

NorthTec offers study programmes suitable for all levels of learning, with seven bachelor degrees available in Northland. Our bachelor programmes in nursing and social services are always popular and graduates are highly sought after by employers.

Students can also complete diplomas and certificates in a range of subjects. For those who need some help getting back into formal education we offer foundation programmes to kick-start the learning process, combined with advice to help students develop their learning and career path.

For young people aged 16 to 19, NorthTec has a range of youth programmes offering fees-free study combined

with strong support for learners, including help with transport, budgeting advice and career guidance. Students in this age group can choose from foundation studies, hospitality with foundation studies, or automotive studies with vocational studies.

With small class sizes and passionate, highly knowledgeable tutors, NorthTec provides a whänau-like atmosphere to help students succeed in their chosen subject.

Our programmes at all levels have a strong focus on being practical, hands-on and linked to local industry and employment opportunities.

We also understand that students may have family commitments or need to work while they study, so we offer the flexibility to study full time, part time or even online.

With programmes ranging from arts to sciences, hospitality to trades or agriculture to beauty therapy, NorthTec has something for everyone. For more information on all programmes, visit www.northtec.ac.nz, or call 0800 162 100.


41

SCHOOL ADDRESS TYPE PHONE

Blomfield Special & Resource Ctre 31 Maunu Road Special School 09 438 2105

Bream Bay College Peter Snell Road Secondary (Year 7-15) 09 432 8226

Excellere College 39 Great North Road Composite (Year 1-15) 09 435 2458

Glenbervie School Ngunguru Road Contributing 09 437 5812

Hikurangi School 4 Swann Avenue Full Primary 09 433 8545

Hora Hora School (Te Mai) 22 Te Mai Road Contributing 09 438 3080

Huanui College Ngunguru Road RD 3 Secondary (Year 7-15) 09 459 1930

Hukerenui School Years 1-8 Crows Nest Road Full Primary 09 433 9895

Hurupaki School 20 Dip Road Contributing 09 435 0733

Kamo High School Wilkinson Avenue Secondary (Year 9-15) 09 435 1688

Kamo Intermediate Hailes Road Intermediate 09 435 0343

Kamo School Three Mile Bush Road Contributing 09 435 1482

Kaurihohore School Apotu Road Contributing 09 435 0041

Kokopu School Kokopu Road Full Primary 09 434 6765

Mangakahia Area School Mangakahia Road Composite (Year 1-15) 09 433 1702

Matarau School Matarau Road Full Primary 09 433 5823

Maungakaramea School Tangihua Road Full Primary 09 432 3804

Maungatapere School Mangakahia Road Full Primary 09 434 6743

Maunu School 13 Austin Road Contributing 09 438 8060

Morningside School Morningside Road Contributing 09 438 2021

Ngunguru School Te Maika Road Full Primary 09 434 3805

Northland Health Camp School 436 Maunu Road Special School 09 438 7660

One Tree Point School 97 One Tree Point Road Contributing 09 432 7891

Onerahi School Church Street Contributing 09 436 0521

Otaika Valley School Valley View Road Contributing 09 432 2731

Pakotai School Mangakahia Road Full Primary 09 433 1727

Parua Bay School 1396 Whangarei Heads Road Full Primary 09 436 5814

Pompallier Catholic College State Highway 14 Secondary (Year 7-15) 09 438 3950

Poroti School Mangakahia Road Full Primary 09 434 6867

Portland School 10 Portland School Road Contributing 09 432 2897

Purua School Irvine Road Full Primary 09 433 5841

Raurimu Avenue School Raurimu Avenue Full Primary 09 436 0820

Ruakaka School 12 Sandford Road Contributing 09 432 7503

Schools

42

SCHOOL ADDRESS TYPE PHONE

Tauraroa Area School Tauraroa Road Composite (Year 1-15) 09 432 2643

Te Horo School (Whangarei) Pipiwai Road Full Primary 09 438 6453

Te Kura o Otangarei William Jones Drive Full Primary 09 437 0623

Tikipunga High School 194 Corks Road Secondary (Year 7-15) 09 437 3299

Tikipunga Primary School Tania Place Contributing 09 437 0743

Totara Grove School 38 Corks Road Contributing 09 435 0019

Waiotira School Ararua Road Contributing 09 432 9804

Waipu School 6 Argyll Street Contributing 09 432 0135

Whananaki School Whananaki North Road Full Primary 09 433 8231

Whangarei Boys` High School Kent Road Secondary (Year 9-15) 09 430 4170

Whangarei Girls` High School Lupton Avenue Secondary (Year 9-15) 09 430 4400

Whangarei Heads School 28 School Road Full Primary 09 434 0844

Whangarei Intermediate 32 Rust Avenue Intermediate 09 438 8659

Whangarei Primary School Bank Street Contributing 09 438 3186

Whau Valley School 17 Moody Avenue Contributing 09 437 0448

392 Kamo Road, KamoPhone 09 435 2576

www.northlandschoolwear.co.nz

SPECIALISING IN

THE MANUFACTURE AND

SUPPLY OF NORTHLAND

SCHOOL WEAR.

We only supply regulation garments

Schools

To advertise in The Business Finder please contact Marguerite Hugo on 021 025 90743 or email: [email protected]

44 Commercial and Industrial

NORTHLAND’S LARGEST SELECTION OFMODERN QUALITY UP-TO-DATE EQUIPMENT

OUT OF DISTRICTS 0800 426 953 • WWW.COWLEYSHIRE.CO.NZ

PARTY HIRE 437 2586

Cnr Sime & Marsden Point Roads

Saturday to 12 noon

121 Kioreroa Road, Whangarei Fax 438 2150, 54 Commerce StEmail [email protected] HOURSWeekdays 6.30am - 5.30pmSaturday 7.30 - 5.00Sunday 8.30 - 4.30pmCLOSED Saturday afternoons and Sundays

RUAKAKA 433 0400

WHANGAREI 438 3613 KAMO 435 1882

BAY OF ISLANDS 407 8698

LTD54 Commerce St 438 3613

LTD

Our Guarantee to you: After each piece of equipment is used, we service, clean and maintain it for good working order

Industrial

DIY & home

Tradesmen

Excavators

Contracting

Toilets

Heavy equipment

ALSO OPEN5 Great North RoadOPEN HOURSWeekdays 7.30 - 5.30

Klinac Lane, WaipapaOPEN 6 DAYS A WEEK

You have a choice of over 5,000 items, so the chances are you get what you want immediately

with no delays.

5 Walton Street, Whangarei I www.powertoolcentres.co.nz09 430 0833 I 0800 TOOL TIME“We sell, service

and repair”

We also buy tools and machineryWHANGAREI’S LARGEST STOCKIST OF NEW AND USED POWER TOOLS, HAND TOOLS, MACHINERY & ACCESSORIES.

45Commercial and Industrial

QUALITY EQUIPMENT NEW ZEALAND OWNED & RUN

Manufacturer & Stockists ofAluminium Extrusions, Aluminium Sheet, Scaffolding, Ladders, Trestles, Planks & Gates,Sealants, Power Tools, Welding Products, Fasteners, and much more…

ULLRICH ALUMINIUM2 Gumdigger Place, Raumanga09 438 7380 | www.ullrich.co.nz

OPEN HOURSMon- Fri 7.30am-5pm • Sat 8.30am-11.30amClosed long weekends

OPEN TO THE PUBLIC

Northern forklifts5 Herekino Streetwww.northernforklifts.co.nz

09 438 8047

Ullrich Aluminium 2 Gumdigger Place, Raumangawww.ullrich.co.nz

09 438 7380

Cowleys133 Kioreroa Roadwww.cowleyshire.co.nz

09 437 2586

Downtown Tools5 Walton Streetwww.powertoolcentres.co.nz

09 430 0833

46

Masters of workwear rentaland cleaning.

NEW ZEALAND, COVERED AT WORK

If you want your staff to look clean and professional and save your companymoney with the least amount of hassle, talk to Apparelmaster. We buy anykind of workwear and rent it back to you, professionally launder and repair itand make sure you get the right gear where and when you need it.

To find out more, call 0800 808 820 or go to apparelmaster.co.nz

Apparel Masterwww.apparelmaster.co.nz

0800 808 820

Atlas Cranes25 Gumdigger Place

09 438 0990

Locally owned and operated.P: 09 4380990

25 Gumdigger Place, Whangarei

24 hour Emergency service, seven days a week for the Northland area.

10 ton – 100 ton cranes available

Obligation free quotes and site visits are provided to ensure that the clients needs and health and safety requirements are met.

[email protected]

Commercial and Industrial

48

Making Life Easier

49Investment, Legal and Insurance

Adams Trimmer2 James Street, [email protected]

09 470 2244

Discovery Life www.discoverylife.co.nz

09 963 6291

Advantage Mint Accounts Ltd24 Reyburn Street [email protected]

09 434 6617

Investment Solutions Northland2/30 Rathbone Streetwww.isnorthland.co.nz

0800 66 66 78

Adams Trimmer Insurance is a locally owned independent insurance broking o�ce located in Whangarei. We provide options for all your insurance needs, however

most importantly we represent YOU not the insurance companies.

Level 2, 2 James Street, WhangareiEmail: [email protected] www. adamstrimmer.co.nz

WHAT WE INSURE

(09) 470 2244 0800 100 633

TINUS VERMEULEN

Making insurance simple!Household Expense Cover I ACC I Home LoansHealth Insurance I Mortgage ProtectionRedundancy I Life Insurance I Disability InsuranceTrauma I Income Protection Cover

A big part of financial freedom is having your heart and mind free from worry about the what-ifs of life !!!

09 963 6291 (p) I +642 10251 9428 (mobile)[email protected] (email) I www.discoverylife.co.nz (web)

50

call Nicki Spence NOW on 0272 455 133 email [email protected] or see our website www.essentialinsurances.co.nz


FOR A FREE NO OBLIGATION

QUOTE

Are you too busy to run around getting quotes for the cover you know you need?Then let us take the hassle out of getting or reviewing insurance

[email protected]

0800 506 506 Essential Insurances www.essentialinsurances.co.nz

0272 455 133

Investment, Legal and Insurance

51

Moodys Accountants 156 Bank Street 10 Town Centre, Ruakakawww.moodysaccountantsandtax.co.nz

09 438 6969 09 432 8486

Mathew Perry Lawyers 7 Maunu Road [email protected]

09 437 3070

Tax Experts Let us minimize your tax.

Whangarei Office, 156 Bank Street Phone: 09 438 6969(Opposite McDonalds)

2 carparks reserved at our front door for visiting clientsRuakaka Office, 10 Town Centre Phone: 09 432 8486

Accountants Data entry, GST Return, Cash Flow Report year to date for Business Management. Annual Accounts at year end.

Business Advisors Develop strategies for your business future.

www.moodysaccountsandtax.co.nz

Tax Experts Let us minimize your tax.

Top Quality Work at a Reasonable Price

CUSTOMER: MATHEW PERRY LAWYERS PROOF TIME 19/03/2015 10:51:07 p.m.REP ID: N141 LAST RUN: 04/02/15

SIZE: 12X49870726AK

7 Maunu Road I WhangareiP (09 ) 437 3070 or (09) 478 66091 F (09) 437 2070

Email: [email protected]

Residential Conveyancing Fixed Fees

SALES

• Sale withouta release ofmortgage $760

• Sale with a releaseof one mortgage$895

REFINANCING• Release of an

existing mortgageand registration ofa new mortgage$800

PURCHASE• Purchase without mortgage nance $895• Purchase with one mortgage $995

RELATIONSHIP PROPERTY TRANSFER• Without release of mortgage to one partner

pursuant to a contracting out agreement $770• To a third party (refer to sales)

All prices are including GST

PLEASE READ ALL COPY CAREFULLY. CHECK SPELLING AND PHONE NUMBERS.

Once proof is approved NZME. will not accept responsibility for incorrect copy or layout.PROOF


52

Have you have ever taken out a mortgage, bought a car, or owned a business? If you have, then it’s almost guaranteed that you also have had at least one insurance policy as well. Insurance is one of those things that most people are aware can be useful, they probably have one or two (or five or six) policies, and they are also probably largely unaware of what they are ACTUALLY covered for!

We’ve all heard the horror stories: people who have paid premiums for years then make a claim, only to be told that either their policy didn’t cover that or that because they had a pre-existing health condi-tion it had never actually been covered in the first place! Unfortu-nately this can happen- but if you use a good adviser (also known as a broker), this can be avoided, and if you have to claim, they can also help to make that process as smooth as possible- reducing the stress you will face at what is usually already a stressful time.

So why have insurance at all?In a nutshell, it’s all about how much risk you want to have in your life. For example- you own a house with a $100000 mortgage, and you choose not to take out life insurance to cover the mortgage should you die. You are choosing to take all the risk yourself- so if you do pass away, the debt either has to be taken on by someone else or the house sold to pay back the debt. If you have family that you want to inherit the house, do you want them to inherit the debt as well? If you don’t, then a life insurance policy is a simple way to make sure that they inherit a debt free property- a nice legacy to leave if you aren’t around anymore.

What types of insurance are there?Broadly speaking, there are 3 types- insurance on people, insurance on property, and insurance on business. At Essential Insurances we specialise in the last two- insuring people and businesses (includ-ing farms). We can choose from at least four different insurance companies to make sure you get the best possible cover specific to your situation.

Why use an insurance adviser (also known as a broker)?A good adviser will do exactly that- advise. They also can save you A LOT of money- the difference in premiums between companies can vary hugely, and also there may be different ways to cover you that can work out a lot cheaper! They will usually have an initial

consultation with you to get an understanding of you and your situa-tion, then come back with a recommendation for the cover that they suggest- then it is up to you to decide if you want to take that advice! As the saying goes ‘the devil is in the detail”- and that DEFINITELY applies to insurance policies. Speaking from a personal perspective, I make a point of constantly reading policy documents- not only from companies that I represent, but as many other companies as I can, so I always know as much as possible about what is available in NZ. This is so that I can then tell you (for example) which company will be the best one to be with if you are worried about getting a malig-nant melanoma. I can also tell you which companies are easiest to meet the criteria of a heart attack for (and therefore be able to claim successfully), and which company is best to take out medical insur-ance with if you want to be able to get the latest anti-cancer drugs that are not funded by PHARMAC- up to $300,000 per year! This means that once I get an idea from you of what is important to you, I can then recommend not only the best type of insurance cover for you, but also the best company to go with. What else does an adviser do?A good adviser won’t just sell you insurance and disappear- they will be with you for the life of the policy. At Essential Insurances, we start by getting to know you and about your priorities and situation. We will then show you our recommendation, and help you decide what the best option is for you- maybe everything we’ve suggested, maybe just a bit, but we’ll NEVER push you into something you don’t completely believe is right for you and your budget! We’ll make the application process as easy as possible, and once your new cover is in place, we’ll even make sure your old cover is cancelled. Then usually once a year we will contact you to make sure all your cover is still at the right levels- because sometimes it may need to be increased or changed, but often it needs to be reduced as debt levels fall and children leave the nest. And in the unfortunate event that you need to make a claim, we are your first point of contact- and we will work REALLY hard to make sure that everything runs as smoothly as possible, because you don’t want extra stress at an already stress-ful time!So if this has got you thinking that you should look at your insurance options, please call or text me (Nicki Spence) on 0272455133, email me on [email protected], or check out our website for more information at www.essentialinsurances.co.nz.

I look forward to hearing from you!

ABOUT INVESTMENT SOLUTIONS NORTHLAND (ISN)Investment Solutions Northland is an independently owned and operated wealth advisory business, founded in 1997 with a simple philosophy; to provide everyday New Zealand-ersandtheirfamilieswithtailored,responsiblefinancialsolu-tions, documented with plain, easy-to-understand language. This focus has seen our team maintain close, long-term relationships with our clients for many years.

More recently, we have added award winning interactive technologytohelpclientsmakesmarterfinancialdecisions.Our business has evolved to provide our clients with com-prehensivefinancialadvicewhichcovers;• KiwiSaver• Retirement Spending• Wealth Accumulation Strategies• Retirement Planning• Overseas Pension Transfers (Australia Super & UK Pen-

sions)

Put simply, we work with people who are accumulating wealth, and we help people manage their wealth.

We provide advice focused on helping you achieve your varyingfinancialneedsandgoals.Importantly,ouradvicetakes into account the different stages of life and your indi-vidual circumstances.

We offer the advantage of a long standing presence in the Northland region, and are comfortable and familiar with the people in our community. We invite you to contact us with-out obligation to discuss how we can be of service to you.

Freephone 0800 66 66 78 or email [email protected]


54

51

Tide Tables 2014-2015

Tide times listed are corrected for NZ daylight savings time.

LAND INFORMATION NEW ZEALAND TIDE PREDICTIONS

EAST COAST - MARSDEN POINTJANUARY 2015

Lat. 35° 50’ S Long. 174° 30’ E

TIME ZONE: -1200 TIMES AND HEIGHTS OF HIGH AND LOW WATERS

Sourced from http://www.linz.govt.nz/

E-mail address [email protected]

