charles county’s senior center news · july 2012 the scoop charles county’s senior center news
TRANSCRIPT
2 July2012•www.CharlesCountyMD.gov
Senior newS
Council newsSponsored Activities & Events for July
Clark Senior Center
• AnnualCouncilFleaMarketFund-Raiser
indian Head Senior Center
• FlySwatterGame,GetonBoardtheIHSCSoulTrainPartywithCharlesLee,andFrozenYogurtDelight
waldorf Senior Center
• Snack Bar, Bingo Supplies, 1812Bicentennial Bash, ROAD TRIP! BowieBaysox, Mango & Melon Week, andWeek-LongYardSale
Tri-County Senior Golf Tournament resultsThankstoallwhoparticipatedintheTri-CountyGolfTournamentheldThursday,May17.Itwasafantasticdaywithgreatweatherforeveryonetoenjoy.Atotalof19playerstookpartintheeventandencourageotherstosignupnextyear.
Congratulations to the winners:
Men's Age 50-591st . . . PaulWhitlock
Men's Age 60-691st . . . MickeyWheeler 2nd. . . FredRichardo
Men's Age 70-791st . . . KenStormer 2nd. . . HenryWatson 3rd . . . CurtSnyder
Women’s Age 70-791st . . . JoanMoran
19th Annual Flea Market & Bake SaleThisistheClarkSeniorCenterCouncil’sbiggestfund-raiseroftheyear!Yourdonateditemsmaybedroppedoffat theClarkCenterMonday, July9,11:00am-3:00pm;andTuesday-Friday, July10-13, 9:00am-3:00pm.Remember tobringclean,usable items.Bake sale donations are also needed: cakes, pies, brownies, specialty breads, andcookieswouldbeappreciated.Volunteersareneededfor thedayof theevent from7:30am-1:00pm.Ifinterestedinvolunteering,pleasecall301-870-2015or301-934-5423fordetails.
Sat, July 14 8:00am-Noon Site: Richard R. Clark Senior Center, La Plata
when Traveling, what Medical Services are Covered by Medicare?Travelingaroundtheworldthissummer?DidyouknowthatMedicarehasveryspecificsituationsinwhichhealthcareservicesarecoveredduringforeigntravel?
TherearethreesituationswhenMedicaremaypayforcertaintypesofhealthcareser-vicesyougetinaforeignhospital(ahospitaloutsidetheU.S.)1.You’reintheU.S.whenyouhaveamedicalemergency,andtheforeignhospitaliscloserthanthenearestU.S.hospitalthatcantreatyourillnessorinjury.2.You’retravelingthroughCanadawithoutunreasonabledelaybythemostdirectroutebetweenAlaskaandanotherstatewhenamedicalemergencyoccurs,andtheCanadianhospitaliscloserthanthenearestU.S.hospital that can treat your illness or injury.Medicare determineswhat qualifies as“withoutunreasonabledelay”onacase-by-casebasis.3.YouliveintheU.S.andtheforeignhospital is closer toyourhome than thenearestU.S.hospital that can treatyourmedicalcondition,regardlessofwhetherit’sanemergency.Remember,inthesesituations,MedicarewillpayonlyfortheMedicare-coveredservicesyougetinafor-eignhospital.CMSProductNo.11037.
Formoreinformation,pleasecall1-800-MEDICAREortheCharlesCountySHIPProgramat301-609-5712or301-934-9305,x5143.
Mark Your Calendar!The Charles County Fair is Coming Sept 13-16It’s time to finish your projects… the fair israpidlyapproaching!Itemsfortheseniordivi-sion(age60orolder)areneeded.Entriesmusthave been completed between September2011 and September 2012, excluding collec-tionswithnewadditions.Twoentrymaximumper class. Entry selections include: NeedleArts: crocheting, knotting, needlepoint,sewn garments, decorated baskets, pillows,embroidery, counted cross stitch, quilt-ing, rugs, decorated accessories, dolls, andmore.Arts&Crafts:Watercolors,oils,acrylics,drawings, ceramics, pottery, woodcarving.Christmasdecorations,toys,decorativeitems,photographs, calligraphy, jewelry, andmore.Collections: Scrapbooks, stamps, coins, andmore.
For details, please call Kay Krafchik at301-934-7996.
WANTED: Ten pairs of volunteers areneededtomonitortheseniorroom.Eachpairwill commit to a block of timebeginning at5:00pmonThursday, September13 through5:00pm on Sunday, September 16. Seniorroomvolunteerswill serve twopurposes: tokeepaneyeontheprojects,andtopromotetheSeniorCenters.
Please call the Waldorf Senior Center at 301-638-4420fordetails.
