v9 – orientation of tm helices
DESCRIPTION
V9 – orientation of TM helices. Modelling 3D structures of helical TM bundles Park, Staritzbichler, Elsner & Helms, Proteins (2004), Park & Helms, Proteins (2006) Beuming & Weinstein (2004) T. Beming & H. Weinstein (2004) Bioinformatics 20, 1822 Adamian & Liang (2006) - PowerPoint PPT PresentationTRANSCRIPT
![Page 1: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/1.jpg)
Membrane Bioinformatics SS091
V9 – orientation of TM helices
- Modelling 3D structures of helical TM bundlesPark, Staritzbichler, Elsner & Helms, Proteins (2004), Park & Helms, Proteins (2006)
- Beuming & Weinstein (2004)T. Beming & H. Weinstein (2004) Bioinformatics 20, 1822
- Adamian & Liang (2006)L. Adamian & J. Liang (2006) BMC Struct. Biol. 6, 13
- TMX: predict lipid-accessible sides of TM helices from sequencePark & Helms, Bioinformatics (2007), Park, Hayat & Helms, BMC Bioinformatics (2007),
![Page 2: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/2.jpg)
2
Structure modelling for helical membrane proteins>P52202 RHO -- Rhodopsin. MNGTEGPDFYIPFSNKTGVVRSPFEYPQYYLAEPWKYSALAAYMFMLIILGFPINFLTLYVTVQHKKLRSPLNYILLNLAVADLFMVLGGFTTTLYTSMNGYFVFGVTGCYFEGFFATLGGEVALWCLVVLAIERYIVVCKPMSNFRFGENHAIMGVVFTWIMALTCAAPPLVGWSRYIPEGMQCSCGVDYYTLKPEVNNESFVIYMFVVHFAIPLAVIFFCYGRLVCTVKEAAAQQQESATTQKAEKEVTRMVIIMVVSFLICWVPYASVAFYIFSNQGSDFGPVFMTIPAFFAKSSAIYNPVIYIVMNKQFRNCMITT LCCGKNPLGDDETATGSKTETSSVSTSQVSPA
www.gpcr.org
EMBO Reports (2002)
1D
2D
3D
Membrane Bioinformatics SS09
![Page 3: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/3.jpg)
3
Design helical bundles using effective energy functions
Aim: assemble TM bundles
Glycophorin A dimer, Erb/Neu dimer, phospholamban pentamer
Method: scan 6-D conformational space of dimers of ideal helices
Membrane Bioinformatics SS09
![Page 4: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/4.jpg)
4
Example for parametrised
energy function between 2
residues
docking of helix-dimers: energy scoring
search 5 degrees of freedom systematically.
score conformations by residue-residue
energy function.
Park et al. Proteins (2004)Membrane Bioinformatics SS09
![Page 5: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/5.jpg)
5
Test for Glycophorin A, dimer of two identical helices, NMR structure available
docking of helix-dimers
RMSD between best model and NMR
structure only 0.8 Å.
Energy landscape
around the minimum Minimum is truly
global minimum.
Park et al. Proteins (2004)
However, this is not the
case for dimers in
larger TMH proteins.Membrane Bioinformatics SS09
![Page 6: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/6.jpg)
6
Need more/other information to orient helices
Early suggestion: TM proteins are „inside-out“ proteins.
That means that are hydrophobic outside and hydrophilic inside.
compute hydrophobic moment = the direction of largest hydrophobicity
N
iiprojiC rriH
N 1
1
here, rproj(i) is the projection of the side-
chain onto the helical axis, i.e. the vector
difference describes the shortest distance
between residue i and the helix axis.
H(i) is the hydrophobicity of residue i.
This method was introduced by
David Eisenberg (1982, Nature)
Membrane Bioinformatics SS09
![Page 7: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/7.jpg)
7
role of hydrophobic moment
According to the concept of Eisenberg,
all helices would orient their most hydrophobic side towards the bilayer.
However, this measure is quite unprecise (Park & Helms, Biopolymers 2006).
Hydrophobicity scalesww: Wimley-White scaleeis: Eisenberg scaleges: Goldman/Engelman/Steitz scalekd: Kyte-Doolittle scaleSpecialized scaleskP: kProtbw: Beuming & Weinstein scaletmlip1/2: Adamian & Liang
Membrane Bioinformatics SS09
![Page 8: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/8.jpg)
8
Beuming & Weinstein (2004): amino acid propensities
(1) Hydrophobic residues (A, I, L, V)
make up 48.7 % of all residues in TM
proteins
(2) Charged residues (D, E, H, K, R)
constitute only 5.5%
(3) Glycine (G) is relatively abundant
(4) Small residues (A, C, S, T) form
30.6%
(5) Aromatic residues (F,W,Y) represent
15.8%
6 -branched residues (T, I, V) form
24.9%.
(7) Proline is a helix-breaker and is
underrepresented
(8) Also, Cys, Gln, and Asn are rarely
found.
Membrane Bioinformatics SS09
![Page 9: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/9.jpg)
9
amino acid propensities: conclusions
The overall amino acid composition deviates significantly from that of the whole
genome.