NEW ZEALAND HYDROGRAPHIC AUTHORITY TIDE PREDICTIONS

MARSDEN POINT Lat. 35° 50' S Long. 174° 30' E

JANUARY 2015 N.Z. LOCAL TIMES AND HEIGHTS OF HIGH AND LOW WATERS

TIMES LISTED ARE NZ LOCAL TIME

CROWN COPYRIGHT RESERVED

Time m

1 Th

0456 2.4 1102 0.7 1716 2.5 2331 0.6

2 Fr

0558 2.5 1202 0.7 1815 2.5

3 Sa

0028 0.6 0655 2.5 1259 0.7 1910 2.5

4 Su

0121 0.5 0747 2.6 1351 0.7 2002 2.5

5 Mo

0210 0.5 0835 2.6 1440 0.7 2051 2.5

6 Tu

0256 0.5 0920 2.6 1526 0.7 2135 2.5

7 We

0339 0.5 1001 2.6 1609 0.7 2217 2.5

8 Th

0419 0.5 1040 2.6 1650 0.7 2257 2.4

Time m

9 Fr

0458 0.6 1118 2.6 1730 0.7 2335 2.4

10 Sa

0536 0.6 1155 2.5 1809 0.7

11 Su

0014 2.4 0615 0.7 1233 2.5 1849 0.7

12 Mo

0055 2.3 0655 0.8 1313 2.4 1930 0.8

13 Tu

0138 2.3 0739 0.8 1356 2.4 2014 0.8

14 We

0225 2.3 0827 0.9 1442 2.4 2101 0.8

15 Th

0318 2.2 0920 0.9 1532 2.3 2153 0.8

16 Fr

0415 2.3 1018 0.9 1626 2.3 2249 0.8

Time m

17 Sa

0515 2.3 1117 0.9 1724 2.4 2347 0.7

18 Su

0614 2.4 1216 0.8 1824 2.4

19 Mo

0043 0.6 0710 2.5 1313 0.7 1922 2.5

20 Tu

0138 0.5 0803 2.7 1408 0.6 2018 2.6

21 We

0230 0.4 0855 2.8 1501 0.5 2112 2.7

22 Th

0322 0.3 0945 2.9 1553 0.4 2205 2.8

23 Fr

0412 0.2 1035 2.9 1645 0.3 2257 2.8

24 Sa

0502 0.2 1125 2.9 1736 0.3 2348 2.8

Time m

25 Su

0553 0.3 1216 2.9 1828 0.3

26 Mo

0041 2.7 0646 0.4 1307 2.8 1920 0.4

27 Tu

0134 2.7 0740 0.5 1400 2.7 2014 0.5

28 We

0231 2.6 0838 0.6 1455 2.6 2109 0.6

29 Th

0331 2.5 0938 0.7 1553 2.5 2208 0.6

30 Fr

0433 2.4 1040 0.8 1652 2.4 2307 0.7

31 Sa

0534 2.4 1140 0.8 1752 2.4








Time m

1 Th

0456 2.4 1102 0.7 1716 2.5 2331 0.6

2 Fr

0558 2.5 1202 0.7 1815 2.5

3 Sa

0028 0.6 0655 2.5 1259 0.7 1910 2.5

4 Su

0121 0.5 0747 2.6 1351 0.7 2002 2.5

5 Mo

0210 0.5 0835 2.6 1440 0.7 2051 2.5

6 Tu

0256 0.5 0920 2.6 1526 0.7 2135 2.5

7 We

0339 0.5 1001 2.6 1609 0.7 2217 2.5

8 Th

0419 0.5 1040 2.6 1650 0.7 2257 2.4

Time m

9 Fr

0458 0.6 1118 2.6 1730 0.7 2335 2.4

10 Sa

0536 0.6 1155 2.5 1809 0.7

11 Su

0014 2.4 0615 0.7 1233 2.5 1849 0.7

12 Mo

0055 2.3 0655 0.8 1313 2.4 1930 0.8

13 Tu

0138 2.3 0739 0.8 1356 2.4 2014 0.8

14 We

0225 2.3 0827 0.9 1442 2.4 2101 0.8

15 Th

0318 2.2 0920 0.9 1532 2.3 2153 0.8

16 Fr

0415 2.3 1018 0.9 1626 2.3 2249 0.8

Time m

17 Sa

0515 2.3 1117 0.9 1724 2.4 2347 0.7

18 Su

0614 2.4 1216 0.8 1824 2.4

19 Mo

0043 0.6 0710 2.5 1313 0.7 1922 2.5

20 Tu

0138 0.5 0803 2.7 1408 0.6 2018 2.6

21 We

0230 0.4 0855 2.8 1501 0.5 2112 2.7

22 Th

0322 0.3 0945 2.9 1553 0.4 2205 2.8

23 Fr

0412 0.2 1035 2.9 1645 0.3 2257 2.8

24 Sa

0502 0.2 1125 2.9 1736 0.3 2348 2.8

Time m

25 Su

0553 0.3 1216 2.9 1828 0.3

26 Mo

0041 2.7 0646 0.4 1307 2.8 1920 0.4

27 Tu

0134 2.7 0740 0.5 1400 2.7 2014 0.5

28 We

0231 2.6 0838 0.6 1455 2.6 2109 0.6

29 Th

0331 2.5 0938 0.7 1553 2.5 2208 0.6

30 Fr

0433 2.4 1040 0.8 1652 2.4 2307 0.7

31 Sa

0534 2.4 1140 0.8 1752 2.4








Time m

1 Th

0456 2.4 1102 0.7 1716 2.5 2331 0.6

2 Fr

0558 2.5 1202 0.7 1815 2.5

3 Sa

0028 0.6 0655 2.5 1259 0.7 1910 2.5

4 Su

0121 0.5 0747 2.6 1351 0.7 2002 2.5

5 Mo

0210 0.5 0835 2.6 1440 0.7 2051 2.5

6 Tu

0256 0.5 0920 2.6 1526 0.7 2135 2.5

7 We

0339 0.5 1001 2.6 1609 0.7 2217 2.5

8 Th

0419 0.5 1040 2.6 1650 0.7 2257 2.4

Time m

9 Fr

0458 0.6 1118 2.6 1730 0.7 2335 2.4

10 Sa

0536 0.6 1155 2.5 1809 0.7

11 Su

0014 2.4 0615 0.7 1233 2.5 1849 0.7

12 Mo

0055 2.3 0655 0.8 1313 2.4 1930 0.8

13 Tu

0138 2.3 0739 0.8 1356 2.4 2014 0.8

14 We

0225 2.3 0827 0.9 1442 2.4 2101 0.8

15 Th

0318 2.2 0920 0.9 1532 2.3 2153 0.8

16 Fr

0415 2.3 1018 0.9 1626 2.3 2249 0.8

Time m

17 Sa

0515 2.3 1117 0.9 1724 2.4 2347 0.7

18 Su

0614 2.4 1216 0.8 1824 2.4

19 Mo

0043 0.6 0710 2.5 1313 0.7 1922 2.5

20 Tu

0138 0.5 0803 2.7 1408 0.6 2018 2.6

21 We

0230 0.4 0855 2.8 1501 0.5 2112 2.7

22 Th

0322 0.3 0945 2.9 1553 0.4 2205 2.8

23 Fr

0412 0.2 1035 2.9 1645 0.3 2257 2.8

24 Sa

0502 0.2 1125 2.9 1736 0.3 2348 2.8

Time m

25 Su

0553 0.3 1216 2.9 1828 0.3

26 Mo

0041 2.7 0646 0.4 1307 2.8 1920 0.4

27 Tu

0134 2.7 0740 0.5 1400 2.7 2014 0.5

28 We

0231 2.6 0838 0.6 1455 2.6 2109 0.6

29 Th

0331 2.5 0938 0.7 1553 2.5 2208 0.6

30 Fr

0433 2.4 1040 0.8 1652 2.4 2307 0.7

31 Sa

0534 2.4 1140 0.8 1752 2.4








Time m

1 Th

0456 2.4 1102 0.7 1716 2.5 2331 0.6

2 Fr

0558 2.5 1202 0.7 1815 2.5

3 Sa

0028 0.6 0655 2.5 1259 0.7 1910 2.5

4 Su

0121 0.5 0747 2.6 1351 0.7 2002 2.5

5 Mo

0210 0.5 0835 2.6 1440 0.7 2051 2.5

6 Tu

0256 0.5 0920 2.6 1526 0.7 2135 2.5

7 We

0339 0.5 1001 2.6 1609 0.7 2217 2.5

8 Th

0419 0.5 1040 2.6 1650 0.7 2257 2.4

Time m

9 Fr

0458 0.6 1118 2.6 1730 0.7 2335 2.4

10 Sa

0536 0.6 1155 2.5 1809 0.7

11 Su

0014 2.4 0615 0.7 1233 2.5 1849 0.7

12 Mo

0055 2.3 0655 0.8 1313 2.4 1930 0.8

13 Tu

0138 2.3 0739 0.8 1356 2.4 2014 0.8

14 We

0225 2.3 0827 0.9 1442 2.4 2101 0.8

15 Th

0318 2.2 0920 0.9 1532 2.3 2153 0.8

16 Fr

0415 2.3 1018 0.9 1626 2.3 2249 0.8

Time m

17 Sa

0515 2.3 1117 0.9 1724 2.4 2347 0.7

18 Su

0614 2.4 1216 0.8 1824 2.4

19 Mo

0043 0.6 0710 2.5 1313 0.7 1922 2.5

20 Tu

0138 0.5 0803 2.7 1408 0.6 2018 2.6

21 We

0230 0.4 0855 2.8 1501 0.5 2112 2.7

22 Th

0322 0.3 0945 2.9 1553 0.4 2205 2.8

23 Fr

0412 0.2 1035 2.9 1645 0.3 2257 2.8

24 Sa

0502 0.2 1125 2.9 1736 0.3 2348 2.8

Time m

25 Su

0553 0.3 1216 2.9 1828 0.3

26 Mo

0041 2.7 0646 0.4 1307 2.8 1920 0.4

27 Tu

0134 2.7 0740 0.5 1400 2.7 2014 0.5

28 We

0231 2.6 0838 0.6 1455 2.6 2109 0.6

29 Th

0331 2.5 0938 0.7 1553 2.5 2208 0.6

30 Fr

0433 2.4 1040 0.8 1652 2.4 2307 0.7

31 Sa

0534 2.4 1140 0.8 1752 2.4








Time m

1 Th

0456 2.4 1102 0.7 1716 2.5 2331 0.6

2 Fr

0558 2.5 1202 0.7 1815 2.5

3 Sa

0028 0.6 0655 2.5 1259 0.7 1910 2.5

4 Su

0121 0.5 0747 2.6 1351 0.7 2002 2.5

5 Mo

0210 0.5 0835 2.6 1440 0.7 2051 2.5

6 Tu

0256 0.5 0920 2.6 1526 0.7 2135 2.5

7 We

0339 0.5 1001 2.6 1609 0.7 2217 2.5

8 Th

0419 0.5 1040 2.6 1650 0.7 2257 2.4

Time m

9 Fr

0458 0.6 1118 2.6 1730 0.7 2335 2.4

10 Sa

0536 0.6 1155 2.5 1809 0.7

11 Su

0014 2.4 0615 0.7 1233 2.5 1849 0.7

12 Mo

0055 2.3 0655 0.8 1313 2.4 1930 0.8

13 Tu

0138 2.3 0739 0.8 1356 2.4 2014 0.8

14 We

0225 2.3 0827 0.9 1442 2.4 2101 0.8

15 Th

0318 2.2 0920 0.9 1532 2.3 2153 0.8

16 Fr

0415 2.3 1018 0.9 1626 2.3 2249 0.8

Time m

17 Sa

0515 2.3 1117 0.9 1724 2.4 2347 0.7

18 Su

0614 2.4 1216 0.8 1824 2.4

19 Mo

0043 0.6 0710 2.5 1313 0.7 1922 2.5

20 Tu

0138 0.5 0803 2.7 1408 0.6 2018 2.6

21 We

0230 0.4 0855 2.8 1501 0.5 2112 2.7

22 Th

0322 0.3 0945 2.9 1553 0.4 2205 2.8

23 Fr

0412 0.2 1035 2.9 1645 0.3 2257 2.8

24 Sa

0502 0.2 1125 2.9 1736 0.3 2348 2.8

Time m

25 Su

0553 0.3 1216 2.9 1828 0.3

26 Mo

0041 2.7 0646 0.4 1307 2.8 1920 0.4

27 Tu

0134 2.7 0740 0.5 1400 2.7 2014 0.5

28 We

0231 2.6 0838 0.6 1455 2.6 2109 0.6

29 Th

0331 2.5 0938 0.7 1553 2.5 2208 0.6

30 Fr

0433 2.4 1040 0.8 1652 2.4 2307 0.7

31 Sa

0534 2.4 1140 0.8 1752 2.4








Time m

1 Th

0456 2.4 1102 0.7 1716 2.5 2331 0.6

2 Fr

0558 2.5 1202 0.7 1815 2.5

3 Sa

0028 0.6 0655 2.5 1259 0.7 1910 2.5

4 Su

0121 0.5 0747 2.6 1351 0.7 2002 2.5

5 Mo

0210 0.5 0835 2.6 1440 0.7 2051 2.5

6 Tu

0256 0.5 0920 2.6 1526 0.7 2135 2.5

7 We

0339 0.5 1001 2.6 1609 0.7 2217 2.5

8 Th

0419 0.5 1040 2.6 1650 0.7 2257 2.4

Time m

9 Fr

0458 0.6 1118 2.6 1730 0.7 2335 2.4

10 Sa

0536 0.6 1155 2.5 1809 0.7

11 Su

0014 2.4 0615 0.7 1233 2.5 1849 0.7

12 Mo

0055 2.3 0655 0.8 1313 2.4 1930 0.8

13 Tu

0138 2.3 0739 0.8 1356 2.4 2014 0.8

14 We

0225 2.3 0827 0.9 1442 2.4 2101 0.8

15 Th

0318 2.2 0920 0.9 1532 2.3 2153 0.8

16 Fr

0415 2.3 1018 0.9 1626 2.3 2249 0.8

Time m

17 Sa

0515 2.3 1117 0.9 1724 2.4 2347 0.7

18 Su

0614 2.4 1216 0.8 1824 2.4

19 Mo

0043 0.6 0710 2.5 1313 0.7 1922 2.5

20 Tu

0138 0.5 0803 2.7 1408 0.6 2018 2.6

21 We

0230 0.4 0855 2.8 1501 0.5 2112 2.7

22 Th

0322 0.3 0945 2.9 1553 0.4 2205 2.8

23 Fr

0412 0.2 1035 2.9 1645 0.3 2257 2.8

24 Sa

0502 0.2 1125 2.9 1736 0.3 2348 2.8

Time m

25 Su

0553 0.3 1216 2.9 1828 0.3

26 Mo

0041 2.7 0646 0.4 1307 2.8 1920 0.4

27 Tu

0134 2.7 0740 0.5 1400 2.7 2014 0.5

28 We

0231 2.6 0838 0.6 1455 2.6 2109 0.6

29 Th

0331 2.5 0938 0.7 1553 2.5 2208 0.6

30 Fr

0433 2.4 1040 0.8 1652 2.4 2307 0.7

31 Sa

0534 2.4 1140 0.8 1752 2.4





JULY 2012 TIME ZONE: -1200 TIMES AND HEIGHTS OF HIGH AND LOW WATERS

TIMES LISTED ARE NZ STANDARD TIME


Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6

52 53

Tide Tables 2014 -2015



EAST COAST - MARSDEN POINTFEBRUARY 2015

Lat. 35° 50’ S Long. 174° 30’ E






FEBRUARY 2015 N.Z. LOCAL TIMES AND HEIGHTS OF HIGH AND LOW WATERS



Time m

1 Su

0005 0.7 0632 2.4 1238 0.8 1849 2.4

2 Mo

0059 0.7 0725 2.5 1330 0.8 1942 2.4

3 Tu

0148 0.6 0812 2.5 1419 0.8 2029 2.4

4 We

0234 0.6 0856 2.5 1503 0.7 2113 2.4

5 Th

0315 0.6 0936 2.6 1544 0.7 2153 2.5

6 Fr

0354 0.6 1013 2.6 1623 0.7 2231 2.5

7 Sa

0431 0.6 1049 2.6 1701 0.7 2308 2.5

8 Su

0508 0.6 1124 2.6 1737 0.7 2345 2.4

Time m

9 Mo

0545 0.7 1201 2.5 1814 0.7

10 Tu

0024 2.4 0624 0.7 1239 2.5 1853 0.7

11 We

0105 2.4 0706 0.8 1321 2.4 1935 0.7

12 Th

0150 2.3 0752 0.8 1406 2.4 2021 0.8

13 Fr

0241 2.3 0844 0.9 1456 2.4 2113 0.8

14 Sa

0338 2.3 0942 0.9 1551 2.4 2211 0.8

15 Su

0439 2.4 1044 0.9 1653 2.4 2313 0.7

16 Mo

0541 2.4 1146 0.8 1756 2.4

Time m

17 Tu

0015 0.6 0641 2.6 1247 0.7 1858 2.5

18 We

0113 0.5 0737 2.7 1344 0.5 1957 2.7

19 Th

0208 0.4 0831 2.8 1439 0.4 2053 2.8

20 Fr

0301 0.3 0923 2.9 1532 0.3 2146 2.9

21 Sa

0353 0.2 1014 3.0 1624 0.3 2238 2.9

22 Su

0444 0.2 1104 3.0 1715 0.2 2330 2.9

23 Mo

0535 0.3 1155 2.9 1805 0.3

24 Tu

0021 2.8 0627 0.4 1245 2.8 1856 0.4

Time m

25 We

0113 2.7 0720 0.5 1337 2.7 1948 0.5

26 Th

0208 2.6 0816 0.7 1431 2.6 2043 0.6

27 Fr

0305 2.5 0915 0.8 1528 2.4 2140 0.7

28 Sa

0406 2.4 1015 0.9 1627 2.4 2239 0.8








Time m

1 Su

0005 0.7 0632 2.4 1238 0.8 1849 2.4

2 Mo

0059 0.7 0725 2.5 1330 0.8 1942 2.4

3 Tu

0148 0.6 0812 2.5 1419 0.8 2029 2.4

4 We

0234 0.6 0856 2.5 1503 0.7 2113 2.4

5 Th

0315 0.6 0936 2.6 1544 0.7 2153 2.5

6 Fr

0354 0.6 1013 2.6 1623 0.7 2231 2.5

7 Sa

0431 0.6 1049 2.6 1701 0.7 2308 2.5

8 Su

0508 0.6 1124 2.6 1737 0.7 2345 2.4

Time m

9 Mo

0545 0.7 1201 2.5 1814 0.7

10 Tu

0024 2.4 0624 0.7 1239 2.5 1853 0.7

11 We

0105 2.4 0706 0.8 1321 2.4 1935 0.7

12 Th

0150 2.3 0752 0.8 1406 2.4 2021 0.8

13 Fr

0241 2.3 0844 0.9 1456 2.4 2113 0.8

14 Sa

0338 2.3 0942 0.9 1551 2.4 2211 0.8

15 Su

0439 2.4 1044 0.9 1653 2.4 2313 0.7

16 Mo

0541 2.4 1146 0.8 1756 2.4

Time m

17 Tu

0015 0.6 0641 2.6 1247 0.7 1858 2.5

18 We

0113 0.5 0737 2.7 1344 0.5 1957 2.7

19 Th

0208 0.4 0831 2.8 1439 0.4 2053 2.8

20 Fr

0301 0.3 0923 2.9 1532 0.3 2146 2.9

21 Sa

0353 0.2 1014 3.0 1624 0.3 2238 2.9

22 Su

0444 0.2 1104 3.0 1715 0.2 2330 2.9

23 Mo

0535 0.3 1155 2.9 1805 0.3

24 Tu

0021 2.8 0627 0.4 1245 2.8 1856 0.4

Time m

25 We

0113 2.7 0720 0.5 1337 2.7 1948 0.5

26 Th

0208 2.6 0816 0.7 1431 2.6 2043 0.6

27 Fr

0305 2.5 0915 0.8 1528 2.4 2140 0.7

28 Sa

0406 2.4 1015 0.9 1627 2.4 2239 0.8








Time m

1 Su

0005 0.7 0632 2.4 1238 0.8 1849 2.4

2 Mo

0059 0.7 0725 2.5 1330 0.8 1942 2.4

3 Tu

0148 0.6 0812 2.5 1419 0.8 2029 2.4

4 We

0234 0.6 0856 2.5 1503 0.7 2113 2.4

5 Th

0315 0.6 0936 2.6 1544 0.7 2153 2.5

6 Fr

0354 0.6 1013 2.6 1623 0.7 2231 2.5

7 Sa

0431 0.6 1049 2.6 1701 0.7 2308 2.5

8 Su

0508 0.6 1124 2.6 1737 0.7 2345 2.4

Time m

9 Mo

0545 0.7 1201 2.5 1814 0.7

10 Tu

0024 2.4 0624 0.7 1239 2.5 1853 0.7

11 We

0105 2.4 0706 0.8 1321 2.4 1935 0.7

12 Th

0150 2.3 0752 0.8 1406 2.4 2021 0.8

13 Fr

0241 2.3 0844 0.9 1456 2.4 2113 0.8

14 Sa

0338 2.3 0942 0.9 1551 2.4 2211 0.8

15 Su

0439 2.4 1044 0.9 1653 2.4 2313 0.7

16 Mo

0541 2.4 1146 0.8 1756 2.4

Time m

17 Tu

0015 0.6 0641 2.6 1247 0.7 1858 2.5

18 We

0113 0.5 0737 2.7 1344 0.5 1957 2.7

19 Th

0208 0.4 0831 2.8 1439 0.4 2053 2.8

20 Fr

0301 0.3 0923 2.9 1532 0.3 2146 2.9

21 Sa

0353 0.2 1014 3.0 1624 0.3 2238 2.9

22 Su

0444 0.2 1104 3.0 1715 0.2 2330 2.9

23 Mo

0535 0.3 1155 2.9 1805 0.3

24 Tu

0021 2.8 0627 0.4 1245 2.8 1856 0.4

Time m

25 We

0113 2.7 0720 0.5 1337 2.7 1948 0.5

26 Th

0208 2.6 0816 0.7 1431 2.6 2043 0.6

27 Fr

0305 2.5 0915 0.8 1528 2.4 2140 0.7

28 Sa

0406 2.4 1015 0.9 1627 2.4 2239 0.8








Time m

1 Su

0005 0.7 0632 2.4 1238 0.8 1849 2.4

2 Mo

0059 0.7 0725 2.5 1330 0.8 1942 2.4

3 Tu

0148 0.6 0812 2.5 1419 0.8 2029 2.4

4 We

0234 0.6 0856 2.5 1503 0.7 2113 2.4

5 Th

0315 0.6 0936 2.6 1544 0.7 2153 2.5

6 Fr

0354 0.6 1013 2.6 1623 0.7 2231 2.5

7 Sa

0431 0.6 1049 2.6 1701 0.7 2308 2.5

8 Su

0508 0.6 1124 2.6 1737 0.7 2345 2.4

Time m

9 Mo

0545 0.7 1201 2.5 1814 0.7

10 Tu

0024 2.4 0624 0.7 1239 2.5 1853 0.7

11 We

0105 2.4 0706 0.8 1321 2.4 1935 0.7

12 Th

0150 2.3 0752 0.8 1406 2.4 2021 0.8

13 Fr

0241 2.3 0844 0.9 1456 2.4 2113 0.8

14 Sa

0338 2.3 0942 0.9 1551 2.4 2211 0.8

15 Su

0439 2.4 1044 0.9 1653 2.4 2313 0.7

16 Mo

0541 2.4 1146 0.8 1756 2.4

Time m

17 Tu

0015 0.6 0641 2.6 1247 0.7 1858 2.5

18 We

0113 0.5 0737 2.7 1344 0.5 1957 2.7

19 Th

0208 0.4 0831 2.8 1439 0.4 2053 2.8

20 Fr

0301 0.3 0923 2.9 1532 0.3 2146 2.9

21 Sa

0353 0.2 1014 3.0 1624 0.3 2238 2.9

22 Su

0444 0.2 1104 3.0 1715 0.2 2330 2.9

23 Mo

0535 0.3 1155 2.9 1805 0.3

24 Tu

0021 2.8 0627 0.4 1245 2.8 1856 0.4

Time m

25 We

0113 2.7 0720 0.5 1337 2.7 1948 0.5

26 Th

0208 2.6 0816 0.7 1431 2.6 2043 0.6

27 Fr

0305 2.5 0915 0.8 1528 2.4 2140 0.7

28 Sa

0406 2.4 1015 0.9 1627 2.4 2239 0.8








Time m

1 Su

0005 0.7 0632 2.4 1238 0.8 1849 2.4

2 Mo

0059 0.7 0725 2.5 1330 0.8 1942 2.4

3 Tu

0148 0.6 0812 2.5 1419 0.8 2029 2.4

4 We

0234 0.6 0856 2.5 1503 0.7 2113 2.4

5 Th

0315 0.6 0936 2.6 1544 0.7 2153 2.5

6 Fr

0354 0.6 1013 2.6 1623 0.7 2231 2.5

7 Sa

0431 0.6 1049 2.6 1701 0.7 2308 2.5

8 Su

0508 0.6 1124 2.6 1737 0.7 2345 2.4

Time m

9 Mo

0545 0.7 1201 2.5 1814 0.7

10 Tu

0024 2.4 0624 0.7 1239 2.5 1853 0.7