TheLatestSCOOP 3
Senior newS Get your Latest SCOOP online!Visit www.CharlesCountyMD.gov/CS
Summer Aquatics for Seniors Enjoythehotsummerdayswithacoolsplashinthepoolwhilegivingyourbodyagreatworkout.Improveyouroverallhealthandwellbeingthroughaprogressionofmovementsinthewater.RegisteratanySeniorCenter.FordetailspleasecallDebiShanks,PhysicalFitnessCoordinator,at301-609-5711.
Aqua Aerobics
Lackey PoolMon/Wed 8:15-9:15am Jun 18-Aug 8Fee: $35
North Point PoolMon/Wed 8:15-9:15am Jun 18-Aug 8 Fee: $35
Tue/Thu 8:15-9:15am Jun 19-Aug 8 Fee:$35
Arthritis Foundation exercise Program
Lackey PoolTue/Thu 8:15-9:15amJun 19-Aug 9Fee: $35
Senior Farmers' Market Nutrition ProgramTobeeligibletoreceivecouponsyoumustbeenrolledinoneofthefollowingFederalPrograms: Qualified Medicare Beneficiary Program (QMB), Special Low-IncomeMedicareBeneficiaryProgram (SLMB),MarylandEnergyAssistanceProgram (MEAP),and Primary Adult Care Program (PAC) which replaces (MPAP), EXTRA HELP withMedicare D Prescription Drug Program, Medicaid, SSI, Food Stamps, or the SeniorEmploymentProgramorhaveayearlyincomeoflessthan$20,665.Participationintheprograminpastyears,doesnotautomaticallyqualifyyouforthisyear.ThisprogramprovidesfreecouponstobeusedatanyapprovedFarmersMarketsforfreshfruitsandvegetables.
CouponbookletswillbedistributedatallSeniorCentersonthedatesandtimeslistedbelow;shouldyouhavequestions,pleasecontactLisaFurlowat301-934-0138or301-870-3388ext5138.
Nanjemoy . . . . . . Jul 3 . . . . . . . . . 10:30 amWaldorf . . . . . . . . Jul 17 . . . . . . . . 10:00 amIndian Head . . . . Jul 5 . . . . . . . . . 10:00 amRRCSC . . . . . . . . . . Jul 24 . . . . . . . . Noon
Farmers' Market Shopping at WSC! New this year! Joinus foraFarmer’smarketeventjustforseniorsonTuesday,July17,10am-1pm,attheWaldorfSeniorCenterandshopforfreshfruitsandvegetablesrightintheparkinglot.
Several local farmers are scheduled tobe there in addition to representatives fromSeniorInformation&Assistancestaff,OfficeonAgingprograms,andfoodstampeligi-bilityscreeningwillbeoffered.
Take advantage of this wonderful opportunity and help to support local CharlesCountyfarmers.
2012-2013 Council MembersCongratulations to our councils and theirnew members. Many thanks to those whoareleavingthecouncils;thanksforyourhardworkanddedication.EachSeniorCenterhasa council that works diligently throughoutthe year making sure the senior programsare well rounded and responsive to theneeds and desires of senior citizens, assist-ingstafftosatisfytheseneeds,andtoensuresupplemental funding is available to helpsupporttheactivities.
New councils for the upcoming year are as follows:
Indian Head Senior Center
Sandra Campbell, Rose Chase, Anna Funk,Geneva Johnson ,Marjorie Lancaster, SelinaMcManus, Sherri Muscolino, Gladys Parker,Marie Payne, Janice Simpson, and MarthaWilliams
Nanjemoy Senior CenterAgnes Davis, Betty Gilroy, Millie Hamman,BeverlyDurham,EvaWest,Audrey Jackson,GeraldineSwann,andEthelTibbs
Waldorf Senior CenterJerryMcMahon,MaryNorris,HelenWinkler,Bill Norris, Barbara Montgomery, FrancesLewis,andJoyceDrew
Richard R. Clark Senior CenterAnthony Perino, Anna Scott, Judy Tunney,KayKrafchik,AlTurner,DawnCamp,DeloresMoses,andAnnaKasper
Senior i&A at Bel Alton Community Development Center
Areyou,or someoneyouknow60yearsofageorolder?Doyouhavequestionsaboutservicesavailable toseniorcitizens?Plan tostopbythecenterandtalkwithstaffonthefollowingdate,
Wed 11:00am-1:00pm Jul 11 Fee: FREE
4 July2012•www.CharlesCountyMD.gov
1210 Charles St • La Plata, MD 20646 • 301-934-5423 or 301-870-2015
ClArk Senior CenTer Get your Latest SCOOP online!Visit www.CharlesCountyMD.gov/CS
Special Events & Activities
Book ClubJuly: Nature Girl by Carl Hiaasen. August:Devil in the White CitybyErikLarson.
Thu, Jul 5 1:00pm Fee: FREE
Summer Game DayLet’s stay inside and beat the heat. Playboardgames,pick-upsticks,jacksetc.
