Blaenbaglan Year 2 Timetable Home Learning Summer Term 2020

Week Beginning: 29th June 2020 If you are able to, you can upload pictures of their work/activities completed at home including news onto j2e using your child’s HWB account. This allows me to comment and mark for your child to see. I have included a guide explaining how to do this if you wish. You can also email me – a schoop has been sent with my contact details. You can complete these activities on paper, using a computer or practically. The worksheets/materials on the website are a guide to help support their learning. I have also uploaded the same worksheets from website onto J2E. They will be in your child’s shared files folder and you can type directly onto the sheet and save the piece of work. This may benefit families who don’t have access to a printer. I have changed some parts of the Weekly Timetable to reflect our “Check In, Catch Up and Prepare” sessions starting this week in school. I will be explaining the tasks, teaching examples/practical activities linked to home learning and showing how to use HWB.

Phonics Spelling Reading Writing Maths Mental Maths

Outdoor Learning/Wellbei

ngPhase 5b:Review sounds learnt so far by playing this game: https://www.phonicsplay.co.uk/resources/phase/5/flashcards-speed-trials

Year 2 have already looked at alternatives for a, e, i, o and u in school. You can revise these through playing games on Phonics Play.

You can access this for free using this log in:Username: March20Password: home

The /aw/ sound spelt as a before l and ll

allballcalltallfallwallstallsmallwalktalkalwaysalsoalmostalteraltogether

Read and answer questions from at least 1 of your Bugclub books.

(Use your login card in the back of your blink book)

Our new mini writing topic is ‘Jack and the Beanstalk’.

Story Writing:Plan an alternative ending to Jack and the Beanstalk. Use the plan provided to create your own ending by answering these questions:

Where does the beanstalk take Jack and who does he meet?

What does Jack take

Position and Movement.

We are learning how to recognise and describing quarter turns, half turns using clockwise and anticlockwise. A quarter turn is a right angle.

Watch Powerpoint and warm up video. https://www.bbc.co.uk/bitesize/clips/z7kwmp3

This is a Supermovers dance song about position and direction. It is a fun way to practise turns, left, right, clockwise and anticlockwise.https://www.bbc.co.uk/teach/supermovers/ks1-maths-position-&-direction/zhh9scw

Shape patternshttps://www.topmarks.co.uk/ordering-and-sequencing/shape-patterns

Compare prices and measurement.https://www.topmarks.co.uk/ordering-and-sequencing/coconut-

Outdoor Activities are weather depending in school. Here are 2 ideas you can try at home:

Use chalk to make a pavement or garden obstacle course.

This week we are looking at alternative pronunciation of “ow” sound.

Practise the alternative pronunciation of grapheme ‘ow’.Write the grapheme ‘ow’. Review the alternative pronunciations and write the words: cow, owl, brown, crown, frown, low, bowl, snow, window, show. Play Acorn Adventures and sort “ow” sound. https://www.phonicsplay.co.uk/resources/phase/5/acorn-adventures

Challenge your child to cut out and sort the words in the ow sorting game into two lists by the way it is pronounced. (On school website)

“ow” as “ou”“ow” as “”oa

Read the following sentences:Is a brown owl at the

See Spelling Activity Pack on website

Tricky words from Phase 5b planning:water, where, who, again, thought, through, work, mouse.

Play this game online:https://www.phonicsplay.co.uk/resources/phase/5/tricky-word-trucks

You can also

back to his mother?

What happens at the end of the story?

You could also change the name of the characters - you could have a girl climbing up the beanstalk and selling the cow for her Dad/Grandpa/Brother. The choice is yours.

We will make a “Bubble” alternative ending to Jack and the Beanstalk and story map as an example in school.

Draw a story map of your new version of Jack and the Beanstalk. Draw an S shape on a piece of paper. Draw pictures and key words to sequence the story. This will help you retell the story orally. You will write

Complete the Math Activity Pack on website. I have uploaded this onto j2e under “Shared Files”.

Practical Ideas:Draw your own map or obstacle course of our garden. Write directions for a family member to follow. Use Turtle tool on jit5 on HWB. You can programme a man, butterfly and rocket.

You could also link it with Jack and the Beanstalk – create a map of Jack’s village and make a route for Jack to sell the cow and back home. Remember to use language learnt e.g. anticlockwise, clockwise, quarter turn, half turn etc.

If you have an ipad/tablet, “Think and Learn Code-a-pillar" and “Scratch Jr” are good free apps to practise position and movement through DCF and coding.

During class sessions, I will share examples and practical activities about this concept. Worksheets from the pack won’t be completed in school.

ordering

Use cardboard/wool to weave natural objects you find on your local walk.

Lockdown Memories Jar:Decorate a glass jar (you could use a recycled jam jar) or container with a lid. Write down, draw or add photographs on

window? Did the cow put his food in a bowl? Can a shadow be brown?

Extension:Use picture flashcards to play Taboo or Charades.

We will try these games and sound in school.

practise tricky words and HFW from previous phase words.

your new version of Jack and the Beanstalk next week.

See Jack and the Beanstalk Story Map example on the website.

Problem Solving:The Mystery at Dragonspire Castle. I will go through this mystery challenge during “Check In, Catch Up and Prepare” sessions. If your child solves the mystery in class, try “The Mystery of the Missing Daffodils”.

If your child is not attending, choose 1 of the mysteries to solve.

separate pieces of paper lockdown memories you had in your family. They could be happy, sad, worrying or excited memories – each one is valued and all feelings should be added to the jar. Your family could take part to and create a family lockdown memory jar.

Add all the memories into the jar and close it. In the future, you can open the memory jar and reflect on this period of time.