11 We

0105 2.4 0706 0.8 1321 2.4 1935 0.7

12 Th

0150 2.3 0752 0.8 1406 2.4 2021 0.8

13 Fr

0241 2.3 0844 0.9 1456 2.4 2113 0.8

14 Sa

0338 2.3 0942 0.9 1551 2.4 2211 0.8

15 Su

0439 2.4 1044 0.9 1653 2.4 2313 0.7

16 Mo

0541 2.4 1146 0.8 1756 2.4

Time m

17 Tu

0015 0.6 0641 2.6 1247 0.7 1858 2.5

18 We

0113 0.5 0737 2.7 1344 0.5 1957 2.7

19 Th

0208 0.4 0831 2.8 1439 0.4 2053 2.8

20 Fr

0301 0.3 0923 2.9 1532 0.3 2146 2.9

21 Sa

0353 0.2 1014 3.0 1624 0.3 2238 2.9

22 Su

0444 0.2 1104 3.0 1715 0.2 2330 2.9

23 Mo

0535 0.3 1155 2.9 1805 0.3

24 Tu

0021 2.8 0627 0.4 1245 2.8 1856 0.4

Time m

25 We

0113 2.7 0720 0.5 1337 2.7 1948 0.5

26 Th

0208 2.6 0816 0.7 1431 2.6 2043 0.6

27 Fr

0305 2.5 0915 0.8 1528 2.4 2140 0.7

28 Sa

0406 2.4 1015 0.9 1627 2.4 2239 0.8








Time m

1 Su

0005 0.7 0632 2.4 1238 0.8 1849 2.4

2 Mo

0059 0.7 0725 2.5 1330 0.8 1942 2.4

3 Tu

0148 0.6 0812 2.5 1419 0.8 2029 2.4

4 We

0234 0.6 0856 2.5 1503 0.7 2113 2.4

5 Th

0315 0.6 0936 2.6 1544 0.7 2153 2.5

6 Fr

0354 0.6 1013 2.6 1623 0.7 2231 2.5

7 Sa

0431 0.6 1049 2.6 1701 0.7 2308 2.5

8 Su

0508 0.6 1124 2.6 1737 0.7 2345 2.4

Time m

9 Mo

0545 0.7 1201 2.5 1814 0.7

10 Tu

0024 2.4 0624 0.7 1239 2.5 1853 0.7

11 We

0105 2.4 0706 0.8 1321 2.4 1935 0.7

12 Th

0150 2.3 0752 0.8 1406 2.4 2021 0.8

13 Fr

0241 2.3 0844 0.9 1456 2.4 2113 0.8

14 Sa

0338 2.3 0942 0.9 1551 2.4 2211 0.8

15 Su

0439 2.4 1044 0.9 1653 2.4 2313 0.7

16 Mo

0541 2.4 1146 0.8 1756 2.4

Time m

17 Tu

0015 0.6 0641 2.6 1247 0.7 1858 2.5

18 We

0113 0.5 0737 2.7 1344 0.5 1957 2.7

19 Th

0208 0.4 0831 2.8 1439 0.4 2053 2.8

20 Fr

0301 0.3 0923 2.9 1532 0.3 2146 2.9

21 Sa

0353 0.2 1014 3.0 1624 0.3 2238 2.9

22 Su

0444 0.2 1104 3.0 1715 0.2 2330 2.9

23 Mo

0535 0.3 1155 2.9 1805 0.3

24 Tu

0021 2.8 0627 0.4 1245 2.8 1856 0.4

Time m

25 We

0113 2.7 0720 0.5 1337 2.7 1948 0.5

26 Th

0208 2.6 0816 0.7 1431 2.6 2043 0.6

27 Fr

0305 2.5 0915 0.8 1528 2.4 2140 0.7

28 Sa

0406 2.4 1015 0.9 1627 2.4 2239 0.8








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6

53




EAST COAST - MARSDEN POINTMARCH 2015

Lat. 35° 50’ S Long. 174° 30’ E






MARCH 2015 N.Z. LOCAL TIMES AND HEIGHTS OF HIGH AND LOW WATERS



Time m

1 Su

0507 2.4 1116 0.9 1727 2.3 2338 0.8

2 Mo

0604 2.4 1212 0.9 1825 2.3

3 Tu

0033 0.8 0657 2.4 1305 0.8 1917 2.3

4 We

0123 0.7 0744 2.5 1352 0.8 2005 2.4

5 Th

0207 0.7 0827 2.5 1435 0.8 2047 2.4

6 Fr

0248 0.7 0906 2.5 1515 0.7 2126 2.5

7 Sa

0327 0.7 0942 2.5 1553 0.7 2203 2.5

8 Su

0404 0.6 1018 2.6 1629 0.7 2240 2.5

Time m

9 Mo

0440 0.7 1054 2.6 1706 0.7 2317 2.5

10 Tu

0518 0.7 1131 2.5 1742 0.7 2356 2.5

11 We

0557 0.7 1210 2.5 1821 0.7

12 Th

0037 2.5 0639 0.8 1252 2.5 1903 0.7

13 Fr

0122 2.4 0726 0.8 1338 2.4 1949 0.7

14 Sa

0212 2.4 0817 0.8 1429 2.4 2042 0.8

15 Su

0309 2.4 0916 0.9 1525 2.4 2142 0.8

16 Mo

0410 2.4 1018 0.8 1628 2.4 2245 0.7

Time m

17 Tu

0513 2.5 1121 0.7 1733 2.5 2349 0.6

18 We

0614 2.6 1223 0.6 1837 2.6

19 Th

0049 0.5 0712 2.7 1321 0.5 1937 2.7

20 Fr

0146 0.4 0807 2.8 1417 0.4 2033 2.8

21 Sa

0240 0.3 0900 2.9 1510 0.3 2127 2.9

22 Su

0332 0.3 0951 3.0 1601 0.2 2219 2.9

23 Mo

0424 0.3 1042 2.9 1652 0.2 2309 2.9

24 Tu

0515 0.4 1132 2.9 1741 0.3 2359 2.8

Time m

25 We

0607 0.5 1222 2.8 1831 0.4

26 Th

0050 2.7 0659 0.6 1313 2.6 1921 0.5

27 Fr

0142 2.6 0753 0.7 1405 2.5 2014 0.7

28 Sa

0237 2.5 0849 0.8 1500 2.4 2110 0.8

29 Su

0335 2.4 0948 0.9 1558 2.3 2208 0.8

30 Mo

0433 2.4 1046 0.9 1657 2.3 2306 0.9

31 Tu

0530 2.4 1141 0.9 1755 2.3








Time m

1 Su

0507 2.4 1116 0.9 1727 2.3 2338 0.8

2 Mo

0604 2.4 1212 0.9 1825 2.3

3 Tu

0033 0.8 0657 2.4 1305 0.8 1917 2.3

4 We

0123 0.7 0744 2.5 1352 0.8 2005 2.4

5 Th

0207 0.7 0827 2.5 1435 0.8 2047 2.4

6 Fr

0248 0.7 0906 2.5 1515 0.7 2126 2.5

7 Sa

0327 0.7 0942 2.5 1553 0.7 2203 2.5

8 Su

0404 0.6 1018 2.6 1629 0.7 2240 2.5

Time m

9 Mo

0440 0.7 1054 2.6 1706 0.7 2317 2.5

10 Tu

0518 0.7 1131 2.5 1742 0.7 2356 2.5

11 We

0557 0.7 1210 2.5 1821 0.7

12 Th

0037 2.5 0639 0.8 1252 2.5 1903 0.7

13 Fr

0122 2.4 0726 0.8 1338 2.4 1949 0.7

14 Sa

0212 2.4 0817 0.8 1429 2.4 2042 0.8

15 Su

0309 2.4 0916 0.9 1525 2.4 2142 0.8

16 Mo

0410 2.4 1018 0.8 1628 2.4 2245 0.7

Time m

17 Tu

0513 2.5 1121 0.7 1733 2.5 2349 0.6

18 We

0614 2.6 1223 0.6 1837 2.6

19 Th

0049 0.5 0712 2.7 1321 0.5 1937 2.7

20 Fr

0146 0.4 0807 2.8 1417 0.4 2033 2.8

21 Sa

0240 0.3 0900 2.9 1510 0.3 2127 2.9

22 Su

0332 0.3 0951 3.0 1601 0.2 2219 2.9

23 Mo

0424 0.3 1042 2.9 1652 0.2 2309 2.9

24 Tu

0515 0.4 1132 2.9 1741 0.3 2359 2.8

Time m

25 We

0607 0.5 1222 2.8 1831 0.4

26 Th

0050 2.7 0659 0.6 1313 2.6 1921 0.5

27 Fr

0142 2.6 0753 0.7 1405 2.5 2014 0.7

28 Sa

0237 2.5 0849 0.8 1500 2.4 2110 0.8

29 Su

0335 2.4 0948 0.9 1558 2.3 2208 0.8

30 Mo

0433 2.4 1046 0.9 1657 2.3 2306 0.9

31 Tu

0530 2.4 1141 0.9 1755 2.3








Time m

1 Su

0507 2.4 1116 0.9 1727 2.3 2338 0.8

2 Mo

0604 2.4 1212 0.9 1825 2.3

3 Tu

0033 0.8 0657 2.4 1305 0.8 1917 2.3

4 We

0123 0.7 0744 2.5 1352 0.8 2005 2.4

5 Th

0207 0.7 0827 2.5 1435 0.8 2047 2.4

6 Fr

0248 0.7 0906 2.5 1515 0.7 2126 2.5

7 Sa

0327 0.7 0942 2.5 1553 0.7 2203 2.5

8 Su

0404 0.6 1018 2.6 1629 0.7 2240 2.5

Time m

9 Mo

0440 0.7 1054 2.6 1706 0.7 2317 2.5

10 Tu

0518 0.7 1131 2.5 1742 0.7 2356 2.5

11 We

0557 0.7 1210 2.5 1821 0.7

12 Th

0037 2.5 0639 0.8 1252 2.5 1903 0.7

13 Fr

0122 2.4 0726 0.8 1338 2.4 1949 0.7

14 Sa

0212 2.4 0817 0.8 1429 2.4 2042 0.8

15 Su

0309 2.4 0916 0.9 1525 2.4 2142 0.8

16 Mo

0410 2.4 1018 0.8 1628 2.4 2245 0.7

Time m

17 Tu

0513 2.5 1121 0.7 1733 2.5 2349 0.6

18 We

0614 2.6 1223 0.6 1837 2.6

19 Th

0049 0.5 0712 2.7 1321 0.5 1937 2.7

20 Fr

0146 0.4 0807 2.8 1417 0.4 2033 2.8

21 Sa

0240 0.3 0900 2.9 1510 0.3 2127 2.9

22 Su

0332 0.3 0951 3.0 1601 0.2 2219 2.9

23 Mo

0424 0.3 1042 2.9 1652 0.2 2309 2.9

24 Tu

0515 0.4 1132 2.9 1741 0.3 2359 2.8

Time m

25 We

0607 0.5 1222 2.8 1831 0.4

26 Th

0050 2.7 0659 0.6 1313 2.6 1921 0.5

27 Fr

0142 2.6 0753 0.7 1405 2.5 2014 0.7

28 Sa

0237 2.5 0849 0.8 1500 2.4 2110 0.8

29 Su

0335 2.4 0948 0.9 1558 2.3 2208 0.8

30 Mo

0433 2.4 1046 0.9 1657 2.3 2306 0.9

31 Tu

0530 2.4 1141 0.9 1755 2.3








Time m

1 Su

0507 2.4 1116 0.9 1727 2.3 2338 0.8

2 Mo

0604 2.4 1212 0.9 1825 2.3

3 Tu

0033 0.8 0657 2.4 1305 0.8 1917 2.3

4 We

0123 0.7 0744 2.5 1352 0.8 2005 2.4

5 Th

0207 0.7 0827 2.5 1435 0.8 2047 2.4

6 Fr

0248 0.7 0906 2.5 1515 0.7 2126 2.5

7 Sa

0327 0.7 0942 2.5 1553 0.7 2203 2.5

8 Su

0404 0.6 1018 2.6 1629 0.7 2240 2.5

Time m

9 Mo

0440 0.7 1054 2.6 1706 0.7 2317 2.5

10 Tu

0518 0.7 1131 2.5 1742 0.7 2356 2.5

11 We

0557 0.7 1210 2.5 1821 0.7

12 Th

0037 2.5 0639 0.8 1252 2.5 1903 0.7

13 Fr

0122 2.4 0726 0.8 1338 2.4 1949 0.7

14 Sa

0212 2.4 0817 0.8 1429 2.4 2042 0.8

15 Su

0309 2.4 0916 0.9 1525 2.4 2142 0.8

16 Mo

0410 2.4 1018 0.8 1628 2.4 2245 0.7

Time m

17 Tu

0513 2.5 1121 0.7 1733 2.5 2349 0.6

18 We

0614 2.6 1223 0.6 1837 2.6

19 Th

0049 0.5 0712 2.7 1321 0.5 1937 2.7

20 Fr

0146 0.4 0807 2.8 1417 0.4 2033 2.8

21 Sa

0240 0.3 0900 2.9 1510 0.3 2127 2.9

22 Su

0332 0.3 0951 3.0 1601 0.2 2219 2.9

23 Mo

0424 0.3 1042 2.9 1652 0.2 2309 2.9

24 Tu

0515 0.4 1132 2.9 1741 0.3 2359 2.8

Time m

25 We

0607 0.5 1222 2.8 1831 0.4

26 Th

0050 2.7 0659 0.6 1313 2.6 1921 0.5

27 Fr

0142 2.6 0753 0.7 1405 2.5 2014 0.7

28 Sa

0237 2.5 0849 0.8 1500 2.4 2110 0.8

29 Su

0335 2.4 0948 0.9 1558 2.3 2208 0.8

30 Mo

0433 2.4 1046 0.9 1657 2.3 2306 0.9

31 Tu

0530 2.4 1141 0.9 1755 2.3








Time m

1 Su

0507 2.4 1116 0.9 1727 2.3 2338 0.8

2 Mo

0604 2.4 1212 0.9 1825 2.3

3 Tu

0033 0.8 0657 2.4 1305 0.8 1917 2.3

4 We

0123 0.7 0744 2.5 1352 0.8 2005 2.4

5 Th

0207 0.7 0827 2.5 1435 0.8 2047 2.4

6 Fr

0248 0.7 0906 2.5 1515 0.7 2126 2.5

7 Sa

0327 0.7 0942 2.5 1553 0.7 2203 2.5

8 Su

0404 0.6 1018 2.6 1629 0.7 2240 2.5

Time m

9 Mo

0440 0.7 1054 2.6 1706 0.7 2317 2.5

10 Tu

0518 0.7 1131 2.5 1742 0.7 2356 2.5

11 We

0557 0.7 1210 2.5 1821 0.7

12 Th

0037 2.5 0639 0.8 1252 2.5 1903 0.7

13 Fr

0122 2.4 0726 0.8 1338 2.4 1949 0.7

14 Sa

0212 2.4 0817 0.8 1429 2.4 2042 0.8

15 Su

0309 2.4 0916 0.9 1525 2.4 2142 0.8

16 Mo

0410 2.4 1018 0.8 1628 2.4 2245 0.7

Time m

17 Tu

0513 2.5 1121 0.7 1733 2.5 2349 0.6

18 We

0614 2.6 1223 0.6 1837 2.6

19 Th

0049 0.5 0712 2.7 1321 0.5 1937 2.7

20 Fr

0146 0.4 0807 2.8 1417 0.4 2033 2.8

21 Sa

0240 0.3 0900 2.9 1510 0.3 2127 2.9

22 Su

0332 0.3 0951 3.0 1601 0.2 2219 2.9

23 Mo

0424 0.3 1042 2.9 1652 0.2 2309 2.9

24 Tu

0515 0.4 1132 2.9 1741 0.3 2359 2.8

Time m

25 We

0607 0.5 1222 2.8 1831 0.4

26 Th

0050 2.7 0659 0.6 1313 2.6 1921 0.5

27 Fr

0142 2.6 0753 0.7 1405 2.5 2014 0.7

28 Sa

0237 2.5 0849 0.8 1500 2.4 2110 0.8

29 Su

0335 2.4 0948 0.9 1558 2.3 2208 0.8

30 Mo

0433 2.4 1046 0.9 1657 2.3 2306 0.9

31 Tu

0530 2.4 1141 0.9 1755 2.3








Time m

1 Su

0507 2.4 1116 0.9 1727 2.3 2338 0.8

2 Mo

0604 2.4 1212 0.9 1825 2.3

3 Tu

0033 0.8 0657 2.4 1305 0.8 1917 2.3

4 We

0123 0.7 0744 2.5 1352 0.8 2005 2.4

5 Th

0207 0.7 0827 2.5 1435 0.8 2047 2.4

6 Fr

0248 0.7 0906 2.5 1515 0.7 2126 2.5

7 Sa

0327 0.7 0942 2.5 1553 0.7 2203 2.5

8 Su

0404 0.6 1018 2.6 1629 0.7 2240 2.5

Time m

9 Mo

0440 0.7 1054 2.6 1706 0.7 2317 2.5

10 Tu

0518 0.7 1131 2.5 1742 0.7 2356 2.5

11 We

0557 0.7 1210 2.5 1821 0.7

12 Th

0037 2.5 0639 0.8 1252 2.5 1903 0.7

13 Fr

0122 2.4 0726 0.8 1338 2.4 1949 0.7

14 Sa

0212 2.4 0817 0.8 1429 2.4 2042 0.8

15 Su

0309 2.4 0916 0.9 1525 2.4 2142 0.8

16 Mo

0410 2.4 1018 0.8 1628 2.4 2245 0.7

Time m

17 Tu

0513 2.5 1121 0.7 1733 2.5 2349 0.6

18 We

0614 2.6 1223 0.6 1837 2.6

19 Th

0049 0.5 0712 2.7 1321 0.5 1937 2.7

20 Fr

0146 0.4 0807 2.8 1417 0.4 2033 2.8

21 Sa

0240 0.3 0900 2.9 1510 0.3 2127 2.9

22 Su

0332 0.3 0951 3.0 1601 0.2 2219 2.9

23 Mo

0424 0.3 1042 2.9 1652 0.2 2309 2.9

24 Tu

0515 0.4 1132 2.9 1741 0.3 2359 2.8

Time m

25 We

0607 0.5 1222 2.8 1831 0.4

26 Th

0050 2.7 0659 0.6 1313 2.6 1921 0.5

27 Fr

0142 2.6 0753 0.7 1405 2.5 2014 0.7

28 Sa

0237 2.5 0849 0.8 1500 2.4 2110 0.8

29 Su

0335 2.4 0948 0.9 1558 2.3 2208 0.8

30 Mo

0433 2.4 1046 0.9 1657 2.3 2306 0.9

31 Tu

0530 2.4 1141 0.9 1755 2.3








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6

January 2015

Sourced from http://www.linz.govt.nz/E-mail address [email protected]


MARSDEN POINT Lat. 35° 50' S., Long. 174° 30' E.

JANUARY 2014 TIME ZONE: -1200 TIMES AND HEIGHTS OF HIGH AND LOW WATERS

TIMES LISTED ARE NZ STANDARD TIME REMEMBER TO ADD 1 HOUR FOR NZ DAYLIGHT SAVING TIME


Time m

1 We

0033 0.4 0659 2.7 1303 0.5 1914 2.7

2 Th

0128 0.3 0753 2.8 1358 0.4 2010 2.7

3 Fr

0220 0.2 0845 2.9 1453 0.3 2104 2.8

4 Sa

0312 0.2 0937 3.0 1546 0.3 2157 2.8

5 Su

0404 0.2 1028 2.9 1638 0.3 2250 2.8

6 Mo

0455 0.3 1119 2.9 1731 0.4 2342 2.7

7 Tu

0547 0.4 1210 2.8 1823 0.4

8 We

0036 2.6 0641 0.5 1303 2.7 1916 0.5

Time m

9 Th

0132 2.5 0738 0.7 1356 2.6 2011 0.6

10 Fr

0230 2.4 0836 0.8 1451 2.5 2107 0.7

11 Sa

0330 2.4 0936 0.8 1548 2.4 2203 0.7

12 Su

0430 2.4 1035 0.9 1645 2.3 2259 0.7

13 Mo

0526 2.4 1130 0.9 1739 2.3 2351 0.7

14 Tu

0617 2.4 1221 0.9 1830 2.3

15 We

0039 0.7 0704 2.4 1308 0.8 1916 2.4

16 Th

0123 0.6 0746 2.5 1352 0.8 1959 2.4

Time m

17 Fr

0204 0.6 0825 2.5 1433 0.8 2039 2.4

18 Sa

0242 0.6 0902 2.5 1511 0.7 2117 2.4

19 Su

0319 0.6 0938 2.6 1549 0.7 2155 2.4

20 Mo

0356 0.6 1014 2.6 1627 0.7 2233 2.4

21 Tu

0433 0.6 1052 2.5 1705 0.7 2313 2.4

22 We

0512 0.7 1131 2.5 1745 0.7 2355 2.4

23 Th

0555 0.7 1213 2.5 1827 0.7

24 Fr

0041 2.4 0641 0.8 1259 2.5 1914 0.7

Time m

25 Sa

0132 2.3 0734 0.8 1349 2.4 2007 0.7

26 Su

0230 2.4 0833 0.8 1445 2.4 2106 0.7

27 Mo

0333 2.4 0937 0.8 1547 2.4 2208 0.6

28 Tu

0437 2.5 1041 0.7 1651 2.5 2311 0.5

29 We

0539 2.6 1144 0.6 1755 2.6

30 Th

0011 0.4 0637 2.7 1243 0.5 1856 2.7

31 Fr

0108 0.3 0733 2.8 1340 0.4 1953 2.8

MARSDEN POINT

February 2015 March 2015

Tide Charts 2015 proudly sponsored by

EQUIPMENT HIRE TESTING AND SERVICING

DIVE COURSES

Sourced from http://www.linz.govt.nz/E-mail address [email protected]


MARSDEN POINT Lat. 35° 50' S., Long. 174° 30' E.

JANUARY 2014 TIME ZONE: -1200 TIMES AND HEIGHTS OF HIGH AND LOW WATERS

TIMES LISTED ARE NZ STANDARD TIME REMEMBER TO ADD 1 HOUR FOR NZ DAYLIGHT SAVING TIME


Time m

1 We

0033 0.4 0659 2.7 1303 0.5 1914 2.7

2 Th

0128 0.3 0753 2.8 1358 0.4 2010 2.7

3 Fr

0220 0.2 0845 2.9 1453 0.3 2104 2.8

4 Sa

0312 0.2 0937 3.0 1546 0.3 2157 2.8

5 Su

0404 0.2 1028 2.9 1638 0.3 2250 2.8

6 Mo

0455 0.3 1119 2.9 1731 0.4 2342 2.7

7 Tu

0547 0.4 1210 2.8 1823 0.4

8 We

0036 2.6 0641 0.5 1303 2.7 1916 0.5

Time m

9 Th

0132 2.5 0738 0.7 1356 2.6 2011 0.6

10 Fr

0230 2.4 0836 0.8 1451 2.5 2107 0.7

11 Sa

0330 2.4 0936 0.8 1548 2.4 2203 0.7

12 Su

0430 2.4 1035 0.9 1645 2.3 2259 0.7

13 Mo

0526 2.4 1130 0.9 1739 2.3 2351 0.7

14 Tu

0617 2.4 1221 0.9 1830 2.3

15 We

0039 0.7 0704 2.4 1308 0.8 1916 2.4

16 Th

0123 0.6 0746 2.5 1352 0.8 1959 2.4

Time m

17 Fr

0204 0.6 0825 2.5 1433 0.8 2039 2.4

18 Sa

0242 0.6 0902 2.5 1511 0.7 2117 2.4

19 Su

0319 0.6 0938 2.6 1549 0.7 2155 2.4

20 Mo

0356 0.6 1014 2.6 1627 0.7 2233 2.4

21 Tu

0433 0.6 1052 2.5 1705 0.7 2313 2.4

22 We

0512 0.7 1131 2.5 1745 0.7 2355 2.4

23 Th

0555 0.7 1213 2.5 1827 0.7

24 Fr

0041 2.4 0641 0.8 1259 2.5 1914 0.7

Time m

25 Sa

0132 2.3 0734 0.8 1349 2.4 2007 0.7

26 Su

0230 2.4 0833 0.8 1445 2.4 2106 0.7

27 Mo

0333 2.4 0937 0.8 1547 2.4 2208 0.6

28 Tu

0437 2.5 1041 0.7 1651 2.5 2311 0.5

29 We

0539 2.6 1144 0.6 1755 2.6

30 Th

0011 0.4 0637 2.7 1243 0.5 1856 2.7

31 Fr

0108 0.3 0733 2.8 1340 0.4 1953 2.8

41 Clyde Street, Whangarei I 09 438 1075 0800 102 102 I [email protected] I www.divenow.co.nz

55

54 55


NZ daylight saving time ends at 0300 local time on Sunday 5 April 2015.

Tide times listed are NZ standard time.