Thu, Jul 5 11:00am Fee: FREE
Coin AppraisalJohnHanklawillappraiseyoucoins.
Wed, Jul 11 9:00am Fee: FREE
Jewelry Club The purpose of this club, whichmeets thesecondWednesdayeachmonth, is to sharejewelry making and jewelry crafting ideas.Bringyourlatestproject.Allarewelcome.
Wed, Jul 11 10:00-Noon Fee: FREE
Free Vascular ScreeningThe office of Vascular Surgeon Dr. SahdenisofferingFREEVascularScreening.All thatis required is to pull your pants up andtake socksoff to complete thisnoninvasivescreening that diagnoses early PeripheralArterialDisease(PAD).Thistest isespeciallyimportant if you have diabetes, are over-weight,havehighcholesteroland/orbloodpressure, smoke, and are over 50 years ofage.Facilitator:NicoleGregory.
Thu, Jul 12 9:30am-4:00pm Fee: FREE
Annual Flea Market Fund-raiserOnce again, it’s time to clear out your atticandgarage,anddonatetotheCenter.Thenvisit the fleamarket to fill it back up againwith bargain priced treasures. All proceedsgototheCounciltobenefittheCenter.
Sat, Jul 14 8:00am-NoonFee: Individually priced items
our kids Have Talent ShowPop your Grandparent buttons as your tal-ented grandchildren show off their talents.Singing, dancing, hula hooping, comedyacts, instrumentals,andmorearewelcome.ActsmusthavetheirmusicCD.SeeFlorenceRobeytosignup.
Thu, Jul 19 10:30am Fee: FREE
roasted Garlic DayWe are celebrating by roasting garlic…whichgivesgarlicamellower,butterytaste,excellent on crackers toast or pasta. Learnabout the health benefits and history ofthismemberoftheonionfamily.Facilitator:ElaineHopkins.
Tue, Jul 24 11:00am Fee: FREE
Christmas in JulyJoinusaswesingsongs,decoratetinytrees,and celebrate Christmas with no rushingabout,waiting in lines,orworryingwhattobuy.Joinusforastressfreeholiday!
Wed, Jul 25 10:00am Fee: FREE
Caregiver SupportSupportforthosecaringforolderadultsfromCindyOlmsted,LongTermCareCoordinator.
Wed, Jul 25 2:00pm Fee: FREE
karaoke Sing-A-longJoinusaswesingyouroldfavorites.
Thu, Jul 26 11:00am Fee: FREE
newcomers CoffeeAre you new at the Center? Enjoy a cup ofcoffeeorteawhilelearningaboutthegreatthingstheCenterhastooffer.
Fri, Jul 27 10:00am Fee: FREE
Benny’s for lunch?Your choice: Chicken Chow Mein, GeneralTso’s Chicken, Shrimpwith Garlic Sauce, orPepper Steak with Onions. Preregistrationandpaymentrequired.
Tue, Jul 31 Noon Fee: $6
Videos: A Month of Letters
The love letterAloveletterfoundinasecretcompartmentofanolddesksealsthefateofayoungcou-plelinkedbydestinybutseparatedbymorethan100years.
Fri, Jul 6 10:00am Fee: FREE
A letter to Three wivesAnn Southern, Linda Darnell, and JeanneCrain star in this intriguing comedy aboutthreewomenwhohavetowaitanentiredayto find whose husband is leaving with an-otherwoman.
Fri, Jul 13 10:00am Fee: FREE
The love letterOnemysterious lovenotehas thepower tounlockstartlingsecrets,leavingatrailofsur-prisesasitturnsatownupsidedown.
Fri, Jul 20 10:00am Fee: FREE
Special Presentations
Solomon’s TempleAccordingtotheTorahandBible,Solomon'sTemple was the first Jewish temple inJerusalem.Facilitator:Dr.RollieHower.
Tue, Jul 10 11:00am Fee: FREE
Do i need A Trust?What you need to know about trusts.PresentedbyPNCBank.
Tue, Jul 17 11:00am Fee: FREE
Classes
Fitness room orientationLearn how to use the fitness room equip-mentproperlybeforeworkingout.This isarequirement.Registrationisnecessary.
Tue, Jul 3 3:30pm Fee: $2Wed, Jul 11 & 25 1:00pm Fee: $2
Beginner ComputerDesignedforthosewithoutcomputerexpe-rience.Instructor:MikeMoses.
Tue & Wed, Jul 17-18 1:00-4:00pmFee: $32 plus $3 supply fee
PilatesStrengthen your back, abdominal muscles,hips,and improveposture.Allfitness levelsmayparticipate.
Wed, Ongoing 10:30am Fee: Fitness Card
Independence Day Party
Hopintotheold48FordtruckandtakeamusicaltourofAmericawithWaywardJim.Hewilltakeyoucoasttocoastwithaselectionofmusic,stories,andtalltales.