Hydrophobic residues (A, F, G, I, L, M, V, W) occur more frequently in MPs than
in the whole genomes.
Conversely, residues C, D, E, K, N, P, Q, R are underrepresented in MPs.
H, S, T, and Y have equal distributions in MPs and whole genomes.
Membrane Bioinformatics SS09
![Page 10: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/10.jpg)
10
Beuming & Weinstein (2004): inside vs. outside
(1) Most of the exposed (lipid facing)
charged residues (D, E, K, H, R) that
are found in TMs are located in the
terminal regions (4.4%) rather than in
the central region (2.7%).
(2) The exposed terminal parts are very
rich in aromatic residues (21.3%)
compard to the central part (16.1%).
Membrane Bioinformatics SS09
![Page 11: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/11.jpg)
11
Beuming & Weinstein (2004): surface propensity scale
Table shows fraction SF of exposed residue i.
Trp has highest value of SF, His has smallest
value.
Normalize SP values with respect to His
(SP=0) and Trp (SP=1).
HISTRP
HISXX SFSF
SFSFSP
Membrane Bioinformatics SS09
![Page 12: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/12.jpg)
12
correlation of SP scale with other scales
Compute correlation coefficient.
SP propensity scale has high
correlation with hydrophobicity or
volume scales.
Combine SP scale with conservation
index:
Alignmentn a
iaiai p
ffCI log
pa : a priori distribution of residues
Membrane Bioinformatics SS09
![Page 13: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/13.jpg)
13
Beuming & Weinstein (2004)
Add propensity score and
conservation score:
total score(i) = SPi + CIi
Accuracy to detect the buried resides
is ca. 70%.
Membrane Bioinformatics SS09
![Page 14: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/14.jpg)
14
Beuming & Weinstein (2004)
(top) correct SASA in X-ray structure
(middle): prediction based on amino-
acid propensity + conservation
BEST!
(bottom): prediction based only on
conservation
Membrane Bioinformatics SS09
![Page 15: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/15.jpg)
15
Adamian & Liang (2006): interacting helices
Example for two interacting TM
helices in succinate dehydrogenase.
Interacting residues follow heptad
motiv.
Note the periodicity of 3.6 residues
per turn in an ideal -helix.
Membrane Bioinformatics SS09
![Page 16: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/16.jpg)
16
Adamian & Liang (2006)
Heptad motifs are generally
preferred for interacting helix pairs.
For left-handed helices, about 94.7%
and 92.4% of interacting residues
can be mapped to heptad repeats for
parallel and anti-parallel helices.
For right-handed pairs the number
are slightly less.
Assume that the residues of lipid-
accessible helices follows a similar
pattern.
Membrane Bioinformatics SS09
![Page 17: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/17.jpg)
17
Adamian & Liang (2006)
Each TM helix has „7 faces“.
A: the anchoring residues are
0, 7, 14, and 21
contacts are also formed by residues
3, 4, 10, 11, 17, 18
Membrane Bioinformatics SS09
![Page 18: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/18.jpg)
18
Adamian & Liang (2006)
Combine lipophilicity score Lf and positional entropy Ef of a helical face by
simply multiplying them.
Membrane Bioinformatics SS09
![Page 19: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/19.jpg)
19
Adamian & Liang (2006): Test fo TRP channel
Membrane Bioinformatics SS09
![Page 20: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/20.jpg)
20
Adamian & Liang (2006): discuss failures
Sometimes, binding sites for individual lipids (e.g. cardiolipin) are formed on the
surfaces of TM proteins. Those residues will also be highly conserved, and the
method will therefore fail.
Membrane Bioinformatics SS09
![Page 21: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/21.jpg)
21
What is needed for true de novo design of helical bundles?
Aim: explore new TM protein topologies.
distance-dependent residue-residue force field
Generate energetically favorable geometries of helix dimers.
Overlap helix dimers full protein structure.
Membrane Bioinformatics SS09
![Page 22: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/22.jpg)
22
Derivation of position scores
(1) For each test protein, 1000 similar sequences
from non-redundant database using BLAST URLAPI.
(2) generate initial multiple sequence alignment (MSA) with ClustalW.
Delete fragments < 80% of length of query sequence.
From these refined MSA, apply 6 different % identity criteria, 6 final MSAs for each test protein.
Pei & Grishin: need to align ≥ 20 sequences to accurately estimate conservation
indices from MSAs.
Membrane Bioinformatics SS09
![Page 23: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/23.jpg)
23
Test: correct orientation (0,0)
has lowest score.
predicting the TM-helix-orientation from sequences
CI: conservation index in MSA
SASA: Solvent accessible surface area,
relative to a single, free helix
fj(i): frequency of amino acid j
in position i.fj : frequency of amino acid j in full alignment.
C : average conservation index (CI): Standard deviation
Positive values: conserved positionsNegative values: variable positions
12
CfifCI
jjji
Assumption:
lipid-exposed positions are
less conserved.