EAST COAST - MARSDEN POINTAPRIL 2015

Lat. 35° 50’ S Long. 174° 30’ E






APRIL 2015 N.Z. LOCAL TIMES AND HEIGHTS OF HIGH AND LOW WATERS



Time m

1 We

0001 0.9 0622 2.4 1233 0.9 1847 2.3

2 Th

0051 0.8 0709 2.4 1320 0.8 1935 2.4

3 Fr

0136 0.8 0751 2.4 1403 0.8 2017 2.4

4 Sa

0218 0.7 0831 2.5 1443 0.7 2057 2.5

5 Su

0257 0.7 0808 2.5 1421 0.7 2035 2.5

6 Mo

0235 0.7 0846 2.5 1458 0.6 2113 2.6

7 Tu

0314 0.7 0924 2.5 1535 0.6 2151 2.6

8 We

0353 0.7 1004 2.5 1614 0.6 2232 2.6

Time m

9 Th

0434 0.7 1045 2.5 1654 0.6 2314 2.6

10 Fr

0518 0.7 1129 2.5 1738 0.7

11 Sa

0001 2.5 0606 0.8 1217 2.5 1826 0.7

12 Su

0051 2.5 0659 0.8 1309 2.4 1919 0.7

13 Mo

0147 2.5 0757 0.8 1407 2.4 2019 0.7

14 Tu

0247 2.5 0858 0.7 1509 2.4 2123 0.7

15 We

0348 2.6 1000 0.7 1614 2.5 2226 0.6

16 Th

0449 2.6 1101 0.6 1718 2.6 2327 0.6

Time m

17 Fr

0547 2.7 1159 0.5 1818 2.7

18 Sa

0025 0.5 0643 2.8 1254 0.4 1914 2.8

19 Su

0119 0.4 0736 2.9 1347 0.3 2007 2.9

20 Mo

0212 0.4 0828 2.9 1438 0.3 2058 2.9

21 Tu

0304 0.4 0919 2.8 1528 0.3 2148 2.9

22 We

0355 0.4 1009 2.8 1616 0.4 2237 2.8

23 Th

0445 0.5 1058 2.7 1704 0.5 2326 2.7

24 Fr

0536 0.6 1148 2.6 1753 0.6

Time m

25 Sa

0015 2.6 0628 0.7 1238 2.5 1843 0.7

26 Su

0106 2.5 0721 0.8 1330 2.4 1936 0.8

27 Mo

0159 2.4 0815 0.9 1424 2.3 2031 0.9

28 Tu

0253 2.4 0910 0.9 1521 2.3 2127 0.9

29 We

0347 2.3 1004 0.9 1617 2.3 2222 0.9

30 Th

0438 2.3 1054 0.9 1710 2.3 2313 0.9








Time m

1 We

0001 0.9 0622 2.4 1233 0.9 1847 2.3

2 Th

0051 0.8 0709 2.4 1320 0.8 1935 2.4

3 Fr

0136 0.8 0751 2.4 1403 0.8 2017 2.4

4 Sa

0218 0.7 0831 2.5 1443 0.7 2057 2.5

5 Su

0257 0.7 0808 2.5 1421 0.7 2035 2.5

6 Mo

0235 0.7 0846 2.5 1458 0.6 2113 2.6

7 Tu

0314 0.7 0924 2.5 1535 0.6 2151 2.6

8 We

0353 0.7 1004 2.5 1614 0.6 2232 2.6

Time m

9 Th

0434 0.7 1045 2.5 1654 0.6 2314 2.6

10 Fr

0518 0.7 1129 2.5 1738 0.7

11 Sa

0001 2.5 0606 0.8 1217 2.5 1826 0.7

12 Su

0051 2.5 0659 0.8 1309 2.4 1919 0.7

13 Mo

0147 2.5 0757 0.8 1407 2.4 2019 0.7

14 Tu

0247 2.5 0858 0.7 1509 2.4 2123 0.7

15 We

0348 2.6 1000 0.7 1614 2.5 2226 0.6

16 Th

0449 2.6 1101 0.6 1718 2.6 2327 0.6

Time m

17 Fr

0547 2.7 1159 0.5 1818 2.7

18 Sa

0025 0.5 0643 2.8 1254 0.4 1914 2.8

19 Su

0119 0.4 0736 2.9 1347 0.3 2007 2.9

20 Mo

0212 0.4 0828 2.9 1438 0.3 2058 2.9

21 Tu

0304 0.4 0919 2.8 1528 0.3 2148 2.9

22 We

0355 0.4 1009 2.8 1616 0.4 2237 2.8

23 Th

0445 0.5 1058 2.7 1704 0.5 2326 2.7

24 Fr

0536 0.6 1148 2.6 1753 0.6

Time m

25 Sa

0015 2.6 0628 0.7 1238 2.5 1843 0.7

26 Su

0106 2.5 0721 0.8 1330 2.4 1936 0.8

27 Mo

0159 2.4 0815 0.9 1424 2.3 2031 0.9

28 Tu

0253 2.4 0910 0.9 1521 2.3 2127 0.9

29 We

0347 2.3 1004 0.9 1617 2.3 2222 0.9

30 Th

0438 2.3 1054 0.9 1710 2.3 2313 0.9








Time m

1 We

0001 0.9 0622 2.4 1233 0.9 1847 2.3

2 Th

0051 0.8 0709 2.4 1320 0.8 1935 2.4

3 Fr

0136 0.8 0751 2.4 1403 0.8 2017 2.4

4 Sa

0218 0.7 0831 2.5 1443 0.7 2057 2.5

5 Su

0257 0.7 0808 2.5 1421 0.7 2035 2.5

6 Mo

0235 0.7 0846 2.5 1458 0.6 2113 2.6

7 Tu

0314 0.7 0924 2.5 1535 0.6 2151 2.6

8 We

0353 0.7 1004 2.5 1614 0.6 2232 2.6

Time m

9 Th

0434 0.7 1045 2.5 1654 0.6 2314 2.6

10 Fr

0518 0.7 1129 2.5 1738 0.7

11 Sa

0001 2.5 0606 0.8 1217 2.5 1826 0.7

12 Su

0051 2.5 0659 0.8 1309 2.4 1919 0.7

13 Mo

0147 2.5 0757 0.8 1407 2.4 2019 0.7

14 Tu

0247 2.5 0858 0.7 1509 2.4 2123 0.7

15 We

0348 2.6 1000 0.7 1614 2.5 2226 0.6

16 Th

0449 2.6 1101 0.6 1718 2.6 2327 0.6

Time m

17 Fr

0547 2.7 1159 0.5 1818 2.7

18 Sa

0025 0.5 0643 2.8 1254 0.4 1914 2.8

19 Su

0119 0.4 0736 2.9 1347 0.3 2007 2.9

20 Mo

0212 0.4 0828 2.9 1438 0.3 2058 2.9

21 Tu

0304 0.4 0919 2.8 1528 0.3 2148 2.9

22 We

0355 0.4 1009 2.8 1616 0.4 2237 2.8

23 Th

0445 0.5 1058 2.7 1704 0.5 2326 2.7

24 Fr

0536 0.6 1148 2.6 1753 0.6

Time m

25 Sa

0015 2.6 0628 0.7 1238 2.5 1843 0.7

26 Su

0106 2.5 0721 0.8 1330 2.4 1936 0.8

27 Mo

0159 2.4 0815 0.9 1424 2.3 2031 0.9

28 Tu

0253 2.4 0910 0.9 1521 2.3 2127 0.9

29 We

0347 2.3 1004 0.9 1617 2.3 2222 0.9

30 Th

0438 2.3 1054 0.9 1710 2.3 2313 0.9








Time m

1 We

0001 0.9 0622 2.4 1233 0.9 1847 2.3

2 Th

0051 0.8 0709 2.4 1320 0.8 1935 2.4

3 Fr

0136 0.8 0751 2.4 1403 0.8 2017 2.4

4 Sa

0218 0.7 0831 2.5 1443 0.7 2057 2.5

5 Su

0257 0.7 0808 2.5 1421 0.7 2035 2.5

6 Mo

0235 0.7 0846 2.5 1458 0.6 2113 2.6

7 Tu

0314 0.7 0924 2.5 1535 0.6 2151 2.6

8 We

0353 0.7 1004 2.5 1614 0.6 2232 2.6

Time m

9 Th

0434 0.7 1045 2.5 1654 0.6 2314 2.6

10 Fr

0518 0.7 1129 2.5 1738 0.7

11 Sa

0001 2.5 0606 0.8 1217 2.5 1826 0.7

12 Su

0051 2.5 0659 0.8 1309 2.4 1919 0.7

13 Mo

0147 2.5 0757 0.8 1407 2.4 2019 0.7

14 Tu

0247 2.5 0858 0.7 1509 2.4 2123 0.7

15 We

0348 2.6 1000 0.7 1614 2.5 2226 0.6

16 Th

0449 2.6 1101 0.6 1718 2.6 2327 0.6

Time m

17 Fr

0547 2.7 1159 0.5 1818 2.7

18 Sa

0025 0.5 0643 2.8 1254 0.4 1914 2.8

19 Su

0119 0.4 0736 2.9 1347 0.3 2007 2.9

20 Mo

0212 0.4 0828 2.9 1438 0.3 2058 2.9

21 Tu

0304 0.4 0919 2.8 1528 0.3 2148 2.9

22 We

0355 0.4 1009 2.8 1616 0.4 2237 2.8

23 Th

0445 0.5 1058 2.7 1704 0.5 2326 2.7

24 Fr

0536 0.6 1148 2.6 1753 0.6

Time m

25 Sa

0015 2.6 0628 0.7 1238 2.5 1843 0.7

26 Su

0106 2.5 0721 0.8 1330 2.4 1936 0.8

27 Mo

0159 2.4 0815 0.9 1424 2.3 2031 0.9

28 Tu

0253 2.4 0910 0.9 1521 2.3 2127 0.9

29 We

0347 2.3 1004 0.9 1617 2.3 2222 0.9

30 Th

0438 2.3 1054 0.9 1710 2.3 2313 0.9








Time m

1 We

0001 0.9 0622 2.4 1233 0.9 1847 2.3

2 Th

0051 0.8 0709 2.4 1320 0.8 1935 2.4

3 Fr

0136 0.8 0751 2.4 1403 0.8 2017 2.4

4 Sa

0218 0.7 0831 2.5 1443 0.7 2057 2.5

5 Su

0257 0.7 0808 2.5 1421 0.7 2035 2.5

6 Mo

0235 0.7 0846 2.5 1458 0.6 2113 2.6

7 Tu

0314 0.7 0924 2.5 1535 0.6 2151 2.6

8 We

0353 0.7 1004 2.5 1614 0.6 2232 2.6

Time m

9 Th

0434 0.7 1045 2.5 1654 0.6 2314 2.6

10 Fr

0518 0.7 1129 2.5 1738 0.7

11 Sa

0001 2.5 0606 0.8 1217 2.5 1826 0.7

12 Su

0051 2.5 0659 0.8 1309 2.4 1919 0.7

13 Mo

0147 2.5 0757 0.8 1407 2.4 2019 0.7

14 Tu

0247 2.5 0858 0.7 1509 2.4 2123 0.7

15 We

0348 2.6 1000 0.7 1614 2.5 2226 0.6

16 Th

0449 2.6 1101 0.6 1718 2.6 2327 0.6

Time m

17 Fr

0547 2.7 1159 0.5 1818 2.7

18 Sa

0025 0.5 0643 2.8 1254 0.4 1914 2.8

19 Su

0119 0.4 0736 2.9 1347 0.3 2007 2.9

20 Mo

0212 0.4 0828 2.9 1438 0.3 2058 2.9

21 Tu

0304 0.4 0919 2.8 1528 0.3 2148 2.9

22 We

0355 0.4 1009 2.8 1616 0.4 2237 2.8

23 Th

0445 0.5 1058 2.7 1704 0.5 2326 2.7

24 Fr

0536 0.6 1148 2.6 1753 0.6

Time m

25 Sa

0015 2.6 0628 0.7 1238 2.5 1843 0.7

26 Su

0106 2.5 0721 0.8 1330 2.4 1936 0.8

27 Mo

0159 2.4 0815 0.9 1424 2.3 2031 0.9

28 Tu

0253 2.4 0910 0.9 1521 2.3 2127 0.9

29 We

0347 2.3 1004 0.9 1617 2.3 2222 0.9

30 Th

0438 2.3 1054 0.9 1710 2.3 2313 0.9








Time m

1 We

0001 0.9 0622 2.4 1233 0.9 1847 2.3

2 Th

0051 0.8 0709 2.4 1320 0.8 1935 2.4

3 Fr

0136 0.8 0751 2.4 1403 0.8 2017 2.4

4 Sa

0218 0.7 0831 2.5 1443 0.7 2057 2.5

5 Su

0257 0.7 0808 2.5 1421 0.7 2035 2.5

6 Mo

0235 0.7 0846 2.5 1458 0.6 2113 2.6

7 Tu

0314 0.7 0924 2.5 1535 0.6 2151 2.6

8 We

0353 0.7 1004 2.5 1614 0.6 2232 2.6

Time m

9 Th

0434 0.7 1045 2.5 1654 0.6 2314 2.6

10 Fr

0518 0.7 1129 2.5 1738 0.7

11 Sa

0001 2.5 0606 0.8 1217 2.5 1826 0.7

12 Su

0051 2.5 0659 0.8 1309 2.4 1919 0.7

13 Mo

0147 2.5 0757 0.8 1407 2.4 2019 0.7

14 Tu

0247 2.5 0858 0.7 1509 2.4 2123 0.7

15 We

0348 2.6 1000 0.7 1614 2.5 2226 0.6

16 Th

0449 2.6 1101 0.6 1718 2.6 2327 0.6

Time m

17 Fr

0547 2.7 1159 0.5 1818 2.7

18 Sa

0025 0.5 0643 2.8 1254 0.4 1914 2.8

19 Su

0119 0.4 0736 2.9 1347 0.3 2007 2.9

20 Mo

0212 0.4 0828 2.9 1438 0.3 2058 2.9

21 Tu

0304 0.4 0919 2.8 1528 0.3 2148 2.9

22 We

0355 0.4 1009 2.8 1616 0.4 2237 2.8

23 Th

0445 0.5 1058 2.7 1704 0.5 2326 2.7

24 Fr

0536 0.6 1148 2.6 1753 0.6

Time m

25 Sa

0015 2.6 0628 0.7 1238 2.5 1843 0.7

26 Su

0106 2.5 0721 0.8 1330 2.4 1936 0.8

27 Mo

0159 2.4 0815 0.9 1424 2.3 2031 0.9

28 Tu

0253 2.4 0910 0.9 1521 2.3 2127 0.9

29 We

0347 2.3 1004 0.9 1617 2.3 2222 0.9

30 Th

0438 2.3 1054 0.9 1710 2.3 2313 0.9








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6

55




EAST COAST - MARSDEN POINTMAY 2015

Lat. 35° 50’ S Long. 174° 30’ E






MAY 2015 N.Z. LOCAL TIMES AND HEIGHTS OF HIGH AND LOW WATERS



Time m

1 Fr

0526 2.4 1142 0.8 1759 2.4

2 Sa

0000 0.9 0610 2.4 1225 0.8 1844 2.4

3 Su

0043 0.8 0652 2.4 1307 0.7 1925 2.5

4 Mo

0125 0.8 0733 2.5 1347 0.6 2005 2.6

5 Tu

0206 0.7 0814 2.5 1427 0.6 2046 2.6

6 We

0247 0.7 0856 2.5 1507 0.6 2127 2.6

7 Th

0330 0.7 0939 2.6 1548 0.6 2210 2.6

8 Fr

0414 0.7 1024 2.5 1632 0.6 2255 2.6

Time m

9 Sa

0501 0.7 1111 2.5 1718 0.6 2343 2.6

10 Su

0551 0.7 1201 2.5 1807 0.6

11 Mo

0034 2.6 0645 0.7 1254 2.5 1902 0.7

12 Tu

0129 2.6 0741 0.7 1352 2.5 2001 0.7

13 We

0226 2.6 0840 0.7 1453 2.5 2103 0.7

14 Th

0326 2.6 0940 0.6 1557 2.5 2206 0.7

15 Fr

0425 2.7 1040 0.5 1700 2.6 2306 0.6

16 Sa

0523 2.7 1137 0.5 1759 2.7

Time m

17 Su

0004 0.6 0620 2.7 1232 0.4 1855 2.8

18 Mo

0059 0.5 0714 2.8 1325 0.3 1947 2.8

19 Tu

0152 0.5 0806 2.8 1415 0.3 2038 2.9

20 We

0244 0.5 0857 2.7 1504 0.4 2126 2.8

21 Th

0334 0.5 0946 2.7 1551 0.4 2213 2.8

22 Fr

0423 0.6 1033 2.6 1637 0.5 2300 2.7

23 Sa

0511 0.7 1120 2.5 1723 0.6 2346 2.6

24 Su

0600 0.7 1207 2.4 1810 0.7

Time m

25 Mo

0032 2.5 0649 0.8 1255 2.3 1859 0.8

26 Tu

0120 2.4 0738 0.8 1346 2.3 1950 0.9

27 We

0209 2.4 0829 0.9 1439 2.3 2043 0.9

28 Th

0259 2.3 0920 0.9 1534 2.3 2137 0.9

29 Fr

0349 2.3 1010 0.9 1628 2.3 2230 0.9

30 Sa

0438 2.3 1059 0.8 1719 2.3 2319 0.9

31 Su

0526 2.4 1145 0.8 1807 2.4








Time m

1 Fr

0526 2.4 1142 0.8 1759 2.4

2 Sa

0000 0.9 0610 2.4 1225 0.8 1844 2.4

3 Su

0043 0.8 0652 2.4 1307 0.7 1925 2.5

4 Mo

0125 0.8 0733 2.5 1347 0.6 2005 2.6

5 Tu

0206 0.7 0814 2.5 1427 0.6 2046 2.6

6 We

0247 0.7 0856 2.5 1507 0.6 2127 2.6

7 Th

0330 0.7 0939 2.6 1548 0.6 2210 2.6

8 Fr

0414 0.7 1024 2.5 1632 0.6 2255 2.6

Time m

9 Sa

0501 0.7 1111 2.5 1718 0.6 2343 2.6

10 Su

0551 0.7 1201 2.5 1807 0.6

11 Mo

0034 2.6 0645 0.7 1254 2.5 1902 0.7

12 Tu

0129 2.6 0741 0.7 1352 2.5 2001 0.7

13 We

0226 2.6 0840 0.7 1453 2.5 2103 0.7

14 Th

0326 2.6 0940 0.6 1557 2.5 2206 0.7

15 Fr

0425 2.7 1040 0.5 1700 2.6 2306 0.6

16 Sa

0523 2.7 1137 0.5 1759 2.7

Time m

17 Su

0004 0.6 0620 2.7 1232 0.4 1855 2.8

18 Mo

0059 0.5 0714 2.8 1325 0.3 1947 2.8

19 Tu

0152 0.5 0806 2.8 1415 0.3 2038 2.9

20 We

0244 0.5 0857 2.7 1504 0.4 2126 2.8

21 Th

0334 0.5 0946 2.7 1551 0.4 2213 2.8

22 Fr

0423 0.6 1033 2.6 1637 0.5 2300 2.7

23 Sa

0511 0.7 1120 2.5 1723 0.6 2346 2.6

24 Su

0600 0.7 1207 2.4 1810 0.7

Time m

25 Mo

0032 2.5 0649 0.8 1255 2.3 1859 0.8

26 Tu

0120 2.4 0738 0.8 1346 2.3 1950 0.9

27 We

0209 2.4 0829 0.9 1439 2.3 2043 0.9

28 Th

0259 2.3 0920 0.9 1534 2.3 2137 0.9

29 Fr

0349 2.3 1010 0.9 1628 2.3 2230 0.9

30 Sa

0438 2.3 1059 0.8 1719 2.3 2319 0.9

31 Su

0526 2.4 1145 0.8 1807 2.4








Time m

1 Fr

0526 2.4 1142 0.8 1759 2.4

2 Sa

0000 0.9 0610 2.4 1225 0.8 1844 2.4

3 Su

0043 0.8 0652 2.4 1307 0.7 1925 2.5

4 Mo

0125 0.8 0733 2.5 1347 0.6 2005 2.6

5 Tu

0206 0.7 0814 2.5 1427 0.6 2046 2.6

6 We

0247 0.7 0856 2.5 1507 0.6 2127 2.6

7 Th

0330 0.7 0939 2.6 1548 0.6 2210 2.6

8 Fr

0414 0.7 1024 2.5 1632 0.6 2255 2.6

Time m

9 Sa

0501 0.7 1111 2.5 1718 0.6 2343 2.6

10 Su

0551 0.7 1201 2.5 1807 0.6

11 Mo

0034 2.6 0645 0.7 1254 2.5 1902 0.7

12 Tu

0129 2.6 0741 0.7 1352 2.5 2001 0.7

13 We

0226 2.6 0840 0.7 1453 2.5 2103 0.7

14 Th

0326 2.6 0940 0.6 1557 2.5 2206 0.7

15 Fr

0425 2.7 1040 0.5 1700 2.6 2306 0.6

16 Sa

0523 2.7 1137 0.5 1759 2.7

Time m

17 Su

0004 0.6 0620 2.7 1232 0.4 1855 2.8

18 Mo

0059 0.5 0714 2.8 1325 0.3 1947 2.8

19 Tu

0152 0.5 0806 2.8 1415 0.3 2038 2.9

20 We

0244 0.5 0857 2.7 1504 0.4 2126 2.8

21 Th

0334 0.5 0946 2.7 1551 0.4 2213 2.8

22 Fr

0423 0.6 1033 2.6 1637 0.5 2300 2.7

23 Sa

0511 0.7 1120 2.5 1723 0.6 2346 2.6

24 Su

0600 0.7 1207 2.4 1810 0.7

Time m

25 Mo

0032 2.5 0649 0.8 1255 2.3 1859 0.8

26 Tu

0120 2.4 0738 0.8 1346 2.3 1950 0.9

27 We

0209 2.4 0829 0.9 1439 2.3 2043 0.9

28 Th

0259 2.3 0920 0.9 1534 2.3 2137 0.9

29 Fr

0349 2.3 1010 0.9 1628 2.3 2230 0.9

30 Sa

0438 2.3 1059 0.8 1719 2.3 2319 0.9

31 Su

0526 2.4 1145 0.8 1807 2.4








Time m

1 Fr

0526 2.4 1142 0.8 1759 2.4

2 Sa

0000 0.9 0610 2.4 1225 0.8 1844 2.4

3 Su

0043 0.8 0652 2.4 1307 0.7 1925 2.5

4 Mo

0125 0.8 0733 2.5 1347 0.6 2005 2.6

5 Tu

0206 0.7 0814 2.5 1427 0.6 2046 2.6

6 We

0247 0.7 0856 2.5 1507 0.6 2127 2.6

7 Th

0330 0.7 0939 2.6 1548 0.6 2210 2.6

8 Fr

0414 0.7 1024 2.5 1632 0.6 2255 2.6

Time m

9 Sa

0501 0.7 1111 2.5 1718 0.6 2343 2.6

10 Su

0551 0.7 1201 2.5 1807 0.6

11 Mo

0034 2.6 0645 0.7 1254 2.5 1902 0.7

12 Tu

0129 2.6 0741 0.7 1352 2.5 2001 0.7

13 We

0226 2.6 0840 0.7 1453 2.5 2103 0.7

14 Th

0326 2.6 0940 0.6 1557 2.5 2206 0.7

15 Fr

0425 2.7 1040 0.5 1700 2.6 2306 0.6

16 Sa

0523 2.7 1137 0.5 1759 2.7

Time m

17 Su

0004 0.6 0620 2.7 1232 0.4 1855 2.8

18 Mo

0059 0.5 0714 2.8 1325 0.3 1947 2.8

19 Tu

0152 0.5 0806 2.8 1415 0.3 2038 2.9

20 We

0244 0.5 0857 2.7 1504 0.4 2126 2.8

21 Th

0334 0.5 0946 2.7 1551 0.4 2213 2.8

22 Fr

0423 0.6 1033 2.6 1637 0.5 2300 2.7

23 Sa

0511 0.7 1120 2.5 1723 0.6 2346 2.6

24 Su

0600 0.7 1207 2.4 1810 0.7

Time m

25 Mo

0032 2.5 0649 0.8 1255 2.3 1859 0.8

26 Tu

0120 2.4 0738 0.8 1346 2.3 1950 0.9

27 We

0209 2.4 0829 0.9 1439 2.3 2043 0.9

28 Th

0259 2.3 0920 0.9 1534 2.3 2137 0.9

29 Fr

0349 2.3 1010 0.9 1628 2.3 2230 0.9

30 Sa

0438 2.3 1059 0.8 1719 2.3 2319 0.9

31 Su

0526 2.4 1145 0.8 1807 2.4








Time m

1 Fr

0526 2.4 1142 0.8 1759 2.4

2 Sa

0000 0.9 0610 2.4 1225 0.8 1844 2.4

3 Su

0043 0.8 0652 2.4 1307 0.7 1925 2.5

4 Mo

0125 0.8 0733 2.5 1347 0.6 2005 2.6

5 Tu

0206 0.7 0814 2.5 1427 0.6 2046 2.6

6 We

0247 0.7 0856 2.5 1507 0.6 2127 2.6

7 Th

0330 0.7 0939 2.6 1548 0.6 2210 2.6

8 Fr

0414 0.7 1024 2.5 1632 0.6 2255 2.6

Time m

9 Sa

0501 0.7 1111 2.5 1718 0.6 2343 2.6

10 Su

0551 0.7 1201 2.5 1807 0.6

11 Mo

0034 2.6 0645 0.7 1254 2.5 1902 0.7

12 Tu

0129 2.6 0741 0.7 1352 2.5 2001 0.7

13 We

0226 2.6 0840 0.7 1453 2.5 2103 0.7

14 Th

0326 2.6 0940 0.6 1557 2.5 2206 0.7

15 Fr

0425 2.7 1040 0.5 1700 2.6 2306 0.6

16 Sa

0523 2.7 1137 0.5 1759 2.7

Time m

17 Su

0004 0.6 0620 2.7 1232 0.4 1855 2.8

18 Mo

0059 0.5 0714 2.8 1325 0.3 1947 2.8

19 Tu

0152 0.5 0806 2.8 1415 0.3 2038 2.9

20 We

0244 0.5 0857 2.7 1504 0.4 2126 2.8

21 Th

0334 0.5 0946 2.7 1551 0.4 2213 2.8

22 Fr

0423 0.6 1033 2.6 1637 0.5 2300 2.7

23 Sa

0511 0.7 1120 2.5 1723 0.6 2346 2.6

24 Su

0600 0.7 1207 2.4 1810 0.7

Time m

25 Mo

0032 2.5 0649 0.8 1255 2.3 1859 0.8

26 Tu

0120 2.4 0738 0.8 1346 2.3 1950 0.9

27 We

0209 2.4 0829 0.9 1439 2.3 2043 0.9

28 Th

0259 2.3 0920 0.9 1534 2.3 2137 0.9

29 Fr

0349 2.3 1010 0.9 1628 2.3 2230 0.9

30 Sa

0438 2.3 1059 0.8 1719 2.3 2319 0.9

31 Su

0526 2.4 1145 0.8 1807 2.4








Time m

1 Fr

0526 2.4 1142 0.8 1759 2.4

2 Sa

0000 0.9 0610 2.4 1225 0.8 1844 2.4

3 Su

0043 0.8 0652 2.4 1307 0.7 1925 2.5

4 Mo

0125 0.8 0733 2.5 1347 0.6 2005 2.6

5 Tu

0206 0.7 0814 2.5 1427 0.6 2046 2.6

6 We

0247 0.7 0856 2.5 1507 0.6 2127 2.6

7 Th

0330 0.7 0939 2.6 1548 0.6 2210 2.6

8 Fr

0414 0.7 1024 2.5 1632 0.6 2255 2.6

Time m

9 Sa

0501 0.7 1111 2.5 1718 0.6 2343 2.6

10 Su

0551 0.7 1201 2.5 1807 0.6

11 Mo

0034 2.6 0645 0.7 1254 2.5 1902 0.7

12 Tu

0129 2.6 0741 0.7 1352 2.5 2001 0.7

13 We

0226 2.6 0840 0.7 1453 2.5 2103 0.7

14 Th

0326 2.6 0940 0.6 1557 2.5 2206 0.7

15 Fr

0425 2.7 1040 0.5 1700 2.6 2306 0.6

16 Sa

0523 2.7 1137 0.5 1759 2.7

Time m

17 Su

0004 0.6 0620 2.7 1232 0.4 1855 2.8

18 Mo

0059 0.5 0714 2.8 1325 0.3 1947 2.8

19 Tu

0152 0.5 0806 2.8 1415 0.3 2038 2.9

20 We

0244 0.5 0857 2.7 1504 0.4 2126 2.8

21 Th

0334 0.5 0946 2.7 1551 0.4 2213 2.8

22 Fr

0423 0.6 1033 2.6 1637 0.5 2300 2.7

23 Sa

0511 0.7 1120 2.5 1723 0.6 2346 2.6

24 Su

0600 0.7 1207 2.4 1810 0.7

Time m

25 Mo

0032 2.5 0649 0.8 1255 2.3 1859 0.8

26 Tu

0120 2.4 0738 0.8 1346 2.3 1950 0.9

27 We

0209 2.4 0829 0.9 1439 2.3 2043 0.9

28 Th

0259 2.3 0920 0.9 1534 2.3 2137 0.9

29 Fr

0349 2.3 1010 0.9 1628 2.3 2230 0.9

30 Sa

0438 2.3 1059 0.8 1719 2.3 2319 0.9

31 Su

0526 2.4 1145 0.8 1807 2.4








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6

56 57




EAST COAST - MARSDEN POINTJUNE 2015

Lat. 35° 50’ S Long. 174° 30’ E






JUNE 2015 N.Z. LOCAL TIMES AND HEIGHTS OF HIGH AND LOW WATERS



Time m

1 Mo

0006 0.9 0612 2.4 1230 0.7 1852 2.5

2 Tu

0052 0.8 0658 2.5 1314 0.6 1936 2.6

3 We

0137 0.7 0744 2.5 1357 0.6 2019 2.6

4 Th

0222 0.7 0830 2.6 1441 0.5 2104 2.7

5 Fr

0308 0.6 0917 2.6 1526 0.5 2149 2.7

6 Sa

0356 0.6 1005 2.6 1612 0.5 2237 2.7

7 Su

0445 0.6 1054 2.6 1700 0.5 2326 2.7

8 Mo

0536 0.6 1146 2.6 1751 0.5

Time m

9 Tu

0017 2.7 0630 0.6 1240 2.5 1846 0.6

10 We

0111 2.7 0725 0.6 1337 2.5 1944 0.6

11 Th

0207 2.6 0822 0.6 1437 2.5 2045 0.7

12 Fr

0305 2.6 0921 0.6 1540 2.5 2147 0.7

13 Sa

0404 2.6 1019 0.5 1642 2.6 2248 0.7

14 Su

0502 2.6 1116 0.5 1741 2.6 2346 0.6

15 Mo

0559 2.6 1211 0.4 1836 2.7

16 Tu

0041 0.6 0654 2.6 1304 0.4 1928 2.7

Time m

17 We

0134 0.6 0746 2.6 1354 0.4 2017 2.8

18 Th

0224 0.6 0836 2.6 1441 0.4 2104 2.7

19 Fr

0312 0.6 0923 2.6 1526 0.5 2149 2.7

20 Sa

0359 0.6 1008 2.5 1610 0.6 2232 2.6

21 Su

0444 0.7 1052 2.5 1653 0.6 2314 2.6

22 Mo

0528 0.7 1135 2.4 1736 0.7 2356 2.5

23 Tu

0613 0.8 1219 2.3 1820 0.8

24 We

0039 2.5 0658 0.8 1305 2.3 1907 0.9

Time m

25 Th

0124 2.4 0745 0.8 1354 2.3 1958 0.9

26 Fr

0211 2.4 0833 0.8 1447 2.2 2051 1.0

27 Sa

0300 2.3 0923 0.8 1542 2.3 2145 1.0

28 Su

0351 2.3 1014 0.8 1636 2.3 2238 0.9

29 Mo

0442 2.3 1104 0.8 1729 2.4 2330 0.9

30 Tu

0534 2.4 1154 0.7 1818 2.5








Time m

1 Mo

0006 0.9 0612 2.4 1230 0.7 1852 2.5

2 Tu

0052 0.8 0658 2.5 1314 0.6 1936 2.6

3 We

0137 0.7 0744 2.5 1357 0.6 2019 2.6

4 Th

0222 0.7 0830 2.6 1441 0.5 2104 2.7

5 Fr

0308 0.6 0917 2.6 1526 0.5 2149 2.7

6 Sa

0356 0.6 1005 2.6 1612 0.5 2237 2.7

7 Su

0445 0.6 1054 2.6 1700 0.5 2326 2.7

8 Mo

0536 0.6 1146 2.6 1751 0.5

Time m

9 Tu

0017 2.7 0630 0.6 1240 2.5 1846 0.6

10 We

0111 2.7 0725 0.6 1337 2.5 1944 0.6

11 Th

0207 2.6 0822 0.6 1437 2.5 2045 0.7

12 Fr

0305 2.6 0921 0.6 1540 2.5 2147 0.7

13 Sa

0404 2.6 1019 0.5 1642 2.6 2248 0.7

14 Su

0502 2.6 1116 0.5 1741 2.6 2346 0.6

15 Mo

0559 2.6 1211 0.4 1836 2.7

16 Tu

0041 0.6 0654 2.6 1304 0.4 1928 2.7

Time m

17 We

0134 0.6 0746 2.6 1354 0.4 2017 2.8

18 Th

0224 0.6 0836 2.6 1441 0.4 2104 2.7

19 Fr

0312 0.6 0923 2.6 1526 0.5 2149 2.7

20 Sa

0359 0.6 1008 2.5 1610 0.6 2232 2.6

21 Su

0444 0.7 1052 2.5 1653 0.6 2314 2.6

22 Mo

0528 0.7 1135 2.4 1736 0.7 2356 2.5

23 Tu

0613 0.8 1219 2.3 1820 0.8

24 We

0039 2.5 0658 0.8 1305 2.3 1907 0.9

Time m

25 Th

0124 2.4 0745 0.8 1354 2.3 1958 0.9

26 Fr

0211 2.4 0833 0.8 1447 2.2 2051 1.0

27 Sa

0300 2.3 0923 0.8 1542 2.3 2145 1.0

28 Su

0351 2.3 1014 0.8 1636 2.3 2238 0.9

29 Mo

0442 2.3 1104 0.8 1729 2.4 2330 0.9

30 Tu

0534 2.4 1154 0.7 1818 2.5








Time m

1 Mo

0006 0.9 0612 2.4 1230 0.7 1852 2.5

2 Tu

0052 0.8 0658 2.5 1314 0.6 1936 2.6

3 We

0137 0.7 0744 2.5 1357 0.6 2019 2.6

4 Th

0222 0.7 0830 2.6 1441 0.5 2104 2.7

5 Fr

0308 0.6 0917 2.6 1526 0.5 2149 2.7

6 Sa

0356 0.6 1005 2.6 1612 0.5 2237 2.7

7 Su

0445 0.6 1054 2.6 1700 0.5 2326 2.7

8 Mo

0536 0.6 1146 2.6 1751 0.5

Time m

9 Tu

0017 2.7 0630 0.6 1240 2.5 1846 0.6

10 We

0111 2.7 0725 0.6 1337 2.5 1944 0.6

11 Th

0207 2.6 0822 0.6 1437 2.5 2045 0.7

12 Fr

0305 2.6 0921 0.6 1540 2.5 2147 0.7

13 Sa

0404 2.6 1019 0.5 1642 2.6 2248 0.7

14 Su

0502 2.6 1116 0.5 1741 2.6 2346 0.6

15 Mo

0559 2.6 1211 0.4 1836 2.7

16 Tu

0041 0.6 0654 2.6 1304 0.4 1928 2.7

Time m

17 We

0134 0.6 0746 2.6 1354 0.4 2017 2.8

18 Th

0224 0.6 0836 2.6 1441 0.4 2104 2.7

19 Fr

0312 0.6 0923 2.6 1526 0.5 2149 2.7

20 Sa

0359 0.6 1008 2.5 1610 0.6 2232 2.6

21 Su

0444 0.7 1052 2.5 1653 0.6 2314 2.6

22 Mo

0528 0.7 1135 2.4 1736 0.7 2356 2.5

23 Tu

0613 0.8 1219 2.3 1820 0.8

24 We

0039 2.5 0658 0.8 1305 2.3 1907 0.9

Time m

25 Th

0124 2.4 0745 0.8 1354 2.3 1958 0.9

26 Fr

0211 2.4 0833 0.8 1447 2.2 2051 1.0

27 Sa

0300 2.3 0923 0.8 1542 2.3 2145 1.0

28 Su

0351 2.3 1014 0.8 1636 2.3 2238 0.9

29 Mo

0442 2.3 1104 0.8 1729 2.4 2330 0.9

30 Tu

0534 2.4 1154 0.7 1818 2.5








Time m

1 Mo

0006 0.9 0612 2.4 1230 0.7 1852 2.5

2 Tu

0052 0.8 0658 2.5 1314 0.6 1936 2.6

3 We

0137 0.7 0744 2.5 1357 0.6 2019 2.6

4 Th

0222 0.7 0830 2.6 1441 0.5 2104 2.7

5 Fr

0308 0.6 0917 2.6 1526 0.5 2149 2.7

6 Sa

0356 0.6 1005 2.6 1612 0.5 2237 2.7

7 Su

0445 0.6 1054 2.6 1700 0.5 2326 2.7

8 Mo

0536 0.6 1146 2.6 1751 0.5

Time m

9 Tu

0017 2.7 0630 0.6 1240 2.5 1846 0.6

10 We

0111 2.7 0725 0.6 1337 2.5 1944 0.6

11 Th

0207 2.6 0822 0.6 1437 2.5 2045 0.7

12 Fr

0305 2.6 0921 0.6 1540 2.5 2147 0.7

13 Sa

0404 2.6 1019 0.5 1642 2.6 2248 0.7

14 Su

0502 2.6 1116 0.5 1741 2.6 2346 0.6

15 Mo

0559 2.6 1211 0.4 1836 2.7

16 Tu

0041 0.6 0654 2.6 1304 0.4 1928 2.7

Time m

17 We

0134 0.6 0746 2.6 1354 0.4 2017 2.8

18 Th

0224 0.6 0836 2.6 1441 0.4 2104 2.7

19 Fr

0312 0.6 0923 2.6 1526 0.5 2149 2.7

20 Sa

0359 0.6 1008 2.5 1610 0.6 2232 2.6

21 Su

0444 0.7 1052 2.5 1653 0.6 2314 2.6

22 Mo

0528 0.7 1135 2.4 1736 0.7 2356 2.5

23 Tu

0613 0.8 1219 2.3 1820 0.8

24 We

0039 2.5 0658 0.8 1305 2.3 1907 0.9

Time m

25 Th

0124 2.4 0745 0.8 1354 2.3 1958 0.9

26 Fr

0211 2.4 0833 0.8 1447 2.2 2051 1.0

27 Sa

0300 2.3 0923 0.8 1542 2.3 2145 1.0

28 Su

0351 2.3 1014 0.8 1636 2.3 2238 0.9

29 Mo

0442 2.3 1104 0.8 1729 2.4 2330 0.9

30 Tu

0534 2.4 1154 0.7 1818 2.5








Time m

1 Mo

0006 0.9 0612 2.4 1230 0.7 1852 2.5

2 Tu

0052 0.8 0658 2.5 1314 0.6 1936 2.6

3 We

0137 0.7 0744 2.5 1357 0.6 2019 2.6

4 Th

0222 0.7 0830 2.6 1441 0.5 2104 2.7

5 Fr

0308 0.6 0917 2.6 1526 0.5 2149 2.7

6 Sa

0356 0.6 1005 2.6 1612 0.5 2237 2.7

7 Su

0445 0.6 1054 2.6 1700 0.5 2326 2.7

8 Mo

0536 0.6 1146 2.6 1751 0.5

Time m

9 Tu

0017 2.7 0630 0.6 1240 2.5 1846 0.6

10 We

0111 2.7 0725 0.6 1337 2.5 1944 0.6

11 Th

0207 2.6 0822 0.6 1437 2.5 2045 0.7

12 Fr

0305 2.6 0921 0.6 1540 2.5 2147 0.7

13 Sa

0404 2.6 1019 0.5 1642 2.6 2248 0.7

14 Su

0502 2.6 1116 0.5 1741 2.6 2346 0.6

15 Mo

0559 2.6 1211 0.4 1836 2.7

16 Tu

0041 0.6 0654 2.6 1304 0.4 1928 2.7

Time m

17 We

0134 0.6 0746 2.6 1354 0.4 2017 2.8

18 Th

0224 0.6 0836 2.6 1441 0.4 2104 2.7

19 Fr

0312 0.6 0923 2.6 1526 0.5 2149 2.7

20 Sa

0359 0.6 1008 2.5 1610 0.6 2232 2.6

21 Su

0444 0.7 1052 2.5 1653 0.6 2314 2.6

22 Mo

0528 0.7 1135 2.4 1736 0.7 2356 2.5

23 Tu

0613 0.8 1219 2.3 1820 0.8

24 We

0039 2.5 0658 0.8 1305 2.3 1907 0.9

Time m

25 Th

0124 2.4 0745 0.8 1354 2.3 1958 0.9

26 Fr

0211 2.4 0833 0.8 1447 2.2 2051 1.0

27 Sa

0300 2.3 0923 0.8 1542 2.3 2145 1.0

28 Su

0351 2.3 1014 0.8 1636 2.3 2238 0.9

29 Mo

0442 2.3 1104 0.8 1729 2.4 2330 0.9

30 Tu

0534 2.4 1154 0.7 1818 2.5








Time m

1 Mo

0006 0.9 0612 2.4 1230 0.7 1852 2.5

2 Tu

0052 0.8 0658 2.5 1314 0.6 1936 2.6

3 We

0137 0.7 0744 2.5 1357 0.6 2019 2.6

4 Th

0222 0.7 0830 2.6 1441 0.5 2104 2.7

5 Fr

0308 0.6 0917 2.6 1526 0.5 2149 2.7

6 Sa

0356 0.6 1005 2.6 1612 0.5 2237 2.7

7 Su

0445 0.6 1054 2.6 1700 0.5 2326 2.7

8 Mo

0536 0.6 1146 2.6 1751 0.5

Time m

9 Tu

0017 2.7 0630 0.6 1240 2.5 1846 0.6

10 We

0111 2.7 0725 0.6 1337 2.5 1944 0.6

11 Th

0207 2.6 0822 0.6 1437 2.5 2045 0.7

12 Fr

0305 2.6 0921 0.6 1540 2.5 2147 0.7

13 Sa

0404 2.6 1019 0.5 1642 2.6 2248 0.7

14 Su

0502 2.6 1116 0.5 1741 2.6 2346 0.6

15 Mo

0559 2.6 1211 0.4 1836 2.7

16 Tu

0041 0.6 0654 2.6 1304 0.4 1928 2.7

Time m

17 We

0134 0.6 0746 2.6 1354 0.4 2017 2.8

18 Th

0224 0.6 0836 2.6 1441 0.4 2104 2.7

19 Fr

0312 0.6 0923 2.6 1526 0.5 2149 2.7

20 Sa

0359 0.6 1008 2.5 1610 0.6 2232 2.6

21 Su

0444 0.7 1052 2.5 1653 0.6 2314 2.6

22 Mo

0528 0.7 1135 2.4 1736 0.7 2356 2.5

23 Tu

0613 0.8 1219 2.3 1820 0.8

24 We

0039 2.5 0658 0.8 1305 2.3 1907 0.9

Time m

25 Th

0124 2.4 0745 0.8 1354 2.3 1958 0.9

26 Fr

0211 2.4 0833 0.8 1447 2.2 2051 1.0

27 Sa

0300 2.3 0923 0.8 1542 2.3 2145 1.0

28 Su

0351 2.3 1014 0.8 1636 2.3 2238 0.9

29 Mo

0442 2.3 1104 0.8 1729 2.4 2330 0.9

30 Tu

0534 2.4 1154 0.7 1818 2.5








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6

57




EAST COAST - MARSDEN POINTJULY 2015

Lat. 35° 50’ S Long. 174° 30’ E






JULY 2015 N.Z. LOCAL TIMES AND HEIGHTS OF HIGH AND LOW WATERS



Time m

1 We

0020 0.8 0626 2.5 1242 0.6 1906 2.6

2 Th

0109 0.7 0717 2.5 1330 0.5 1954 2.7

3 Fr

0158 0.6 0807 2.6 1417 0.4 2041 2.8

4 Sa

0247 0.5 0857 2.7 1505 0.4 2129 2.8

5 Su

0337 0.5 0947 2.7 1554 0.4 2218 2.8

6 Mo

0428 0.5 1038 2.7 1643 0.4 2308 2.8

7 Tu

0519 0.4 1130 2.7 1735 0.5 2359 2.8

8 We

0612 0.5 1224 2.6 1829 0.5

Time m

9 Th

0052 2.7 0706 0.5 1320 2.6 1927 0.6

10 Fr

0147 2.7 0802 0.5 1420 2.5 2027 0.7

11 Sa

0244 2.6 0900 0.5 1522 2.5 2129 0.7

12 Su

0343 2.5 0959 0.6 1624 2.5 2230 0.7

13 Mo

0443 2.5 1057 0.5 1723 2.6 2329 0.7

14 Tu

0541 2.5 1152 0.5 1818 2.6

15 We

0024 0.7 0636 2.5 1244 0.5 1909 2.6

16 Th

0115 0.7 0727 2.5 1333 0.5 1957 2.7

Time m

17 Fr

0204 0.6 0815 2.5 1419 0.5 2041 2.7

18 Sa

0250 0.6 0900 2.5 1502 0.5 2123 2.6

19 Su

0333 0.6 0942 2.5 1543 0.6 2203 2.6

20 Mo

0415 0.7 1022 2.5 1623 0.6 2242 2.6

21 Tu

0455 0.7 1102 2.4 1702 0.7 2320 2.5

22 We

0536 0.7 1143 2.4 1743 0.8

23 Th

0000 2.5 0617 0.8 1226 2.3 1827 0.8

24 Fr

0042 2.4 0700 0.8 1312 2.3 1915 0.9

Time m

25 Sa

0127 2.4 0746 0.8 1403 2.3 2006 0.9

26 Su

0215 2.3 0836 0.8 1458 2.3 2102 0.9

27 Mo

0308 2.3 0930 0.8 1555 2.3 2158 0.9

28 Tu

0404 2.3 1025 0.7 1651 2.4 2255 0.9

29 We

0501 2.4 1120 0.7 1746 2.5 2350 0.8

30 Th

0557 2.5 1213 0.6 1838 2.6

31 Fr

0043 0.6 0652 2.6 1305 0.4 1928 2.7








Time m

1 We

0020 0.8 0626 2.5 1242 0.6 1906 2.6

2 Th

0109 0.7 0717 2.5 1330 0.5 1954 2.7

3 Fr

0158 0.6 0807 2.6 1417 0.4 2041 2.8

4 Sa

0247 0.5 0857 2.7 1505 0.4 2129 2.8

5 Su

0337 0.5 0947 2.7 1554 0.4 2218 2.8

6 Mo

0428 0.5 1038 2.7 1643 0.4 2308 2.8

7 Tu

0519 0.4 1130 2.7 1735 0.5 2359 2.8

8 We

0612 0.5 1224 2.6 1829 0.5

Time m

9 Th

0052 2.7 0706 0.5 1320 2.6 1927 0.6

10 Fr

0147 2.7 0802 0.5 1420 2.5 2027 0.7

11 Sa

0244 2.6 0900 0.5 1522 2.5 2129 0.7

12 Su

0343 2.5 0959 0.6 1624 2.5 2230 0.7

13 Mo

0443 2.5 1057 0.5 1723 2.6 2329 0.7

14 Tu

0541 2.5 1152 0.5 1818 2.6

15 We

0024 0.7 0636 2.5 1244 0.5 1909 2.6

16 Th

0115 0.7 0727 2.5 1333 0.5 1957 2.7

Time m

17 Fr

0204 0.6 0815 2.5 1419 0.5 2041 2.7

18 Sa

0250 0.6 0900 2.5 1502 0.5 2123 2.6

19 Su

0333 0.6 0942 2.5 1543 0.6 2203 2.6

20 Mo

0415 0.7 1022 2.5 1623 0.6 2242 2.6

21 Tu

0455 0.7 1102 2.4 1702 0.7 2320 2.5

22 We

0536 0.7 1143 2.4 1743 0.8

23 Th

0000 2.5 0617 0.8 1226 2.3 1827 0.8

24 Fr

0042 2.4 0700 0.8 1312 2.3 1915 0.9

Time m

25 Sa

0127 2.4 0746 0.8 1403 2.3 2006 0.9

26 Su

0215 2.3 0836 0.8 1458 2.3 2102 0.9

27 Mo

0308 2.3 0930 0.8 1555 2.3 2158 0.9

28 Tu

0404 2.3 1025 0.7 1651 2.4 2255 0.9

29 We

0501 2.4 1120 0.7 1746 2.5 2350 0.8

30 Th

0557 2.5 1213 0.6 1838 2.6

31 Fr

0043 0.6 0652 2.6 1305 0.4 1928 2.7








Time m

1 We

0020 0.8 0626 2.5 1242 0.6 1906 2.6

2 Th

0109 0.7 0717 2.5 1330 0.5 1954 2.7

3 Fr

0158 0.6 0807 2.6 1417 0.4 2041 2.8

4 Sa

0247 0.5 0857 2.7 1505 0.4 2129 2.8

5 Su

0337 0.5 0947 2.7 1554 0.4 2218 2.8

6 Mo

0428 0.5 1038 2.7 1643 0.4 2308 2.8

7 Tu

0519 0.4 1130 2.7 1735 0.5 2359 2.8

8 We

0612 0.5 1224 2.6 1829 0.5

Time m

9 Th

0052 2.7 0706 0.5 1320 2.6 1927 0.6

10 Fr

0147 2.7 0802 0.5 1420 2.5 2027 0.7

11 Sa

0244 2.6 0900 0.5 1522 2.5 2129 0.7

12 Su

0343 2.5 0959 0.6 1624 2.5 2230 0.7

13 Mo

0443 2.5 1057 0.5 1723 2.6 2329 0.7

14 Tu

0541 2.5 1152 0.5 1818 2.6

15 We

0024 0.7 0636 2.5 1244 0.5 1909 2.6

16 Th

0115 0.7 0727 2.5 1333 0.5 1957 2.7

Time m

17 Fr

0204 0.6 0815 2.5 1419 0.5 2041 2.7

18 Sa

0250 0.6 0900 2.5 1502 0.5 2123 2.6

19 Su

0333 0.6 0942 2.5 1543 0.6 2203 2.6

20 Mo

0415 0.7 1022 2.5 1623 0.6 2242 2.6

21 Tu

0455 0.7 1102 2.4 1702 0.7 2320 2.5

22 We

0536 0.7 1143 2.4 1743 0.8

23 Th

0000 2.5 0617 0.8 1226 2.3 1827 0.8

24 Fr

0042 2.4 0700 0.8 1312 2.3 1915 0.9

Time m

25 Sa

0127 2.4 0746 0.8 1403 2.3 2006 0.9

26 Su

0215 2.3 0836 0.8 1458 2.3 2102 0.9

27 Mo

0308 2.3 0930 0.8 1555 2.3 2158 0.9

28 Tu

0404 2.3 1025 0.7 1651 2.4 2255 0.9

29 We

0501 2.4 1120 0.7 1746 2.5 2350 0.8

30 Th

0557 2.5 1213 0.6 1838 2.6

31 Fr

0043 0.6 0652 2.6 1305 0.4 1928 2.7








Time m

1 We

0020 0.8 0626 2.5 1242 0.6 1906 2.6

2 Th

0109 0.7 0717 2.5 1330 0.5 1954 2.7

3 Fr

0158 0.6 0807 2.6 1417 0.4 2041 2.8

4 Sa

0247 0.5 0857 2.7 1505 0.4 2129 2.8

5 Su

0337 0.5 0947 2.7 1554 0.4 2218 2.8

6 Mo

0428 0.5 1038 2.7 1643 0.4 2308 2.8

7 Tu

0519 0.4 1130 2.7 1735 0.5 2359 2.8

8 We

0612 0.5 1224 2.6 1829 0.5

Time m

9 Th

0052 2.7 0706 0.5 1320 2.6 1927 0.6

10 Fr

0147 2.7 0802 0.5 1420 2.5 2027 0.7

11 Sa

0244 2.6 0900 0.5 1522 2.5 2129 0.7

12 Su

0343 2.5 0959 0.6 1624 2.5 2230 0.7

13 Mo

0443 2.5 1057 0.5 1723 2.6 2329 0.7

14 Tu

0541 2.5 1152 0.5 1818 2.6

15 We

0024 0.7 0636 2.5 1244 0.5 1909 2.6

16 Th

0115 0.7 0727 2.5 1333 0.5 1957 2.7

Time m

17 Fr

0204 0.6 0815 2.5 1419 0.5 2041 2.7

18 Sa

0250 0.6 0900 2.5 1502 0.5 2123 2.6

19 Su

0333 0.6 0942 2.5 1543 0.6 2203 2.6

20 Mo

0415 0.7 1022 2.5 1623 0.6 2242 2.6

21 Tu

0455 0.7 1102 2.4 1702 0.7 2320 2.5

22 We

0536 0.7 1143 2.4 1743 0.8

23 Th

0000 2.5 0617 0.8 1226 2.3 1827 0.8

24 Fr

0042 2.4 0700 0.8 1312 2.3 1915 0.9

Time m

25 Sa

0127 2.4 0746 0.8 1403 2.3 2006 0.9

26 Su

0215 2.3 0836 0.8 1458 2.3 2102 0.9

27 Mo

0308 2.3 0930 0.8 1555 2.3 2158 0.9

28 Tu

0404 2.3 1025 0.7 1651 2.4 2255 0.9

29 We

0501 2.4 1120 0.7 1746 2.5 2350 0.8

30 Th

0557 2.5 1213 0.6 1838 2.6

31 Fr

0043 0.6 0652 2.6 1305 0.4 1928 2.7








Time m

1 We

0020 0.8 0626 2.5 1242 0.6 1906 2.6

2 Th

0109 0.7 0717 2.5 1330 0.5 1954 2.7

3 Fr

0158 0.6 0807 2.6 1417 0.4 2041 2.8

4 Sa

0247 0.5 0857 2.7 1505 0.4 2129 2.8

5 Su

0337 0.5 0947 2.7 1554 0.4 2218 2.8

6 Mo

0428 0.5 1038 2.7 1643 0.4 2308 2.8

7 Tu

0519 0.4 1130 2.7 1735 0.5 2359 2.8

8 We

0612 0.5 1224 2.6 1829 0.5

Time m

9 Th

0052 2.7 0706 0.5 1320 2.6 1927 0.6

10 Fr

0147 2.7 0802 0.5 1420 2.5 2027 0.7

11 Sa

0244 2.6 0900 0.5 1522 2.5 2129 0.7

12 Su

0343 2.5 0959 0.6 1624 2.5 2230 0.7

13 Mo

0443 2.5 1057 0.5 1723 2.6 2329 0.7

14 Tu

0541 2.5 1152 0.5 1818 2.6

15 We

0024 0.7 0636 2.5 1244 0.5 1909 2.6

16 Th

0115 0.7 0727 2.5 1333 0.5 1957 2.7

Time m

17 Fr

0204 0.6 0815 2.5 1419 0.5 2041 2.7

18 Sa

0250 0.6 0900 2.5 1502 0.5 2123 2.6

19 Su

0333 0.6 0942 2.5 1543 0.6 2203 2.6

20 Mo

0415 0.7 1022 2.5 1623 0.6 2242 2.6

21 Tu

0455 0.7 1102 2.4 1702 0.7 2320 2.5

22 We

0536 0.7 1143 2.4 1743 0.8

23 Th

0000 2.5 0617 0.8 1226 2.3 1827 0.8

24 Fr

0042 2.4 0700 0.8 1312 2.3 1915 0.9

Time m

25 Sa

0127 2.4 0746 0.8 1403 2.3 2006 0.9

26 Su

0215 2.3 0836 0.8 1458 2.3 2102 0.9

27 Mo

0308 2.3 0930 0.8 1555 2.3 2158 0.9

28 Tu

0404 2.3 1025 0.7 1651 2.4 2255 0.9

29 We

0501 2.4 1120 0.7 1746 2.5 2350 0.8

30 Th

0557 2.5 1213 0.6 1838 2.6

31 Fr

0043 0.6 0652 2.6 1305 0.4 1928 2.7








Time m

1 We

0020 0.8 0626 2.5 1242 0.6 1906 2.6

2 Th

0109 0.7 0717 2.5 1330 0.5 1954 2.7

3 Fr

0158 0.6 0807 2.6 1417 0.4 2041 2.8

4 Sa

0247 0.5 0857 2.7 1505 0.4 2129 2.8

5 Su

0337 0.5 0947 2.7 1554 0.4 2218 2.8

6 Mo

0428 0.5 1038 2.7 1643 0.4 2308 2.8

7 Tu

0519 0.4 1130 2.7 1735 0.5 2359 2.8

8 We

0612 0.5 1224 2.6 1829 0.5

Time m

9 Th

0052 2.7 0706 0.5 1320 2.6 1927 0.6

10 Fr

0147 2.7 0802 0.5 1420 2.5 2027 0.7

11 Sa

0244 2.6 0900 0.5 1522 2.5 2129 0.7

12 Su

0343 2.5 0959 0.6 1624 2.5 2230 0.7

13 Mo

0443 2.5 1057 0.5 1723 2.6 2329 0.7

14 Tu

0541 2.5 1152 0.5 1818 2.6

15 We

0024 0.7 0636 2.5 1244 0.5 1909 2.6

16 Th

0115 0.7 0727 2.5 1333 0.5 1957 2.7

Time m

17 Fr

0204 0.6 0815 2.5 1419 0.5 2041 2.7

18 Sa

0250 0.6 0900 2.5 1502 0.5 2123 2.6

19 Su

0333 0.6 0942 2.5 1543 0.6 2203 2.6

20 Mo

0415 0.7 1022 2.5 1623 0.6 2242 2.6

21 Tu

0455 0.7 1102 2.4 1702 0.7 2320 2.5

22 We

0536 0.7 1143 2.4 1743 0.8

23 Th

0000 2.5 0617 0.8 1226 2.3 1827 0.8

24 Fr

0042 2.4 0700 0.8 1312 2.3 1915 0.9

Time m

25 Sa

0127 2.4 0746 0.8 1403 2.3 2006 0.9

26 Su

0215 2.3 0836 0.8 1458 2.3 2102 0.9

27 Mo

0308 2.3 0930 0.8 1555 2.3 2158 0.9

28 Tu

0404 2.3 1025 0.7 1651 2.4 2255 0.9

29 We

0501 2.4 1120 0.7 1746 2.5 2350 0.8

30 Th

0557 2.5 1213 0.6 1838 2.6

31 Fr

0043 0.6 0652 2.6 1305 0.4 1928 2.7








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6








Time m

1 Su

0421 2.6 1041 0.5 1709 2.6 2313 0.7

2 Mo

0523 2.6 1141 0.4 1809 2.7

3 Tu

0013 0.6 0624 2.6 1238 0.4 1905 2.8

4 We

0110 0.5 0722 2.7 1333 0.3 1959 2.8

5 Th

0205 0.5 0817 2.7 1426 0.3 2050 2.9

6 Fr

0258 0.4 0910 2.7 1516 0.4 2140 2.8

7 Sa

0349 0.4 1000 2.7 1605 0.4 2228 2.8

8 Su

0439 0.5 1049 2.6 1652 0.5 2315 2.7

Time m

9 Mo

0527 0.5 1137 2.5 1740 0.6

10 Tu

0001 2.6 0614 0.6 1225 2.4 1829 0.7

11 We

0047 2.5 0702 0.7 1314 2.4 1919 0.8

12 Th

0134 2.4 0750 0.7 1406 2.3 2012 0.9

13 Fr

0223 2.3 0840 0.8 1501 2.3 2107 1.0

14 Sa

0313 2.3 0932 0.8 1557 2.3 2202 1.0

15 Su

0406 2.2 1024 0.8 1651 2.3 2256 1.0

16 Mo

0458 2.2 1115 0.8 1741 2.3 2346 0.9

Time m

17 Tu

0549 2.3 1203 0.7 1827 2.4

18 We

0032 0.9 0637 2.3 1248 0.7 1910 2.5

19 Th

0117 0.8 0723 2.4 1330 0.6 1952 2.5

20 Fr

0200 0.7 0807 2.4 1412 0.6 2033 2.6

21 Sa

0242 0.7 0851 2.5 1454 0.5 2114 2.6

22 Su

0325 0.6 0935 2.5 1536 0.5 2157 2.7

23 Mo

0409 0.6 1019 2.6 1620 0.5 2240 2.7

24 Tu

0453 0.5 1106 2.6 1706 0.5 2326 2.7

Time m

25 We

0540 0.5 1154 2.5 1755 0.6

26 Th

0014 2.6 0629 0.5 1246 2.5 1849 0.7

27 Fr

0105 2.6 0722 0.6 1343 2.5 1947 0.7

28 Sa

0201 2.5 0819 0.6 1445 2.5 2050 0.7

29 Su

0301 2.5 0920 0.6 1549 2.5 2154 0.7

30 Mo

0404 2.5 1023 0.6 1653 2.6 2258 0.7

31 Tu

0509 2.5 1125 0.5 1753 2.6 2358 0.6

June 2015 July 2015

April 2015 May 2015

41 Clyde Street, Whangarei I 09 438 1075 0800 102 102 I [email protected] I www.divenow.co.nz

TIMES AND HEIGHTS OF HIGH AND LOW WATERS

56

All Marine

231 Port Road 52 Riverside Drive www.allmarine.co.nz

09 438 4499 09 974 8766

Alloy Stainless & Marine 52 Riverside Drive www.asmltd.co.nz

09 438 0252

Kamo Canvas

Cnr. Pipiwai and Waipanga Road www.kamocanvas.co.nz

09 435 6117

Marine

57Marine

Dive HQ 41 Clyde Street www.divenow.co.nz

09 438 1075

Kamo Marine

193 Harris Road, Glenbervie 09 437 1090

Kamo Outboards 5 Colenso Street www.kamooutboards.co.nz

09 435 1038

Para Rubber 32 Porowini Ave www.pararubber.co.nz

09 437 7710

Bevin Sells: • Tohatsu Outboards• Zego Sports Boats• Car and Boat Trailers

• Trailer Hire• Trailer Repairs• Spare Parts

Need a new outboard motor?Or a car or boat trailer!

FREEPHONE 0800 526 662 • 09 437 1090KAMO MARINE

CENTRE193 Harris Road, Glenbervie, Whangarei.

Agent for Axxa Trailers For Hire

Need a new

outboard motor,

a car or boat trailer?

If it’s broken, we can fix it or replace it!

Tohatsu Outboards Trailer RepairsZego Sports boats Car and Boat TrailersSpare Parts Trailers for Hire

Marine

Marine Hose & TubingIndustrial ExtrusionsIndustrial Rubber StripsSponge TapesTips & Plugs

09 437 7710www.pararubber.co.nz

32 Porowini Ave, WhangareiOPEN 7 DAYS Mon -Fri 9am-5pm

Sat 9am-3pm, Sun 10am-2pm



021 025 90743

58

Stanley Marine

Town Basin www.stanleymarine.co.nz

09 438 4479

Warren Hay Marine 27 Rewa Rewa Road www.warrenhaymarine.co.nz

09 430 2666

Marine

59Marine

Eye Centre12 Kensington Avenue www.bid.do/eyecentre

0800 1100 30

Dr Rachel MossVigour Clinic, 10 Islington Street www.healthpoint.co.nz

09 459 1739

Northern Radiology

11 Kensington Avenue

09 437 0540

Medical60

See a stroke F.A.S.TIs it a stroke? Check it out the FAST way!CALL 111 IMMEDIATELY IF YOU SUSPECT A STROKE!The FAST campaign encourages New Zealanders to learn the key signs of stroke and to act fast by calling 111 if they suspect a stroke. Prompt action can save lives, improve recovery and reduce ongoing costs from stroke to families, caregivers and the health services. It is vital to recognise when someone is having a stroke and to start treatment as soon as possible, because the sooner medical treatment begins, the more likely brain damage can be reduced and a better outcome achieved.

What are the signs of stroke?The signs and symptoms of stroke usually come on suddenly. The type of signs experienced will depend on what area of the brain is affected.

Common first signs of stroke include:• Sudden weakness and/or numbness of face, arm

and/or leg especially on one side of the body• Sudden blurred or loss of vision in one or both eyes• Sudden difficulty speaking or understanding what

others are saying• Sudden loss of balance or an unexplained fall or

difficulty controlling movements, especially with any of the other signs

How can you tell if someone is having a stroke?By learning to recognise the symptoms of stroke you could save a life! Learn the FAST check.

Stroke is a Medical Emergency – Act FASTStroke is always a medical emergency. Even if the symptoms go away quickly or don’t cause pain call 111 immediately.www.stroke.org.nz/See-a-Stroke-FASTFAST posters, fliers, wallet cards and fridge magnets are available from National Office on [email protected] or your regional Stroke Foundation office.

Northland District Health BoardWhangarei Hospital, Maunu Road www.northlanddhb.org.nz

09 470 0000

Alzheimers Northland148 Corks Road, Tikipunga www.alzheimers.org.nz

09 438 7771

Gentle Dental 17 Rust Avenue [email protected]

09 430 0046

8 807

258A

A

Contact Us

We walk beside all people affected by DementiaKia piki te ora mo nga tangata mate porewarewa

PhoneWhangarei (09) 438-7771

FaxWhangarei (09) 438-2974

Email: [email protected]

Alzheimers Northland

148 Corks Road, Tikipunga

We provide support and educationto all people affected byAlzheimer’s disease or Dementialiving in Northland communities.

Medical 61

THE PROFESSIONAL, CARING DENTAL PRACTICE OFFERING A COMPLETE RANGE OF DENTAL PROCEDURES AND SERVICES.