Membrane Bioinformatics SS09
![Page 24: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/24.jpg)
24
Aim: construct structural model for a bundle of ideal transmembrane
helices.
(1) Construct 12 good geometries for every helix pair AB, BC, CD, DE, EF, FG
(2) overlay ABCDEFG
„thin out“ solution space containing ca. 126 models
(a) remove „solutions“ where helices collide with eachother
(b) delete non-compact „solutions“
(3) score remaining 106 solutions by sequence conservation
(4) cluster 500 best solutions in 8 models
(5) rigid-body refinement, select 5 models with best sequence conservation.
Ab initio structure prediction of TM bundles
Membrane Bioinformatics SS09
![Page 25: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/25.jpg)
25
Rigid-body refinement
Membrane Bioinformatics SS09
![Page 26: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/26.jpg)
26
dark: Model
light: X-ray structure
Additional input:
known connectivity of the
helices A-B-C-D-E-F-G.
Otherwise, the search
space would have been
too large.
Compare best models with X-ray structures
HalorhodopsinBacteriorhodopsin Sensory Rhodopsin
Rhodopsin NtpK
Membrane Bioinformatics SS09
![Page 27: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/27.jpg)
27
Comparing the best models with X-ray structures
Membrane Bioinformatics SS09
![Page 28: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/28.jpg)
28
These are our 4 best
non-native models of bR.
Because contact between
A and E was not imposed,
very different topologies
were obtained.
In 2006, our methods
could not distinguish
between these models.
but they could serve as
input for further
experiments.
Can one select the best model?
Membrane Bioinformatics SS09
![Page 29: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/29.jpg)
29
“Success case”: True de novo model of 4-helix bundle
Membrane Bioinformatics SS09
![Page 30: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/30.jpg)
30
Predicting lipid-exposure
Membrane Bioinformatics SS09
![Page 31: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/31.jpg)
31
Predicting lipid-exposure
Aim: derive optimal scale to predict exposure of residues
to hydrophobic part of lipid bilayer.
Scale should optimally correlate with SASA minimize quadratical error.
Y: SASA values of the training set (N = 2901 residue positions)
X: profile of residue frequencies from multiple sequence alignment ( N 21 matrix)
: wanted propensity scale for 20 amino acids + 1 intercept value (21)
Solution for minimization task
Membrane Bioinformatics SS09
![Page 32: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/32.jpg)
32
What does MO scale capture?
Membrane Bioinformatics SS09
![Page 33: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/33.jpg)
33
Improved prediction of exposure by statistical learning
Prediction method Prediction accuracy [%]
Beuming & Weinstein 68.7
TMX 78.7
Yuan ... Teasdale 71.1
Beuming & Weinstein(2004) method
Membrane Bioinformatics SS09
![Page 34: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/34.jpg)
34
Improved method by statistical learning
The theory of Support Vector Classifiers evolves from a simpler case of optimal
separating hyperplanes that, while separating two separable classes, maximize
the distance between a separating hyperplane and the closest point from either
class.
A: The two classes can be fully separable by a hyperplane, and the optimal separating hyperplane can be obtained by solving Eq. 9. B: It is not possible to separate the two classes with a hyperplane, and the optimal hyperplane can be obtained by solving Eq. 17.
Membrane Bioinformatics SS09
![Page 35: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/35.jpg)
Stockholm Univ. Sept. 200835
Improved method by statistical learning
Membrane Bioinformatics SS09
![Page 36: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/36.jpg)
36
Improved method by statistical learning
Membrane Bioinformatics SS09
![Page 37: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/37.jpg)
37
Improved method by statistical learning
Membrane Bioinformatics SS09
![Page 38: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/38.jpg)
38
Improved method by statistical learning
Membrane Bioinformatics SS09
![Page 39: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/39.jpg)
39
http://service.bioinformatik.uni-saarland.de/tmx/
input:
Putative TM helices
TopoView drawsSnake plot
Master thesisNadine Schneider
Membrane Bioinformatics SS09
![Page 40: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/40.jpg)
40
http://service.bioinformatik.uni-saarland.de/tmx/
Top: TMD11, Bottom: TMD 12 Membrane Bioinformatics SS09
![Page 41: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/41.jpg)
41
http://service.bioinformatik.uni-saarland.de/tmx/
Top: TMD5, Bottom: TMD 12 Membrane Bioinformatics SS09
![Page 42: V9 – orientation of TM helices](https://reader036.vdocument.in/reader036/viewer/2022081417/568148ba550346895db5d62e/html5/thumbnails/42.jpg)
42
Summary TMX and related methods
Sequences of TM proteins reveal many powerful features to allow prediction of
2D- and 3D structural features, function, and oligomerization status.
TMX server can predict lipid exposure with ca. 78% accuracy.:
http://service.bioinformatik.uni-saarland.de/tmx/
Possible applications:
(1) predict transporter pores
(2) predict lipid-exposed surface of TM proteins:
correlate with different membrane composition
collaborate with us do you have lots of solubility data?
(3) Conserved surface residues may indicate interaction sites
Membrane Bioinformatics SS09