ENHANCE YOUR SMILE WITH PERFECT ORAL HEALTH

BY VISITING US TODAY.

17 Rust Avenue | Whangarei 0110 Phone: T: 09 430 0046

[email protected]

EYE CENTRE – PRIMECAREEye Specialists: David Dalziel and Andrew Watts

Phone: 0800 1100 30

Fax: 09-972 7026 | Email: [email protected] | Website: www.bit.do/EyeCentre

12 Kensington Avenue, Whangarei

“Great service, competitive prices,family friendly atmosphere & world class technology” FOR ALL DISEASES

OF THE EYEWe consult in Kerikeri fortnightly and Bream Bay monthly. CONTACT ourWhangarei rooms for more

details.

GET

BETTERVISION THIS YEAR!• Southern Cross Affi liated Provider• RSA Agreement Holder• War Pension/Veteran Affairs Approved

ACC Approved (No ACC surcharge)

Visiting specialists:Associate Professor Polkinghorne – RetinalDr Keith Pine – Maxillofacial Prosthetist

• WINZ Quotes• Government Subsidy for

15 years and under withcommunity or higher use card.

62

Eye diseases and conditions

Chalazion

Cataract Cataract

Blepharitis Diabetic Retinopathy

Conjunctivitis

Medical

What is Ophthalmology?Ophthalmology is the branch of specialist medicine that is focused on the health of eyes and their surrounding tissues, including muscles, bones, eyelids, and tear production/drainage systems. Your eye is the organ of vision and consists of the cor-nea (the outer clear layer), the sclera (the white of the eye), the iris (the coloured part), the lens (lies behind the iris) and the retina (the light-sensitive lining at the back of the eye). Your eyes ‘see’ by focusing light that enters the eye onto the retina which sends the image to the brain by the optic nerve.

Ophthalmologists are doctors who are trained in the study of eyes. All will be trained in eye surgery and may have particular areas of interest or expertise. Dr Dalziel & Dr Watts prefers not to prescribe glasses for adults and leaves this to optom-etrists.Optometrists are not doctors but are trained in examining eyes and testing your vision to assess your need for glasses or contact lenses. Opticians read prescriptions for visual correction, order lenses and dispense eye glasses and contact lenses.

Common Eye ConditionsGlaucomaGlaucoma is a group of diseases that can damage the eye’s optic nerve and may result in vision loss and blindness. Multiple factors are often important in causing glaucoma, but it is most commonly related to in an increase in pressure in the eye. Symptoms are generally absent until the condition has progressed to an advanced stage.

Very occasionally, a rarer form of glaucoma can develop suddenly and symptoms may then include: headaches and aches around the affected eye, seeing halos around lights, sensitivity to light, blurred vision, nausea and vomiting. Please note that this will require urgent medical attention.

You may be more likely to develop glaucoma if you:• have someone else in your family with

glaucoma• already have high pressure in your eye• have experienced injury to your eye• have or have had certain other eye problems• have migraine or circulation problems.

Glaucoma is more common in people over 50 years of age and more common in women than men. Di-agnosis usually comes after consultation with an eye doctor. Signs of glaucoma may also be picked up at an optometrist’s eye examination.

Age-Related Macular Degeneration.Age-Related Macular Degeneration (ARMD or AMD) is the leading cause of legal blindness in peo-ple over 50 years of age (legal blindness means that a person can see 6/60 or less with glasses). It is caused by the breakdown of the central portion of the retina (the nerve layer part of your eye) called the macula.The macula is responsible for the fine central vision in the eye that is needed for driving a car, reading fine print, recognising faces, watching television and fine work etc. Peripheral vision will remain clear.The cause of ARMD is unknown but smoking has been shown to accelerate it, especially the “wet” form. Macular degeneration does appear to be he-reditary in some families but not in others.There are two types of Macular Degeneration: dry and wet.

63Medical

Medical64

Community Equipment

We provide a dedicated technical support service to Northland’s citizens who use mobility equipment to live independently, generally through the organisations that fund the equipment. Services we provide include:• vehicle modifications• lift installation and servicing• power chair servicing and repair• mobility scooter servicing and repair• walking frame, stroller, hoist and commode servic-

ing and repairsOur workshop facilities are located at 29 Hewlett Street, Whangarei. Our team is mobile so you can be too! We travel to clients from Wellsford to Cape Reinga, coast to coast, right throughout Northland.Our key clients are:• accessable (who manage equipment for both ACC

and Ministry of Health clients) • NorthAble’s EQ+ service (Phone 0508 637-200)

If you need repairs, maintenance, or technical support for your Ministry of Health or ACC funded mobil-ity equipment, contact accessable who will arrange for Whangarei Engineering to do this (free phone 0508 001 002 or email [email protected]). If you have equip-ment that was issued by the Ministry of Health or ACC and no longer need it, give accessable a call and they will arrange to have us collect it at no cost to you or your family. Alternatively you can call us direct on 09 430 2104.

Tiaho Trust - Empowering Communities

We are proud to have a close working relationship with Tiaho Trust, a ‘for disabled - by disabled’ organisation based in Whangarei that provides information and empowerment services to the disabled community of Northland, New Zealand. They can be reached on 09 430 3406.

Who to contact for help and support?Telephone advice counselling and supportLifeline - Telephone Counselling & Advice 0800 543 354Youthline [email protected] 0800 376 633 (txt 234)0508 TAUTOKO - Suicide Prevention help line midday - midnight 0508 82 8865Rainbow Youth - Support for gay young people & their family [email protected] - Phone Counselling for children aged 9 to 13 years kidsline.org.nz 0800 543 754

Whatsup - Counselling for children aged 5 to 18 years old whatsup.co.nz 0800 942 8787

Depression Helpline - Counsellors who can find the right support depression.org.nz 0800 111 757Alcohol and Drug Helpline - Information, insight & support Maori Line Pasifika Line

0800 787 7970800 787 798 0800 787 799

Medical 65

NorthAble Disability ServicesNorthAble’s mission is improving access to disability sup-port services in Northland Te Tai Tokerau. NorthAble’s main functions are to provide a DIAS (dis-ability, information and advisory service); a NASC (needs assessment and service co-ordination service); VHN (Very High Needs Service); and a LYNKZ (community participation and vocational programme); and Equip-ment Shop (Equipment Plus) and associated mobile van.

DIAS NorthAble is ‘Your First Stop for Disability Infor-mation and Service’. We provide you with free, friendly, independent disability information on a range of wide range of topics.

NASC is a gateway to accessing a range of disability sup-port services.

LYNKZ is a Community Participation and Vocational programme assisting and supporting people whilst they’re seeking employment and providing life skills such as cooking and social activities. VHN is a vocational and community participation ser-vice for people with Very High Needs as assessed by the Ongoing Resourcing Scheme (ORS).

Equipment Plus Shop: Come and check out the range of equipment at Equipment Plus - accessible car parking available. Mobile Service: Our mobile van services rural Northland on a regular schedule selling disability equipment and providing a full of a wide range of dis-ability information.

Contact NorthAble, 40 John St, Whangarei. Telephone 09 430 0988, Freephone 0508 637 200, Fax 09 438 9468, Email: [email protected], Website: www.northable.org.nz

Equipment Plus Shop & Mobile Van Service: 73 John Street (Corner John and Dent Streets), Whangarei, phone 09 430 3469. Also at 16 Edward Street, Dargaville and Greenworld Health and Lifestyle, 97 Broadway, Kaikohe. Online shop: www.equip-mentplus.org.nz

LYNKZ: 65 John Street, Whangarei and Tirarau Street, Dargaville, phone 09 430 3470.

Primary Mental Health coordinators (mon-fri only) Non-urgent referralsWhangarei Graz Amber 09 438 1015Bay of Islands Tina Silk 027 242 0003Bay of Islands & Kaikohe Amanda Douglas 021 028 576Kaitaia Ki Whakawhiti are Pai Richard Waitling 021 222 9859WhangaroakiKaitaia Te WaratiUtutaonga - Pawa 021 889 872Hokianga Kathryn Johnstone 021 457 721

Other Local Support

Whaingaroa - Social Worker Valmai Piper 021 852 276 or 09 405 0340Ngati hine Health Trust Doreen Rihari 027 304 9536 or 09 430 2386

Internet SourcesThe Word - Questions answered about sex, life and relationships theword.org.nzThe Lowdown [email protected] text 5626Suicide prevention intervention New Zealand www.spinz.org.nzThe Journal - John Kirwan’s Self Help Strategy www.depression.org.nzBeating the Blues www.beatingtheblues.co.nz (see your GP)

8.30am - 5.00pm Monday - FridayPh: 09 437 0540

At Northern Radiology, we are proud of our achievements in providing a private radiology service to the Northland area for 35 years.

By accepting a quality management philosophy and developing and implementing quality management systems, we strive to continually improve

the delivery of our service to our customers.

11 Kensington Ave, Whangarei

-sive to the needs of our customers, who are patients and referring practitioners.

X-rays Bone Density scans Mammograms CT & MRI scans Pregnancy Ultrasound

66

8.30am - 5.00pm Monday - FridayPh: 09 437 0540

At Northern Radiology, we are proud of our achievements in providing a private radiology service to the Northland area for 35 years.

By accepting a quality management philosophy and developing and implementing quality management systems, we strive to continually improve

the delivery of our service to our customers.

11 Kensington Ave, Whangarei

-sive to the needs of our customers, who are patients and referring practitioners.

X-rays Bone Density scans Mammograms CT & MRI scans Pregnancy Ultrasound

67

MotoringMotoring68

Magic Tyres 4 Reyburn Street

09 438 3534

AMT Whangarei Mobile Mecahnic www.whangareimechanic.co.nz

09 438 9750

Obsidian [email protected]

027 7332 779

4 REYBURN STREET, WHANGAREI PH 09 438 3534 OR 0800 867 897

Phone 438 9750 Mobile 021 251 8415

We have a well equipped mobile van to tackle almost any mechanical repair.

We can repair your car at your own home or work nine times out of ten!

www.whangareimechanic.co.nz

We also offer: Servicing Warrant of Fitness Repairs

Pre-Purchase Inspections Vehicle TLC

Motoring 69

A1 Auto Wreckers34 Rewarewa [email protected]

09 438 9164

All About Tyres4 Wakelin [email protected]

09 435 4545

Garnet Motors46 Kaka Street

09 438 7209

Kamo Panel & Paint

Colenso Street www.kamopanelpaint.co.nz

09 435 1950JJ Automotive Services33 Commerce Street, Unit 11

09 438 2095

MotoringMotoring70

Shaw Motorcycles 11 Cameron [email protected]

09 438 1183

Water Street Motors

44 Water Street

09 438 1197

Valid Automotive 164A Lower Dent Streetwww.validautomotive.com

09 430 7579

Motoring 71

Planet Honda20 Port Roadwww.planethonda.co.nz

09 438 9780

Rent-a-Cheepy

69 Otaika Roadwww.rentacheepy.co.nz

09 438 7373

72

Electric Vehicles: An Economic AppraisalIn recent years, electric vehicles have enjoyed a lot of attention. They are not only environmentally friendly, but also come with substantial financial benefits. High purchase prices have always been a snag to the uptake of these vehi-cles. However, this has changed as the top selling car manufacturers like Nissan have brought down the purchase price by severe price cuts. The situation is only going to get better from here, thanks to the emerg-ing battery technology. While many people seem unaware, electricity for transportation is cheaper than petrol. So if you avoid the monstrous oil machine, you’re saving up on your pennies. This matters to all of us, after all, ‘A penny saved is a penny earned’. Electric cars are also maintenance free as opposed to their combustion counterparts. They have less moving parts and fewer liquids; no oil changes, no spark plugs, transmissions or fuel filters. Due to the effects of regenerative braking, brake systems on these vehicles typically last longer. An annual basic service on a car like the Mitsubishi iMiEV would cost around $150 and involve general checks on the suspension components and checking fluid levels (and top-ping up if need be). With the battery cost reductions and rising oil prices, these savings will increase further in the coming years. Table 1 shows a cost comparison between electric and petrol cars. This was tabulated by an EV owner based in Whangarei.

Table 1- Cost comparison between Electric and Petrol cars

Tesla Roadster and Tesla Model S plugged in at New Zealand's only Rapid charging station in Whangarei.

MotoringMotoring

73

09 438 3700 74 Kioreroa RdWOF TyresServicing MaintenanceFull diagnostic scan Aircon check

Come and see us for quick and affordable service!

Whangarei and Kamo Testing Railway Road WhangareiClark Road, Kamo

09 438 812509 435 8125

Whangarei Automotive

74 Kioreroa Road

09 438 3700

Kamo Display & Sell

479 Kamo Road

09 435 0079

Walls Daimlers 021 932 225

09 434 4936

Independently owned and locally operated testing stations

Are you concerned about your car not being checked for 12 months?

Pop in and get one of our 10 point interim Safety Checks* and put your mind at ease.

Helping keep Northland driverssafe for 25 years

WhangareiTesting Station

Railway Rd, Ph 438 8125

KamoTesting Station

Clark Rd, Ph 435 3682

safe fo

*Safety checks are undertaken by a WOF authorized inspector but do not constitute

a Warrant of Fitness.

ARE YOU BEING SERVED?

When it comes to servicing your car two of the biggest problems arememory and money. As long as the car is performing we just plain forget to get it checked and when we think we should, we justify not having it done

becausemoney’s tight. It’s false economy of course and having the car clap out on a rainy winter’s night isn’t pleasant.

It’s a good policy to establish a relationship with your mechanic. Most vehicle service providers are bound by consumer protection legislation and, if they’re part of a franchise or belong to a recognized servicing organisation, are additionally contractually bound to provide a certain standard of customer care. If you think you’re not being looked after well, change your provider.

It’s a competitive world and you’re the customer.

The Warrant of Fitness check acts as a service reminder of course andWOF rules were recently changed. Since 1 January 2014 all vehicles fi rst registered on or after 1 January 2004 now only require annual inspections for the lifetime of the vehicle.

From 1 July this year other WOF changes will be introduced:

• After an initial inspection new vehicles won’t require aWOF inspection until the third anniversary of fi rst registration

• Vehicles less than three years old will be issued a WOF that expires on the third anniversary of fi rst registration or 12 months after the currentWOF expires, whichever is the longest

• Vehicles fi rst registered on or after 1 January 2000 will require an annual inspection• Vehicles fi rst registered before 1 January 2000 still require a six-monthlyWOF

inspection. For more information–www.nzta.govt.nz

Ph: 09 435 0079479 Kamo Road

KAMO

DISPLAY & SELL

WE SELL 4UAUTO NETWORK

A platform for private sellers and buyers to buy and sell with no hidden cost.

Finance available

P r i v a t e B u y e r s

Motoring

74 Retail

75

Alpha Kids

3/485 Kamo Road [email protected]

09 435 1833

Kamo Pet & Aquatic

521 Kamo Road [email protected]

09 435 3736

Melville’s Home Centre

14 Vine Street

09 438 7022

Bin Inn

75 Walton Street [email protected]

09 430 0588

Retail

76

Kamo Florist

523 Kamo Road www.kamoflorist.co.nz

09 435 1115

Brewers World

5 Maunu Roadwww.brewersworldwhangarei.co.nz

09 438 0988

Pet Essentials32 A Commerce Streetwww.petessentialswhangarei.co.nz

09 438 8835

Network VideoTikipungaOnerahi

09 435 3430 09 436 3430

Retail

77Retail

PARA RUBBER 09 437 7710www.pararubber.co.nz

STORAGE BOX 09 437 7710www.storagebox.co.nz

FOAM AND RUBBERSPECIALISTS

PARA RUBBER & STORAGE BOX32 Porowini Ave, Whangarei

OPEN 7 DAYS M-F 9am-5pm, Sat 9am-3pm, Sun 10am-2pm

PARKING AVAILABLEAsk about our trade account for both stores

Starts Thursday 2nd October – 12th October. No rainchecks.

From 5mm to 150mm thick in all grades

Cut per sq/mfor seats, lounge, mattress, squabs, craft etc

Upholstery Foam

NOW

$4499

NOW

$7999

NOW

$1799

NOW

$2999NOW

$2999NOW

$3499

Free cuttingBring in your sizes

Super Pool Broom7 rows of UV-stabilised heavy duty nylon and PP bristles. Large curved area provides constant contact with pool surface.

10kg Para Pool ChlorineFor the control of algae and bacteria in outdoor pools.

Zig Zag Rubber JandalsEssential summer footwearSizes: 5 to 14

All Purpose Pool BroomEffective for startup pool brushing and algae removal / prevention.

Leaf RakeTapered edge and extra strong net removes surface and fl oor debris.

Telescopic HandlesFeatures the ezy-lock internal or external locking cams and heavy duty wishbone clips.Extendable sizes: 1.2 to 2.4m, 1.8 to 3.6m, 2.4 to 4.8m

$10Save

ROLLING BOXES16L, 23L, 32L, 42L, 53L, 82L, 88L, 110L, 140L

SULO WHEELIE BINS60L/120L/240L Sulo

Solid construction Wheelie Bins

SHOPPINGBASKETS

STORAGE BOX REFILL BOTTLES & JARS

KITCHENDRAWER INSERTS

SAVE $5.00 SAVE $5.00 SAVE $10.00ea

10%off

Huge range from$10.99

20%OFF

SPECIAL60L $74.99120L $99.99240L $129.99

GreatBuyHalfPrice

$9.99limited stock

Trim To Size For Perfect Fit – White420X375, 440X390, 485X390, 485X440

From$23.99

Huge selection atomisers, pumps, fl ip-lid etc

ffrom

ool surface.

ebris.

NOWWWWWW

1.2m to 2.4m

pair

Spring Special

Spring Special

Spring Special Spring SpecialSpring Special

4x4 JandalsGreat non-slip design– very popularSizes 7-14

Best Buy$1699

all sizes

78

Para Rubber & Storage Box 32 Porowini Avenue www.pararubber.co.nz www.storagebox.co.nz

09 437 7710

Tikipunga Wholesale Meats 169 Kiripaka Road

09 437 0843

Sugar Rush 37 Bank Street (Civic Arcade)

09 438 7984

Rasheeds 3 Maunu Road

09 438 4683

Magic Tyres 4 Reyburn Street

09 438 3534

09 437 0843

Open Monday-Friday 7.30am - 6pmSaturday 9am - 3pm

169 Kiripaka Rd, Whangarei

NOW ACCEPTING WINZ CARDS

PRICES UNBEATABLE

RASHEED’SASIAN GROCERIES

GLUTEN FREE FLOUR 100+ SPICES40+ LENTILS & BEANS

SOUTH AFRICAN PHILIPPINES

INDIAN GROCERIESTHAI

3 Maunu Rd, Whangarei PHONE 09 438 4683

4 REYBURN STREET, WHANGAREI PH 09 438 3534 OR 0800 867 897

Retail

79Real Estate

Brent Harkin021 140 2837 [email protected]

09 438 8667

Pauline Dinsdale Real Estate569 Kamo Road 021 344 866

09 435 6575

Barfoot & [email protected]

022 628 9076 09 438 1322

i-Rentalswww.i-rentals.co.nz

09 438 866722159WGR_MindaRoss_9x12.indd 1 19/02/2014 2:06:30 p.m.

Retail

80 Retirement

CAIRNFIELD HOUSEREST HOME & HOSPITAL

“Where Quality and Loving care is Assured”

24 Hour Care/ Registered Nurse Available 7 days a Week

Gracious Large RoomsDelicious Home Cooked Meals

Extensive/ Fun Activities ProgramMOH Certifi ed/ Privately Owned

Please come and check out our new hospital wing.

52-60 Jack street, Whangarei | Ph: 09 437 0186

IT’S NEVER TOO LATE TO STARTFor many Kiwis, retirement is about having more time to enjoy the things they love, but a growing number of New Zealanders don’t know how much money they will need to enjoy the kind of retirement lifestyle they want.“Going into retirement doesn’t mean your life stops” Sorted’s Jane Ratcliffe says. “To be able to enjoy your retirement it’s important to work out how much money you’ll need to support your lifestyle, when you’re no longer in paid work.”CREATING A MONEY PLAN For most New Zealanders, NZ Super will not be enough to sup-port the kind of lifestyle they’re after. “It’s important to sit down and work out how much extra money you’ll need beyond NZ Super to sustain the lifestyle you want for your retirement – and that’s where a money plan can help” says Jane.“Making a plan for your money is one of your best tools for get-ting sorted – all you need are details of your current spending and income” says Jane. “Your money plan will tell you whether you have money left over. If your plan shows you don’t have enough, you’ll need to adjust your spending or find ways to increase your income.“Everyone can benefit from having a budget. Simply, this is a plan of what money you expect to receive and how you expect to spend it. It’s one of your best tools for managing your money, whatever your age”SO WHAT ARE YOU DOING ABOUT IT? Whether you have your retirement in hand or it’s causing you concern, the key is to do something about it. IT’S NEVER TOO LATE TO MAKE A PLAN NO MATTER WHAT YOUR AGE “Many Kiwis describe retirement as the best time of their life because of the freedom it gives them. So do what you can to make sure you and your loved ones can make the most of it too”.At ISN we specialise in working with people to help identify their personal retirement wealth targets and also illustrate available options to help achieve their goals. We also work with retirees to help them plan their retirement spending.

Contact us to arrange a free

no obligation meeting.

www.isnorthland.co.nz

Retirement

202 Kamo Road,Whangarei

Visit us on Facebook/puriricourt

Ph: 09 437 9302 Fax: 09 437 [email protected] www.pcrh.co.nz

Ask us about our meals on wheels.

Puriri Court Rest Homeand Hospital

We specialise in providing professional, personalelderly care. Our independently owned rest home

facilty is fully equipped and staffed with caring professionals.

As a care facility, we believe Puriri Court Rest Home and Hospital provides the best clinical care available in the greater Whangarei area.

81Retirement

Home awayCare • Comfort • Companionship

from home

45-47 Kamo Road, Whangarei PHONE: 09 437 3311 Manager: Maryanne Thompson, RN Licensed by the Health Department

Cairnfield Resthome and Hospital

52-60 Jack Street, Whangarei

09 437 0186

Puriri Court Rest Home and Hospital

202 Kamo Road www.pcrh.co.nz

09 437 9302

Kamo Disability Supplies

561B Kamo Road

09 435 6953

Parahaki Court Resthome

45-47 Kamo Road

09 437 3311

83

A&P Society www.whangareiap.org.nz

09 438 3109

Cervus Equipment115 Kioreroa Road www.cervusequipment.co.nz

09 438 7228

Fencing Services

113 Lower Cameron Street

09 438 9330

Norwood22 Rewa Rewa Road www.norwood.co.nz

09 438 4719

115 Kioreroa Road P 09 438 7228

RESIDENTIAL & COMMERCIAL

AGRICULTURAL EQUIPMENT GOLF & TURF EQUIPMENT

TOYS & MERCHANDISE

www.cervusequipment.co.nz

Rural

09 438 3109www.whangareiap.org.nz

PROVIDING A LINK BETWEEN TOWN & COUNTRY TO FURTHER AGRICULTURAL INTERESTS.



021 025 90743

84

Specializing in sales, parts, service and accessories of road bikes, farm bikes, dirt bikes and jet skis.

09 437 5451 or 021 346 44915 Rewa Rewa Road, Whangarei

[email protected] www.northlandpowersports.co.nz

Northland PowerSports15 Rewa Rewa Road www.northlandpowersports.co.nz

09437 5451

Farm [email protected] www.farminsure.co.nz

0272 455 133

For a free, no-obligation quote, call Nicki Spence NOW on 0272455133

email [email protected] or see our website www.farminsure.co.nz

Do you want to save money on your ACC levies?Do you want to make sure you’re not paying too

much for your other insurance covers- and that they actually protect you for

what you want them to?

Do you own a farm or business? Do you look at your ACC levies and wish they could be cheaper? Well there is an option that not a lot of people have heard about- an agreed value cover called Cover Plus Extra. This is ideal if you have a business or farm where the income fluctuates a lot, because you de-cide the level of cover in advance of anything happening, rather than having to prove what your income was once the accident has hap-pened. One weak spot with ACC cover is just that- they only cover accidents. Did you know that if you look at everything that is claimed for under personal risk insurance, accidents will usually only make up 5-6% of the total claims? That means that 94-95% of claims are for illness- so if you’re a farm or business owner and you want to make sure that it can keep running if you can’t work for some reason, you really need to have good insurance cover for if you get sick as well.At Farm Insure (a division of Essential Insurances), we specialise in restructuring your ACC cover with private insurance cover- giving you really good protection if you get sick OR have an accident. Doing this means not only better cover, but often we’ve been able to save clients THOUSANDS of dollars a year!

So why have insurance at all?In a nutshell, it’s all about how much risk you want to have in your life. For example- you own a house with a $100000 mortgage, and you choose not to take out life insurance to cover the mortgage should you die. You are choosing to take all the risk yourself- so if you do pass away, the debt either has to be taken on by someone else or the house sold to pay back the debt. If you have family that you want to inherit the house, do you want them to inherit the debt as well? If you don’t, then a life insurance policy is a simple way to make sure that they inherit a debt free property- a nice legacy to leave if you aren’t around anymore.

What types of insurance are there?Broadly speaking, there are 3 types- insurance on people, insurance on property, and insurance on business. At Essential Insurances we specialise in the last two- insuring people and businesses (includ-ing farms). We can choose from at least four different insurance companies to make sure you get the best possible cover specific to your situation.

Why use an insurance adviser (also known as a broker)?A good adviser will do exactly that- advise. They also can save you A LOT of money- the difference in premiums between companies can vary hugely, and also there may be different ways to cover you that can work out a lot cheaper! They will usually have an initial consul-tation with you to get an understanding of you and your situation, then come back with a recommendation for the cover that they sug-gest- then it is up to you to decide if you want to take that advice! As the saying goes ‘the devil is in the detail”- and that DEFINITELY applies to insurance policies. Speaking from a personal perspective, I make a point of constantly reading policy documents- not only from companies that I represent, but as many other companies as I can, so I always know as much as possible about what is available in NZ. This is so that I can then tell you (for example) which company will be the best one to be with if you are worried about getting a ma-lignant melanoma. I can also tell you which companies are easiest to meet the criteria of a heart attack for (and therefore be able to claim successfully), and which company is best to take out medical insurance with if you want to be able to get the latest anti-cancer drugs that are not funded by PHARMAC- up to $300,000 per year! This means that once I get an idea from you of what is important to you, I can then recommend not only the best type of insurance cover for you, but also the best company to go with.

What else does an adviser do?A good adviser won’t just sell you insurance and disappear- they will be with you for the life of the policy. At Essential Insurances, we start by getting to know you and about your priorities and situation. We will then show you our recommendation, and help you decide what the best option is for you- maybe everything we’ve suggested, maybe just a bit, but we’ll NEVER push you into something you don’t completely believe is right for you and your budget! We’ll make the application process as easy as possible, and once your new cover is in place, we’ll even make sure your old cover is cancelled. Then usu-ally once a year we will contact you to make sure all your cover is still at the right levels- because sometimes it may need to be increased or changed, but often it needs to be reduced as debt levels fall and children leave the nest. And in the unfortunate event that you need to make a claim, we are your first point of contact- and we will work REALLY hard to make sure that everything runs as smoothly as possi-ble, because you don’t want extra stress at an already stressful time!So if this has got you thinking that you should look at your insurance options, please call or text:

Nicki Spence on 0272455133 Email: [email protected], or Check out our website for more information at www.farminsure.co.nz.I look forward to hearing from you!

Rural

85

ThinkWater29 Port Roadwww.thinkwaternorthland.co.nz

0800 1 thinkwater

WES Electrical

24 Herekino Street www.wes.net.nz

09 470 0220

www.thinkwaternorthland.co. nz 0800 1 thinkwater

NORTHLAND

Water is our business

NEW ZEALAND AND AUSTRALIA’S LEADING WATER SOLUTIONS NETWORK

now open in Northland

Come and visit us at our new showroom29 Port Road, Whangarei

Rural

87

Shop 9 &11, Civic Arcade, 41 Bank Street, Whangarei

Mon - Fri 8.30am to 5pm

Where no alteration is too big

We aim to please

We aim to provide you with the best

fit for all your clothing needs.

Alterations and Repairs of:

Overalls

Patching

General clothing

Uniforms

Special occasion clothing

Wedding dresses

Curtains

Leather, Etc.

Phone: (09) 438 6936 Email: [email protected]

PROOF COPY

ONLY

Fire Services

www.fire.org.nz

111

Alice’s Clothing Alterations

Shop 9&11 Civic Arcade, Bank Street

09 438 6936

Engraving Systems28 Reyburn Streetwww.engravingsystems.co.nz

09 438 1744Trophies & AwardsMEDALS

28 Reyburn Street Tel: 09 438 1744 [email protected]

www.engravingsystems.co.nz

A reputation for achieving the impossible!

engravingLaser EngravingSublimation G

ifts

21st KeysBadges and BarsSHIRTS

Plaq

ues

Sand Blasting

Self inking Stamps

Services Offered

88

Family Photography & Cake Smashes

Glenbervie, Whangarei

09 4591688 or 021 613 880www.fledglingphotography.co.nz www.facebook.com/FledglingPhotographyWhangarei

Helping you capture wonderful memories for you and your family.

call Nicki Spence NOW on 0272 455 133 email [email protected] or

see our website www.essentialinsurances.co.nz


FOR A FREE NO OBLIGATION QUOTE

Are you too busy to run around getting quotes for the cover you know you need?Then let us take the hassle out of getting or reviewing insurance

Fledging Photography

Glenberviewww.fledgingphorography.co.nz

09 459 1688

Frankensignz132 Cameron Street

09 9737 483

Essential Insurances

www.essentialinsurances.co.nz

0272 455 133

Syndicate Signs

120 Robert Streetwww.syndicatessigns.co.nz

09 459 7417

The Business [email protected]

021 025 90743

Services Offered

89

Morris & Morris199 Kamo Roadwww.morrisandmorris.co.nz

09 437 5799

Robinson Memorials

8 Maunu Roadwww.robinsonmemorials.co.nz

09 438 3201

What happens when someone diesMore often that not, a natural death occurs in a hospital or nursing home rather than a home. The following infor-mation details what happens when a death occurs.

Death in a Hospital or Nursing HomeFollowing a death in a hospital, hospice or nursing home medical staff will contact the doctor to issue a death certificate. The nursing staff will notify the next of kin and family members. Nursing staff will usually prepare the deceased and you will be able to spend time with them before having us transfer the deceased into our care.

When a death occurs at homeYou should phone the deceased’s doctor as soon as pos-sible so the Doctor can verify the death and confirm that they can sign the medical Death Certificate. Once a Death Certificate has been signed we can then transfer the de-ceased into our care at our funeral home.

When death is referred to the CoronerWhen an unexpected death occurs in the home, hospital or in a public place then the death may need to be referred to the Coroners office. The following are reasons why a death may be referred to the Coroner:

Accidental DeathA death by accident, whether it involves motor vehicles or not, will involve the Police. Once they have completed

their scene examination they will organise for a Funeral Director to transfer the deceased to the Coroners Mortu-ary. The Police will call the Funeral Director of your choice once the Coroner has completed the formalities. You are not obliged to use the same Funeral Director who trans-ported the deceased to the Coroners Mortuary.

An unexpected DeathApart from an accident, examples of unexpected death could be where there is no serious health history, possible violence, or no recent consultation with a doctor. In such circumstances you should call the Police as well as your doctor. The Police will determine if the death needs to be referred to the Coroner.

If the Coroner is involvedIn cases where the cause of death is not obvious, the Po-lice will notify the Coroner. The Coroner will carry out fur-ther investigative work to determine the cause of death. When this has been completed, the deceased will then be released to the family to arrange the funeral. You will need to inform the Coroner which Funeral Director you wish to use. www.morrisandmorris.co.nz

Services Offered

90

STATIC GUARDS

MobILE PATROLS

CASH IN TRANSIT

DOCUMENT DESTRUCTION

KEY HOLDING & ALARM RESPONSES

RETAIL SECURITY

NIGHT CLUB / BAR SECURITY

CONSULTING SERVICES

HOURS DAYS

NORTHERN DISTRICTS

SECURITY

Northern Districts Security has been delivering Peace of Mind since 1989.

www.ndsecurity.co.nz

09 430 3232134 Dent Street • Whangarei

All our security staff undergo professional training by qualified instructors, and are licenced through the Ministry of Justice.

We are committed to providing our customers with ethical and top of the line services.

91

Northern District Security134 Dent Streetwww.ndsecurity.co.nz

09 430 3232

Regent Dry Cleaners and LaundromatCnr Mill Road and Shortland Street

09 438 0563

PrymeDesign 022 063 8799

Splash Signs & Print72 James Streetwww.splash-signs-and-print.co.nz

09 438 2102

[email protected]

022 608 3528

09 438 210272 James Street, Whangarei

Come and see us for all your printing needs!

Banners & Flags Graphic Design Footpath Signs Business Cards

Professional Alterations& Repairs

PH 09 438 0563Cnr Mill Road & Shortland StWhangarei

REGENT DRY CLEANERSAND LAUNDROMAT

• HEMS • WAISTS • ZIPS • HOLES • & MORE

Services Offered

92

Whangarei AirportHandforth Street, Onerahi www.whangareiairport.co.nz

09 436 0047

Jonzone4 Porowini Avenuewww.jonzone.co.nz

09 430 0625

Armourguard 7B First Avenue www.armourguard.co.nz

09 438 5585

Whangarei DrycleanersCnr Clyde & Walton Streets

09 438 2121

Email:[email protected]

Handforth Street, Onerahi Whangarei

Ph: 09 436 0047

10 minute

drive from

centre of

Whangarei.

WHANGAREI DRYCLEANERS• Under cover drive-in • Professional alterations and repairs• Same day laundry service • Blanket and duvet specialists• Specialist sportswear cleaners

Self Service LaundromatCnr Clyde & Walton Streets

ARMOURGUARD SECURITY

7B First Avenue, Whangarei 09 438 1639

Armourguard provides tailored solutions for all security requirements,

everywhere, every day.

Cash in transit and processing solutions Static guardsPatrols Alarm response services

www.armourguard.co.nz

Services Offered

93

WildByNature [email protected]

0210 834 4253 Speedy Signs103 Cameron Street www.speedysigns.co.nz

09 430 3460

Waste Management 09 438 5585

Contact Chantel Minnaar Today0210 834 4253 [email protected] us on: www.facebook.com/Wild-By-Nature

Nappy Wallets Bandana Bibs Burp Cloths

Crochet Beanies Capsule Covers ...and many more

Services Offered

95Sport, Recreation and Leisure

Phone: 09 945 4505 Shop 17, 81 Paramount Parade,Tikipunga

Moana Futures 81 Paramount Parade

09 945 4505

Northland Rugby50 Kioreroa Road www.taniwha.co.nz

09 438 4743

TenPin Bowling

129 Port Road www.10pinbowling.co.nz

09 438 1028

AE Fun Park 203 Hayward Road, RD8 www.aefun.co.nz

09 432 3534

97

Specialists in computer and network services. Helpdesk assistance Internet security through to Disaster recovery and hardware failure

No challenge is too big, or too small, for the team at Microcraft.

P: 09 438 6065 Open Weekdays 8am-5pm www.microcraft.co.nz 140 Maunu Road

Vince Cocurullo - Fix It Man www.cocurullo.co.nz

09 438 8834

Microcraft 140 Maunu Roadwww.microcraft.co.nz

09 438 6065

Need a Nerdwww.needanerd.co.nz

0800 63 33 26021 215 0875

Technology

Take away the frustrations of purchasinga business or home computer!

Need a Nerd will come to you and:

• provide the right advice on what you should buy

• plug in cables and set up internet, e-mail and software

• transfer fi les from old to new

• provide outstanding ongoing service and support

David Taylor • www.needanerd.co.nz021 215 0875 • 0800 63 33 26

Battery tips for your smartphone and tabletYou know smartphone battery life doesn’t last forever. Sure, the smart thing to do is to always have your charger handy. But life doesn’t always go according to plan. So if your charger’s at home and you’re not, how can you stall that powerless feeling for as long as possible?Here are our top 10 battery tips you can do before you leave home, as well as when you are away and don’t have a charger:1. Carry a spare charger that doesn’t require an

outlet. For optimal charging, use the approved wall charger for your device.

2. Pamper your battery. Keep the ports where your battery plugs into your device clean. Don’t let your device get hotter than about 95 degrees Fahrenheit, and limit your usage outside in colder weather, too. For additional reassurance or to give your hot battery a break, you might consider carrying a spare that you can pop in when you’re caught in the red.

3. 3. Upgrade your device. Newer smartphones have considerably longer-lasting batteries than older phones. Depending on usage, the Droid Turbo can deliver up to 48 hours of perfor-

mance before needing a boost.4. Economize. Turn off Wi-Fi when not in use.

Wi-Fi gobbles a lot of power on all devices because it’s always looking for a signal. You can also turn off 4G LTE if you happen to be somewhere without a strong signal. Keep the screen as dim as you can stand it, and close apps when you are done with them so they don’t run in the background. Extend the refresh time: Set your email to get new messages every 15 minutes (or even longer) rather than as soon as they arrive on the server. And when-ever possible, put your device to sleep.

5. Turn off push notifications. Yes, you want to know breaking news as soon as it happens or keep up with Facebook® comments the instant they are posted to your wall, but these notifica-tions require power. Turn them off when you need to conserve energy and disable location-based services when not in use.

6. Change your settings. Change the display set-tings on your phone so that your screen time-out is at a lower setting. Make sure Bluetooth is turned off when not in use so your device isn’t trying to pair with an accessory that isn’t there. Turn off your GPS options, too. Live wallpaper applications can also affect battery performance. While you’re in settings, see if

you have the latest software, and if not, update it! Also, make sure you have enough battery life to complete a software update. Note that it also takes at least three days to see battery improvement after updating the software.

7. Do some digging. Look for apps that help you monitor your battery use.

8. Don’t turn it off. Really—your tablet or phone will use more juice powering back up than it will quietly napping. When at home, you’ll want to power cycle the device every 48 hours by turning it off, waiting 15 to 30 seconds, then turning it back on. A power cycle will reboot the device, and will turn off any apps that could be inadvertently running in the back-ground and draining the battery.

9. Charge it! But not too often. For optimum performance, “reboot” your battery whenever you can by waiting to charge until the battery is down to about 10 percent. Then, fill ’er up to 100 percent. Try to avoid overcharging it except for newer devices, which is recom-mended.

10. Have a tablet? Drain its battery regularly. For optimum battery performance in a tablet, once a month, let your battery drain completely before recharging. It appreciates the exercise.

www.verizonwireless.com

98

On the fast-track to UFB2015 is shaping up as a big year for Northpower and Northpower Fibre. With more than 3,500 people already connected to New Zealand’s first (and world-class) ultra-fast fibre network, we’re expecting plenty more Whangarei residents and businesses to connect this year.

Northpower’s General Manager of Network, Graham Dawson, says uptake figures in some areas of Whangarei are immensely pleasing and he expects the figure to double in 2015.

“You take the Port area of Whangarei for example and we’re talking an uptake rate of 57% already. Businesses on fibre are discovering savings and greater efficiencies. I’d like to see 80% of local businesses on fibre within a couple of years,” says Mr Dawson. Northpower provides the first 30m of fibre installation to businesses on the UFB network free. “Due to the sheer volume of orders at times, there will be delays connecting people to the Whangarei UFB network, but we have geared up with additional technicians to assist in the process.

We ask people to be patient because it will be worth the wait – and the fact it is free (up to 200m of fibre installation) for most residential customers is quite enticing. To find out more (and to find a list of retail service providers on the Northpower Fibre network) visit the ‘Our

Partners’ page at www.northpowerfibre.co.nz. And to find out if fibre is at your door, go to the Coverage tab, enter your

address and click on ‘Check Availability’.

Separate to the Whangarei UFB network, Mr Dawson says North-power is keen to be part of the spread of UFB to more rural towns in Northland. “We have always had a

vision to take fibre into other parts of our electricity network in Kaipara and

Whangarei, so we will be putting our best foot forward to be part of the government

initiative to build UFB networks in other parts of Northland,” he says.


Whangarei has the fastest broadband in New Zealand


Go to northpowerfibre.co.nz check the coverage tab to see if

fibre is at your doorstep.

Choose your prefered broadband provider and



northpowerfibre.co.nzAll enquiries: 0800 667 847

Technology

“In terms of value for money, fibre broadband

and phone can cost you no more than what you pay

today”General Manager of Network,

Graham Dawson

99

Ultrafast Broadband & Telecommunications SolutionsUltracom is your Whangarei based one stop Service Provider for Ultrafast Broadband services. We offer a full range of telecom-munication solutions including Broadband, Digital phone services that supports Faxing & Alarm monitoring, a feature rich, business grade Cloud PABX platform and extremely competitive Toll Calling rates. Our diverse range of broadband plans allows you to se-lect an option that suits your budget, speed, data and telecommunications requirements without compromising on reliability or quality, all in one tidy package.Ultracomisproudtobelocal.Ouroffice,call centre & technicians are based here in Whangarei making us very contactable and accessible so you can say goodbye to prolonged periods of being “put on hold” while waiting to speak to someone from your phone company.We employ locals, and we use and value the services of other local Whangarei businesses all of which helps to keep Northland’s economy buoyant, providing a secure future for the region and people who live,workandplayhere.Iffibreisnot available to your address, we also provide ADSL / VDSL & if necessary, wireless solutions to get you connected.

Northpower 28 Mount Pleasant Roadwww.northpower.com

09 430 1803

UltraCom www.ultracom.co.nz

09 430 0355

Uber

53 Port Road www.uber.co.nz

09 438 5472

Technology

101

Morgan Engineering Ltdhas been appointed theNorthland Agent for NewZealand Power Tarps.

Tarping Solutions forTippers

Custom made tarpsystems to suit yourtruck and trailer

•

•

Hand operated andelectric systems

Only the best qualitymaterials used in a rangeof colours

•

•

Full installation service

12 months warranty

•

•

Showcasing excellence andinnovation within the transport

manufacture sector

3 Dyer Street, Whangarei | Ph 09 4381822 | Fax 09 4381872www.morganengineering.co.nz

Trucking

Bikes Lawn mowersCopperStoves MicrowavesTrampolines Stainless Steel Barbecues Plastic coated wireLight fi ttings Steel Drums Mesh Trucks Any Machinery

All White ware Oil heaters Household appliances Power tools Steel racking Motors All car panels Brass Fridges Heaters Aluminium Steel furniture Engines

Stainless sinks Car batteries Alloy cans Cars Forklifts Roofi ng iron Steel guttering Gas bottles valves removed Radiators Hot water cylinders Fences No wood

WE TAKE ALL METALS INCLUDING:

4 Hiko Road, Kamo, Whangarei 0112Off Pipiwai Road (Behind substation) Kamo.Phone 09 435 2488 | Fax 09 435 2349

Mobile 027 493 2122 [email protected]

CLEAN UP YOUR HOUSE AND GARAGE ANDGET PAID FOR YOUR SCRAP METAL.

102 Trucking

9014108AA

THETOTAL APPROACHTOTRAFFIC SOLUTIONSIntegrated Traffic Solutions use the latest technology to aid and improvesafety and efficiency across the roading network. We are New Zealand’slargest provider of traffic services and a recognised industry leader.

We’re shaping the future of the industry by offering full service trafficsolutions, providing road users with the information they need to reach theirdestinations safely and with minimal disruption to their journey time.

Our expertise and experience ensure that we deliver optimal solutions toyour road safety and travel demand requirements.

INTEGRATEDTRAFFIC SOLUTIONS

Leading the way

ITS

(09) 470 [email protected] www.safe4u.co.nzCnr Port Road & Fertislier Rd,Whangarei

Cummins 09 438 8892

Integrated Traffic SolutionsPort Road and Fertislier Road www.safe4u.co.nz

09 470 4015

Kamo Scrap MetalPort Road and Fertislier Road [email protected]

09 435 2488

Morgan Engineering3 Dyer Street www.morganengineering.co.nz

09 438 1822

Toll 0508 516171www.southpacific.cummins.com

CUMMINS BRANCHES

Auckland 09 277 1000Whangarei 09 438 8892Bay Of Plenty 07 345 6699Palmerston North 06 356 2209

Every Location.

Cummins New Zealand.Proudly Supporting Road Transportin New Zealand with:

Cummins Service NetworkCummins Genuine PartsReCon ComponentsReCon EnginesFiltrationCoolantLubricants

SUPPORTED BY A NATIONWIDE DEALER NETWORK

24 hours a day call...

&TRANSPORT20122012 10

Fatal accidents involving trucks are a third of what theywere 10 years ago. The trucking industry wants to bringthose figures down even further. Having more stringentdrug tests may well help do this.

TRUCKING INDUSTRYBACKS CALLS FORROADSIDE DRUG TESTING

TRUCKING OPERATORSare right behind the AutomobileAssociation’s call for saliva-basedroadside drug testing following therelease of aMasseyUniversitystudy establishing the high

prevalence of drugged drivers, says theRoad Transport ForumChief ExecutiveOfficer, KenShirley.

‘‘Drug-affected drivers have been themajorconcern for the road freight industry for a longtime now. Back in 2004 the Forum’s AnnualConference called for random roadside drugtesting. TheGovernment responded andbrought in checks using physical tests butonly on drivers suspected of being under theinfluence. This study shows theGovernmentneeds to go further.’’

Mr Shirley says that fortunately there is

very little drug or alcohol use amongcommercial truck drivers. Commercial VehicleInvestigationUnit statistics show that drugsand alcohol are a factor in just 1%of heavyvehicle accidents. ‘‘The responsible operatorswhomake upmost of the road freight industryhave drug and alcohol policies, includingrandom testing, in their employmentcontracts.’’

Around 70%of all fatal accidents involvinga truck and another vehicle are caused by theother vehicle, Mr Shirley says. ‘‘It maywellbe that a number of the drivers of the othervehicles were under the influence of drugs.Fatal accidents involving trucks are a thirdof what theywere 10 years ago. The truckingindustry wants to bring those figures downeven further. Havingmore stringent drugtestsmaywell help do this.’’

103Trucking

Providing professional support to those who

choose to make a living in the transport industry.

0800 686 [email protected] www.natroad.co.nz

88 years later and driving stronger than everNormans Bus & Coach is excited to offer a range of tailor-made options designed with the corporate team building event and festivities

market in mind.

With their large fleet of vehicles and ex-tensive knowledge of spectacular locations and events, planning your corporate event and end of year fes-tivities has never been easier.

Relax and let Normans take the wheel!

Corporate functions, Festive celebrationsVineyard tours to private catered functionsContact Pete, Nikki and the team today to discuss your needs;or visit their website at www.normansbuses.co.nz for inspiration

Call us now (09) 435 4532CONTACT US: 18 Springs Flat RoadKamo, Whangarei, NZ Email:[email protected]

Contact: Pete, Nikki and the team today to discuss your idea today!

Smith and Davies 34 Te Waiti Place

09 438 2836

Normans Bus & Coach18 Springs Flat Road, Kamo [email protected]

09 435 4532

National Road [email protected] www.natroad.co.nz

0800 686 777

Pete’s Towing12 Hewlett Street

0800 738 372

Trucking

104

Northland’s future rides on trucksNorthland, like the rest of New Zealand, depends on the road freight industry to keep its economy moving. It’s especially important for the farming, forestry, horticulture and fishing industries which col-lectively are second only to manufacturing in generating jobs and incomes in the region. Nationally over 90% of all freight by weight is carried on trucks, but with its long narrow peninsula and limited rail network Northland is even more dependent on heavy vehicles than many other parts of New Zealand.The road freight industry is an important contributor to Northland’s prosperity in its own right too. According to Statistics New Zealand there are around 230 trucking businesses directly employing over 900 people in Northland. On top of that a significant number depend on the industry for all or part of their livelihoods including vehicle servicing, provision of essentials such as tyres, fuel and oil and other services like accounting and legal advice. Like many other Northland industries, road freight is made up mainly of small family-owned operations, many being owner drivers or with around five to 10 people. For smaller communities these companies can be a significant provider of local jobs as well as an essential lifeline to the rest of Northland.For all their importance to the region, commercial heavy trucks make up a surprisingly small proportion of the total number of vehi-cles on Northland’s roads. The latest available official information says that there were around 21,000 trucks out of a total of 133,500 vehicles registered in the Whangarei district in 2013. This number covers trucks of all sizes from the smaller ones used for round town and local area deliveries up to the larger rigs like fuel tankers and the curtainsiders and container vehicles used to supply supermar-kets, shops, factories as well as logging trucks, stock transporters and chiller unit for perishable goods. Most of the trucks in Northland aren’t involved in commercial road freight. Instead they are owned and operated by contractors, councils, farmers, manufacturers and a host of other businesses whose primary purposes aren’t to move freight. In reality probably fewer than 1,500 trucks of the total num-ber of trucks belong to commercial operators on Northland roads, less than 1% of the total Northland fleet.While they may be relatively few in number, trucks in Northland move more freight than those in most other regions in New Zealand. The famous “Golden Triangle” of Auckland, Waikato and the Bay of Plenty and then Canterbury are predicted to have the greatest road freight growth over the next 30 years. But Northland is predicted to be next biggest increaseThis anticipated growth makes the current state of Northland’s roading network even more concerning. Generally Northland is poorly served by its transport network, both road and rail, compared to many other parts of New Zealand. More than half its roading network is unsealed and state highways, with their higher Govern-ment funding, make up just 750 out of a total of 6,600 kilometres of roading. It also has a high ratio of road length kilometres per head of population compared to the national figure and conflicting demands on road infrastructure mainly from forestry and dairy freight and tourism. Add in difficult topography, challenging geography, high rainfall and unsuitable detours in the event of road closures and Northland has real problems.National Road Carriers supports the Northland Regional Council’s proposal that Mangakahia Road should become part of the State Highway network. We are also strongly in favour of the Puhoi to Whangarei as a Road of National Significance improving the link from Northland to Auckland and the rest of New Zealand.

There’s been a number of heavy vehicle accidents in the region recently, but these aren’t necessarily a sign heavy vehicles are less safe. Accidents can often come in clusters, so it’s important to look at the trend over time. This shows that heavy vehicles are not a major contributor to fatal and serious injury accidents in the region. According to New Zealand Transport Agency data heavy vehicles were involved in just 4% of such accidents between 2009 and 2013, about the same as the national average for heavy vehicles. There’s one other major issue concerning the local road freight industry. Like those in the rest of New Zealand, Northland trucking companies struggle to find suitable drivers, despite unacceptably high unemployment in the region. The biggest rigs can cost up to half a million dollars, so it’s essential that the people who drive them have the skills and knowledge to drive them professionally and safely. National Road Carriers along with Northland companies, NorthTec and members of the Northland Freight Group are work-ing together to promote the transport industry as a career. One good outcome of the driver shortage is that the industry now offers competitive wages and allowances. It’s not just about truck driving though. There’s a wide range of opportunities within the industry from warehousing to managerial roles.Trucks are an essential part of Northland’s future. Without them, export goods wouldn’t get to wharves and airports and supermarket shelves would be empty, petrol stations out of fuel and hospitals would run out of drugs and supplies. The future of Northland is rid-ing on a truck.

www.natroad.co.nz

24 HOUR 7 DAYCALL OUT SERVICE

Servicing Northland for over 25 years

Supporting Stay Alive Don’t Drink Don’t Drive CampaignWe are here when you need us

0800 PETES 4U 0800 738 37412 Hewlett St Phone 438 7277

PETE’STOWING

From Break Downs to AccidentsIf the unthinkable happens to you, WE CAN HELP.

Call our FREE phone

Supporting “Safety On Our Roads” CampaignWe are here when you need us12 Hewlett St

0800 Petes 24-7 or 0800 738 372

Trucking

105Trucking

106

www.absolutecaterers.co.nzor call 09 470 2595

Located in the Toll StadiumOkara Drive, Whangarei

• BUFFETS / PLATED • FINGER FOOD• WEDDINGS • MORNING TEA• BIRTHDAYS • COCKTAIL• BREAKFASTS • CORPORATE• LUNCH • MOBILE• DINNER CATERING

Weddings

Absolute Catererswww.absolutecaterers.co.nz

09 470 2595

Allure Weddings and Party Hire140 Lower Dent Street www.allureweddings.co.nz

09 556 0578

107

There’s nothing like live musicFor a Band with years of experience, guaranteed to entertain you at your next event, don’t hesitate to call Kurfew.

e: [email protected]: 0800kurfew

www.kurfew.co.nz

Made in the USA from quality fabrics.

3/485 Kamo Road09 435 1833

Find us on FacebookLittle Sweethearts Whangarei

Little Sweethearts are importers of girls special occasion gowns, baptism dresses

& christening gowns.

Weddings

Little Sweethearts3/485 Kamo Road

09 435 1833

Toll [email protected] www.venuesandeventswhangarei.co.nz

09 430 4833

Cowleys Hire Centres133 Kioreroa Road www.cowleyshire.co.nz

09 437 2586

Kurfew www.kurfew.co.nz

0800 kurfew

108

The clubhouse is licensed for 350 people with full bar and catering service available. We are the perfect setting for weddings, birthdays and work socials.

09 437 0775Denby Crescent, Tikipunga, Whangareiwww.whangareigolfclub.co.nz email: [email protected]

Whangarei Golf Club(Inc)

BUFFET STYLE up to 240 guestsCOCKTAIL STYLE up to 350 guestsFREE VENUE HIREAGE conditions apply

Whangarei’s best kept secr

et

Whangarei Golf ClubDenby Crescentwww.whangareigolfclub.co.nz

09 437 0775

Barge Showgroundswww.bargeshowgrounds.co.nz

09 438 3109

Cheers Wedding and Party Hire38 Nell Place www.cheerspartyhire.co.nz

09 437 1018

Personalised Planning and Venue setup.

[email protected] I www.cheerspartyhire.co.nz

Providing you with top quality hire products at affordable prices

See our extensive range of quality items at 3B Nell Place I 09 437 1018Mob: 021 172 3785

Weddings

110

ASB Leisure Centre

www.sportnorthland.co.nz

09 437 9232

Barge Showgrounds

[email protected] www.bargeshowgrounds.co.nz

09 438 3109

Venues and Events www.venuesandeventswhangarei.co.nz

Venues and Events

112 Dining Guide

Mad4Pizza241 Kamo Roadwww.mad4pizza.co.nz

09 459 5913

Stumpy’s Takeaways121 Riverside Drive

09 438 1775

Parua Bay Tavernwww.paruabaytavern.co.nz

09 436 5856

Shiraz58 Walton Street571 Kamo Road

09 438 3112

09 435 5222

Monday - Tuesday 4pm - 10pmWednesday - Sunday 11am - 10pm

[email protected]

241Kamo Road 09 459 5913

113Dining Guide

Tonic239 Kamo Road

09 438 6978

Shotgun Bettys37 Vine Street

09 459 7461

Madly Indian1 The Centre, Waipu www.madlyindian.co.nz

09 432 0103

Cafe NarniaCnr Kamo Road and Mains Ave

09 437 7511

Wildside Bar & GrillVine Street

09 438 6978

Fat Camel Cafe12 Quality Street

09 438 0831

1 The Centre, Waipu I 09 432 0103www.madlyindian.co.nz

Very Indian, Very Authentic

114

Fresh - Tasty - Healthy

Fully Licensed - Open 7 Days - 9am to 9pm

12 Quality StWhangarei CBD(Walk through from Camerson or Vine Streets)

Ph 438 0831

The Fat Camel is modelled after a typical Tel -Aviv Café, where the café is the centre of social life. Where the builder meets the banker, where people can relax, come in flip flops or a suit and feel comfortable. Back home you can see kids finishing homework in the café, people playing games of Chess or Backgammon. A place to drop in and have Chess or Backgammon. A place to drop in and have a quick bite before the movies or a more leisurely meal shared with good friends over a glass of wine, where you are remembered and can find good conversation.We want to give that same sense of intimacy and atmosphere to Whangarei – a place that you can always come and feel welcome at any time.always come and feel welcome at any time.

Falafel Pita - A Vegetarian OptionThe Israeli sandwhich, Spiced Chickpea patties deep fried and served in the traditional manner in a pita pocket with Salads and Humus then topped with our Amba & Tahinah sauces.$8.80$8.80

Lamb Shishlik PitaQuality Nz Lamb diced, spiced and grilled in atraditional manner. Served with salads and Humus in a Pita Pocket and topped with our Tahinah and Amba sauces.$9.80

Chicken Shawarma PlateDiced Chicken tenderlions grilled in traditional spices and served on a bed of fragrant rice with all of our delicious salads and humus. Accompanied with sauces. $19.80

Shakshuka If you haven’t tried Shakshuka you haven’t tried Israeli food. This is an iconic dish of eggs poached in a tasty capsicum and tomato sauce. Served with pita. Also available with a locally made Beef Salami or Feta Cheese. $13.00 - $16.50$13.00 - $16.50

A Sample From Our Menu

Israeli Food - Dine In or Take-Away

Best Coffee In Town

Fat Camel Cafe

Colouring Competition2015

Colour in the Northland Taniwha so that it looks like the one on the right hand side and stand the chance to win a kids Northland Rugby jersey.

Name: ________________________________________Surname: _____________________________________Telephone Number:____________________________Age:___________________________________________

..to look like this one!

Colour this one....

HOW TO ENTER:Post your completed entry to: 223 Hayward Road, Maungakaramea RD 8, 0178 OR Drop it into the entry box in the Strand Shopping Centre Food Court. Entry box is next to The Business Finder Magazine Stand.

Competition closes1 July 2015Winner will be announced: 15 July 2015

TheR

You could stand the change to win a kids

Northland Rugby jersey!

Any questions please email [email protected]

OR call 021 025 90743Terms and conditions apply.

115

Fresh - Tasty - Healthy

Fully Licensed - Open 7 Days - 9am to 9pm

12 Quality StWhangarei CBD(Walk through from Camerson or Vine Streets)

Ph 438 0831

The Fat Camel is modelled after a typical Tel -Aviv Café, where the café is the centre of social life. Where the builder meets the banker, where people can relax, come in flip flops or a suit and feel comfortable. Back home you can see kids finishing homework in the café, people playing games of Chess or Backgammon. A place to drop in and have Chess or Backgammon. A place to drop in and have a quick bite before the movies or a more leisurely meal shared with good friends over a glass of wine, where you are remembered and can find good conversation.We want to give that same sense of intimacy and atmosphere to Whangarei – a place that you can always come and feel welcome at any time.always come and feel welcome at any time.

Falafel Pita - A Vegetarian OptionThe Israeli sandwhich, Spiced Chickpea patties deep fried and served in the traditional manner in a pita pocket with Salads and Humus then topped with our Amba & Tahinah sauces.$8.80$8.80

Lamb Shishlik PitaQuality Nz Lamb diced, spiced and grilled in atraditional manner. Served with salads and Humus in a Pita Pocket and topped with our Tahinah and Amba sauces.$9.80

Chicken Shawarma PlateDiced Chicken tenderlions grilled in traditional spices and served on a bed of fragrant rice with all of our delicious salads and humus. Accompanied with sauces. $19.80

Shakshuka If you haven’t tried Shakshuka you haven’t tried Israeli food. This is an iconic dish of eggs poached in a tasty capsicum and tomato sauce. Served with pita. Also available with a locally made Beef Salami or Feta Cheese. $13.00 - $16.50$13.00 - $16.50

A Sample From Our Menu

Israeli Food - Dine In or Take-Away

Best Coffee In Town

Fat Camel Cafe

116


Competition 2015 The

R

Answers can be found on Page 3 of this magazine.

The Business Finder aims to promote Whangarei District businesses using combined media solutions in the form of three different mediums:

Fill in the three missing words and stand the chance to win season tickets to games at Toll Stadium.

Name: ________________________________________

Surname: _____________________________________

Telephone Number:____________________________



An annual, glossy, perfect bound ………........................……..

…………................ signage

and by featuring business listings on our website www.….............……………..co.nz

1

2

3


116

117


Competition 2015 The

R

Answers can be found on Page 3 of this magazine.

The Business Finder aims to promote Whangarei District businesses using combined media solutions in the form of three different mediums:

Fill in the three missing words and stand the chance to win season tickets to games at Toll Stadium.

Name: ________________________________________

Surname: _____________________________________

Telephone Number:____________________________



An annual, glossy, perfect bound ………........................……..

…………................ signage

and by featuring business listings on our website www.….............……………..co.nz

1

2

3


recyclingGUIDE

Tetrapak cartons & food wrappings

Window glass, light bulbs, crystal, ceramics/pottery, drinking glasses, mirrors & broken glass

Containers used for engine oil, fuel, solvents, paints, poisons etc.

Containers over 5 litres

Plastic bags

What CAN I put in my recycle bin?ONLY these items go in your recycling bin:

What CAN’T I put in my recycle bin?The following items are NOT recyclable and belong in your rubbish bag

GlassWhole glass bottles and jars onlyRinse and remove lids

MetalDrink cans, food cans, clean aluminium

foil platers and empty aerosol containers. Rinse and squash

empty tins.

PlasticOnly plastics numbered 1&2 from your kitchen, bathroom and laundryRinse, squeeze flat and replace lids to prevent litter

Paper & CardboardNewspapers, magazines, junk mail,

envelopes, flattened cardboard boxes, shoe boxes, cartons, old phone books

Make sure card is folded so it is smaller than your recycle bin. All paper and card

should be flattened and placed beside your recycle bin.

You can tie it in a bundle, or put it either in a plastic bag

or a cardboard box which is taped shut.

118

FROM FIRST AVE

BUTTERFA

CTOR

Y LANE

VINERY LANE

DENT ST

SEAVIEW RD

GREY ST

HATE

A DR

V

EWIN

G RD

VALE RD

DUND

AS R

D

NORF

OLK

ST

HUNT

ST

RUST AVE

SELWYN AVE

FIFTH AVE

CENTRAL AVETHIRD AVE

SECOND

AVE

KAUIKA ST

FIRST AVE W

ATER

ST

WALTON ST

ROSE ST

ALBERT ST

RAILWAY RD

TARE

WA

RD

TARE

WA

RD

SH1 WESTERN HILL

S DRIVE

POROWINI AVE

MORNINGSIDE RD

ANZA

C RD

POTO ST

MAUNU RD

VINE ST

BANK

ST

BANK

ST

JAMES STROBERT ST

RATHBONE ST

JOHN ST

CAMERON ST

CLYDE ST

HANNAH ST

CARRUTH ST

ROBERT ST

HEREKINO ST

PORT RDCOMMERCE ST

WOO

DS R

D

OKAR

A DR

V

REYBURN STLOWER DENT ST

REYBURN HOUSE LANE

QUAYSIDE WAY

FINLA

YSON ST

DENT ST

WALTON ST

WALTON ST

LOVERS LANE

RIVERSIDE DRVALEXAN

DER

ST

HateaRiverTo Bay of Islands

To Whangarei Hospital

Information

Public Toilet Facilities

Bus Terminal

Whangarei Central Library

Forum North Performance &Conference Centre

Whangarei District Council

Youth Space

Cameron St Mall

Police Station

Town Basin

Whangarei Aquatic Centre

Toll Stadium

5

5

4

4

3

3

2

2

1

1

6

6 8

8

7

7

9

9

LOWER HATEA RIVER CROSSING

WHANGAREI CITY CENTRE

KEY

SH

1

Whangarei City Centre

Maunu area

Maunu Reserve &Barge Showgrounds

Bird Recovery Centre

Kiwi North Museum,Kiwi House and

Heritage Park

Maunu PrimarySchool

Pompallier CatholicCollege

Kowhai Park

Maunu Scenic Reserve

Puriri ParkReserve

Maunuhui Reserve

KereruCottage

Hora HoraPrimary School

Tarewa Park

AnzacPark

Whangarei Hospital

Raumanga ValleyReserve

Murdoch CresReserve

Maunu Children’s Health Camp

Western HillsQuarry

MAUNU RD

MAUNU RD

MAUNU RD

WES

TERN

HIL

LS D

RIVE

OTAI

KA R

D

PUKENUI RD

TUI CRES

PURIRI PARK RD

CLARKSON CRES

HERO

N PL

NGAHERE DR

SILVERSTREAM RD

HOSPITAL RD

RAUMANGA VALLEY RD

MURDOCH CRES

COLLINGWOOD ST

COLL

INGW

OOD ST

TAREWA RD

NORTH STKAUIKA RD

FIRST AVESECOND AVETHIRD AVE

FOURTH AVE

KIRIKIRI RD

KEA PL

WESTW

OOD LN

TE MAI RD

MEL

ODY

LNPOMPALIER ESTATE DR

TowardsDargaville

TowardsAuckland

WHANGAREI

SH

1

SH1

SH 14

Maps

119

Kensington area

Kamo area

Tikipunga area

Onerahi area

HERETAUNGA ST

MEADOW PARK CRES

OTUHIWAI CRES

PARAMOUNT PARADE

WINSTON STHAW

EA PL

REED ST

VINE

GAR

HILL

RD

THOMAS ST

STEE

RE P

L

BALMORAL RD

TOWNSEND PL

CORKS RD

KIRIPAKA RDNGUNGURU RD

KIRIPAKA RD

BOUN

DARY

RD

REREWAI PL

GARDEN PL

TAPPER CRES

KIRIPAKA RD

DENBY CRES

SPEDDING RD

TANIA PL

WESSEX ST

JEEVES PL

PALM DRIVE

Tikipunga Park

Beazley Park

Whangarei Scenic Reserve

Whangarei Falls

Yha WhangareiFalls Backpackers

TikipungaHighschool

TikipungaFoodmarket

Trinity UnitingChurch

The Falls Estate Lifestyle Village

TowardsTutukaka

Coast

MIL

L R

DKENSINGTON AVE

KAMO RD

KAMO RD M

ILL

RD

BANK

ST

SH

ORANGA RD

HATEA DRIVE

PARK AVE

ISLINGTON STHENRY ST

DAVIES ST

WRACK ST

DINNISS AVE

CONTINENTAL

NIXON

WALLACE ST DEVERON ST

SHORTLAND STDONALD ST

NEIL

ST

LUPTON AVE

MERCER ST

MAIR ST

PRIN

CESS

ST

HARO

NUI S

T

Nixon StreetReserve

MANSE ST

Whangarei GirlsHigh School

Whangarei PrimarySchool

Chelsea HouseBed & Breakfast

1

ONERAHI RD

COMMINS RD

OLD ONERAHI RD

CART

WRI

GHT R

D

TAIN

UI S

T

HINEMOA ST

RAUMATI CRES

WAVERLEY ST

GOODWIN ST

Flames International

Hotel

Onerahi Tavern

Onerahi TownPost Shop

One

rahi

Sh

ops

Onerahi PrimarySchool

TowardsWhangarei Heads

TowardsWhangarei CBD

TowardsWhangareiCity Airport

KAMO RD

KAMO RD

GILLINGHAM RD

EDEN TCE

CHARLES ST

LEWIS ST

OGLE

CRE

S

PURIRI ST

MCI

NNES

AVE

MELDRUM ST

LILIAN ST

BOSWELL ST

GRANT ST

WAKELIN ST

CLARK RD

CAMBRIDGE ST

FAIRWAY DRIVE

BRAINTREE ST

CLARK RD

GRIFFIN ST

HAILES RD

SIERRA AVE

CARR ST

MAGNOLIA AVE

LINCOLN PL

CARLTON CRESWINDSOR AVE

FISHER TCE

HOEY ST

ORARI PL

ASCOT AVE

RIDGEWAY DRIVERIDGEWAY DRIVE

COLE

NSO

ST

LOCHIEL

PLBALM

ACEW

AN D

RIVE

PEBBLE BEACH BOULEVARD

TowardsWhangarei

CBD

THREE MILE BUSH RD

CORKS RD

STATION RD EAST

KAMO BYPASS

Kamo High School

Station Road

Reserve

Kamo PrimarySchool

Kamo MotelPalomino

Rocking HorsesKamo

Intermediate

Greengingers

Parahaki Rest Home

Mcdonald’s

Asb Bank

TowardsCape Reinga

FARMER ST

Maps

Telephone Directory120

A1 Auto Wreckers 09 438 9164Absolute Caterers 09 470 2595Adams Trimmer 09 470 2244Advance Training Centre 09 438 2825Advantage Mint Accountants 09 434 6617Adventure Forest 09 459 4485AE Fun Park 09 432 3534African Safari Experience 09 404 0225AMT 09 438 9750Anytime Fitness 09 438 8863All about Tyres 09 435 4545All Marine 09 438 4499Alloy Stainless and Marine 09 438 0252Allure Weddings and Party Hire 09 556 0578Alpha Cuts 09 435 1833Alpha Kids 09 435 1883Alzheimers Northland 09 438 7771A&P Society 09 438 3109Apparel Master 0800 808 820Armourguard 09 438 1639ASB Leisure Centre 09 437 9232Atlas Cranes 09 438 0990

Back2Nature Childcare 09 435 3672Barfoot & Thompson 09 438 1322BBS Timber 09 438 9358Bella Homes 09 438 6399Bin Inn 09 430 0588BJs Childcare Services 0800 459 1778Brewers World 09 438 0988Bright Stars Early Education Centre 09 459 4255

Cairnfield Retirement Home and Hospital 09 437 0186CDL 09 430 2323Cervus Equipment 09 438 7228CEW 09 435 0889Charlotte Dawn 09 435 6597Cheers Party Hire 09 437 1018Civil Defence 09 430 4200Cleanscape 09 972 7625Club Auto 0800 506 506Cocurullo's 09 438 8834Combs 'n' Co 09 436 0727Cowleys Hire Centres 09 437 2586Cummins 09 438 8892

DB Interiors 09 435 0057Deco Glass 022 608 3528District Health Board 09 470 0000Discovery Life Insurance 09 963 6291Dive HQ 09 438 1075DownTown Tools 09 430 0833

Elim Christian Early Learning Centre 09 430 3050Engraving Systems 09 438 1744Essential Insurance 0272 455 133Eye Centre 0800 110030

Fairview Window Creations 0800 386 6784FatCamel 09 438 0831Fencing Services 09 438 9330FireCo 0275 437 106First National Real Estate 09 438 8667Fledgling Photography 09 459 1688Forum North 09 430 4200Frankensignz 09 973 7483Frings 09 438 4664Fulton Hogan 09 470 0700

Garnet Motor services 09 438 7209Gasworks and Plumbing 09 438 0196Gentle Dental 09 430 0046GJ Gardner 09 437 5666

HB Architecture 09 438 9545Huddleston Hypnotheraphy 09 438 5367

IDEAL Buildings 09 438 8844Investment Solutions Northland 0800 66 66 78Integrated Traffic Solutions 09 470 4015I-Rentals 09 945 4955

JJ Automotive 09 438 2095Jonzone 09 458 2905

Kamo Canvas 09 435 6117Kamo Disability Services 09 435 6953Kamo Display and Sell 09 435 0079Kamo Marine Centre 09 437 1090Kamo Outboards 09 435 1038Kamo Panel & Paint 09 435 1950Kamo Pet & Aquatic 09 435 3736Kamo Scrap Metal 09 435 2488Kamo Village Florist 09 435 1115Keith Hay Homes 09 435 1511Kingdom Kidz 09 459 5552Koru Kids PreSchool 09 430 8804Kurfew 0800 kurfew

Latitude Homes 09 430 3065Little Sweethearts 09 435 1833

A E

F

G

H

J

K

L

I

B

C

D

2Telephone Directory 121

Mad4Pizza 09 459 5913Madly Indian 09 432 0103Magic Tyres 09 438 3534Mathews Perry Law 09 437 3070Melville's Home Centre 09 438 7022Microcraft 09 438 6065Minda Ross (Barfoot &Thompson) 09 438 1322Mitre 10 09 430 4009Moana Futures 09 945 4505Moody's Accountants Whangarei 09 438 6969Moody's Accountants Waipu 09 432 8486Morgan Engineering 09 438 1822Morris & Morris Funerals 09 437 5799

National Road Carriers 0800 686 777Need a Nerd 0800 633 326Normans Bus and Coach 09 435 4532Northern Districts Security 09 430 3232Northern Forklifts 09 438 8047Northern Radiology 09 437 0540Northland Business Systems 09 972 7296Northland Schoolwear 09 435 2576Northland Rugby Union 09 438 4743Northland School Wear 09 435 2576Northland Specialty Glass 09 945 4794NorthPine 09 432 1155Northpower 0800 667 847NorthTec 0800 162 100Norwood 09 438 4719NZ Fire Service 111

Obsidian Vehicle Glass Specialists 027 733 2779

Pacific Homes 09 430 0162Para Rubber 09 437 7710Parahaki Court Rest Home 09 437 3311Pauline Dinsdale 09 435 6575Persona Spa 09 430 7377Penguin Direct 09 438 0230Pete’s Towing 09 438 7277Pet Essentials 09 438 8835Planet Honda 09 438 9780Plumbers & Gasfitters 09 438 0192Power sports 09 437 5451Puriri Court Rest Home and Hospital 09 437 9302Pryme design 022 063 8799

Rachel Moss 09 459 1739Rasheed's Asian Groceries 09 438 4683Regent Dry cleaners 09 438 0563Regent Training Centre 09 430 3240Rent-A-Cheepy 09 438 7373Rob Little John Builders 09 430 0851Robinson Memorials 09 438 3201

Seedlings Homebase Childcare 09 556 1275Shaw Motorcycles 09 438 1183Shotgun Betty's 09 459 7461Smith & Davies 021 346 6791Speedy Signs 09 430 3460Splash Signs & Print 09 438 2102Stanley Marine 09 438 4479Steve Bowling Contractors 09 435 2119Stumpys Takeaways 09 438 1775Sugar Rush 09 438 7948Syndicate Signs 09 459 7417

TDDA 09 09 438 4103Te Wananga o Aotearoa 0800 355 553Ten Pin Bowling 09 438 1028Thinkwater 0800 1 thinkwaterTikipunga Wholesale Meats 09 437 0843The Business Finder 021 025 90743The Property Wizard 09 430 8672Toll 0508 51 61 71Toll Stadium 09 470 2599Tonic Restaurant 09 437 5558Toyota 09 430 4360

Uber 09 438 5472Ullrich aluminium 09 438 7380UltraCom 09 430 0344

Valid Automotive 09 430 7579Venues & Events Whangarei Vince Cocurullo 09 438 8834Virgin Concrete 09 435 5044

Warren Hay Marine 09 430 2666Waste Management 09 438 5585Water Street Motors 09 438 1197WES Electrical 09 470 0220Wild by Nature 021 083 44253Whangarei Airport 09 436 0047Whangarei Automotive 09 438 3700Whangarei Drycleaners 09 438 2121Whangarei Golf Club 09 437 0775Whangarei Pet & Aquatic 09 438 1627Whangarei Suit Hire 09 438 8135Whangarei Testing Station (Kamo) 09 435 3682Whangarei Testing Station (Whangarei) 09 438 8125Wildside Bar & Grill 09 438 6978

M S

T

U

V

W

N

O

P

R

122

2015January

S M T W T F S1 2 3

4 5 6 7 8 9 1011 12 13 14 15 16 1718 19 20 21 22 23 2425 26 27 28 29 30 31

FebruaryS M T W T F S1 2 3 4 5 6 78 9 10 11 12 13 1415 16 17 18 19 20 2122 23 24 25 26 27 28

1 2 3 4 5 6 78 9 10 11 12 13 1415 16 17 18 19 20 2122 23 24 25 26 27 2829 30 31

MarchM T W T F SS

AprilS M T W T F S

1 2 3 45 6 7 8 9 10 1112 13 14 15 16 17 1819 20 21 22 23 24 2526 27 28 29 30

MayS M T W T F S

1 23 4 5 6 7 8 910 11 12 13 14 15 1617 18 19 20 21 22 2324 25 26 27 28 29 3031

JuneM T W T F SS1 2 3 4 5 6

7 8 9 10 11 12 1314 15 16 17 18 19 2021 22 23 24 25 26 2728 29 30

AugustS M T W T F S

12 3 4 5 6 7 89 10 11 12 13 14 1516 17 18 19 20 21 2223 24 25 26 27 28 2930 31

JulyS M T W T F S

1 2 3 45 6 7 8 9 10 1112 13 14 15 16 17 1819 20 21 22 23 24 2526 27 28 29 30 31

SeptemberM T W T F SS

1 2 3 4 56 7 8 9 10 11 1213 14 15 16 17 18 1920 21 22 23 24 25 2627 28 29 30

OctoberS M T W T F S

1 2 34 5 6 7 8 9 1011 12 13 14 15 16 1718 19 20 21 22 23 2425 26 27 28 29 30 31

NovemberS M T W T F S1 2 3 4 5 6 78 9 10 11 12 13 1415 16 17 18 19 20 2122 23 24 25 26 27 2829 30

DecemberM T W T F SS

1 2 3 4 56 7 8 9 10 11 1213 14 15 16 17 18 1920 21 22 23 24 25 2627 28 29 30 31

2015

New Years Day Thursday 1 January Day after New Years Day Friday 2 JanuaryAnniversary Day Auckland/Northland Monday 26 January Waitangi Day Friday 6 FebruaryGood Friday Friday 3 AprilEaster Monday Monday 6 April

ANZAC Day Monday 27 AprilQueen's Birthday Monday 1 JuneLabour Day Monday 26 OctoberChristmas Day Friday 25 DecemberBoxing Day Saturday 26 December Monday 28 December (Observed)

Public Holidays (Northland)

123

2015January

S M T W T F S1 2 3

4 5 6 7 8 9 1011 12 13 14 15 16 1718 19 20 21 22 23 2425 26 27 28 29 30 31

FebruaryS M T W T F S1 2 3 4 5 6 78 9 10 11 12 13 1415 16 17 18 19 20 2122 23 24 25 26 27 28

1 2 3 4 5 6 78 9 10 11 12 13 1415 16 17 18 19 20 2122 23 24 25 26 27 2829 30 31

MarchM T W T F SS

AprilS M T W T F S

1 2 3 45 6 7 8 9 10 1112 13 14 15 16 17 1819 20 21 22 23 24 2526 27 28 29 30

MayS M T W T F S

1 23 4 5 6 7 8 910 11 12 13 14 15 1617 18 19 20 21 22 2324 25 26 27 28 29 3031

JuneM T W T F SS1 2 3 4 5 6

7 8 9 10 11 12 1314 15 16 17 18 19 2021 22 23 24 25 26 2728 29 30

AugustS M T W T F S

12 3 4 5 6 7 89 10 11 12 13 14 1516 17 18 19 20 21 2223 24 25 26 27 28 2930 31

JulyS M T W T F S

1 2 3 45 6 7 8 9 10 1112 13 14 15 16 17 1819 20 21 22 23 24 2526 27 28 29 30 31

SeptemberM T W T F SS

1 2 3 4 56 7 8 9 10 11 1213 14 15 16 17 18 1920 21 22 23 24 25 2627 28 29 30

OctoberS M T W T F S

1 2 34 5 6 7 8 9 1011 12 13 14 15 16 1718 19 20 21 22 23 2425 26 27 28 29 30 31

NovemberS M T W T F S1 2 3 4 5 6 78 9 10 11 12 13 1415 16 17 18 19 20 2122 23 24 25 26 27 2829 30

DecemberM T W T F SS

1 2 3 4 56 7 8 9 10 11 1213 14 15 16 17 18 1920 21 22 23 24 25 2627 28 29 30 31

2015

New Years Day Thursday 1 January Day after New Years Day Friday 2 JanuaryAnniversary Day Auckland/Northland Monday 26 January Waitangi Day Friday 6 FebruaryGood Friday Friday 3 AprilEaster Monday Monday 6 April

ANZAC Day Monday 27 AprilQueen's Birthday Monday 1 JuneLabour Day Monday 26 OctoberChristmas Day Friday 25 DecemberBoxing Day Saturday 26 December Monday 28 December (Observed)

Public Holidays (Northland)

124

The pr imary goal of Harr is Butt Archi tecture is to produce elegant archi tecture that ut i l ises a combinat ion of proven bui lding approaches and the best technological advances avai lable today.

the business finder 2015

Documents