Enjoy a delicious meal with featuringstate favorites: Main clam chowder,North Carolina BBQ Pork Sandwich,Boston Baked Beans, Cape Cod Blend(broccoli,carrots,snappeas,greenpep-pers, and cranberries mixed), HawaiianFruitSalad,andGeorgiaPeachPie.
IntheafternoonplayStatelineBingo.
Tue, Jul 3 • 10:30amFee: $3 plus a generous meal donation
TheLatestSCOOP 5
Monday Tuesday Wednesday Thursday Friday
Interval Training . . . . . . . . . . 9:00Billiards Drop In . . . . . . 9:00-4:00Spanish . . . . . . . . . . . . 10:00-11:30Duplicate Bridge . . . . .10:00-2:00Ceramics . . . . . . . . . . . .10:00-2:002N1 Club . . . . . . . . . . . 10:15-11:00Tai Chi . . . . . . . . . . . . . 10:30-11:30Pinochle . . . . . . . . . . . . .1:00-3:00Circuit Training . . . . . . .2:30-3:30
Flex & Stretch . . . . . . . . .8:30-9:30Project Linus . . . . . . . .9:00-NoonBilliards Drop In . . . . . . 9:00-4:00Gentle Yoga . . . . . . . . . 9:30-11:00Fine Arts . . . . . . . . . . .10:00-NoonAFEP . . . . . . . . . . . . . . 10:30-11:00Bridge . . . . . . . . . . . . . . 10:00-3:15Zumba Gold . . . . . . . . . . . . . NoonGuitar Lessons . . . . . . . Noon-1:00Easy Craft . . . . . . . . . . . . 1:00-1:45Line Dancing . . . . . . . . .1:00-2:00So . MD . Pitch . . . . . . . . .1:00-4:00Weekly Workout . . . . . .5:30-6:45
Billiards Drop In . . . . . . 9:00-4:00Strength Training . . . . 9:15-10:15Quilting, Etc . . . . . . . . .9:30-NoonCrochet Club . . . . . . . .10:00-NoonPilates . . . . . . . . . . . . . . . . . . 10:30Bridge . . . . . . . . . . . . . . 11:00-3:15Pinochle . . . . . . . . . . . .12:30-3:00Powder Puff Billiards . . .1:00-4:00
Flex & Stretch . . . . . . . . .8:30-9:30Billiards Drop In . . . . . . 9:00-4:00Tai Chi . . . . . . . . . . . . . .9:30-10:30Stained Glass . . . . . . .10:00-NoonAFEP . . . . . . . . . . . . . . 10:30-11:00Zumba Gold . . . . . . . . . . . . . 11:30Canasta . . . . . . . . . . . . .12:30-3:00Reflections . . . . . . . . . . . 1:00-1:30Beg Line Dancing . . . . . .1:00-2:00
Project Linus . . . . . . . . .9:00-2:00Billiards Drop In . . . . . . 9:00-4:00Strength Training . . . . 9:15-10-15Oil Painting/Acrylics . .10:00-2:00Pinochle . . . . . . . . . . . .12:30-3:00
2 3 4 5 6
Greenback Investment . . . . 10:00 Independence Day Celebration . . . . . . . . . 10:30Fitness Orientation . . . . . . . . 3:30
Independence DaySenior Center Closed
Summer Game Day . . . . . . . 11:00Book Club . . . . . . . . . . . . . . . . 1:00
Hand & Foot Canasta . . . . . . 10:00Video: The Love Letter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00Gentle Yoga . . . . . . . . . . . . . 10:30Cancer Support Group . . . . . . 1:30
9 10 11 12 13
Flea Market Donations . 9:00Reflexology . . . . . . . . . . . . . . 9:15Greenback Investment . . . . 10:00
Flea Market Donations . 9:00Solomon’s Temple . . . . 11:00
Flea Market Donations . 9:00Coin Appraisal . . . . . . . . . . . . 9:00Visit the Nurse . . . . . . . . . . . 10:00Genealogy . . . . . . . . . . . . . . 10:00Caregiving Tips . . . . . . . . . . 10:00Jewelry Club . . . . . . . . . . . . . 10:00Fitness Orientation . . . . . . . . 1:00
Flea Market Donations . 9:00FREE Vascular Screening 9:30
Flea Market Donations . 9:00Visit the Barber . . . . . . . . . . 10:00Video: A Letter to Three Wives . . . . . . . . . . . . . . . . . . 10:00 Creative Writing . . . . . . . . . . 1:00
16 17 18 19 20
Ceramics . . . . . . . . . . . . . . . . 10:00Prostate Support Group . . . . 1:00
PNC: Do I Need a Trust? . . . . . . . . . . . . . . 10:30Beginner Computer . . . . 1:00
Blood Pressure Screening . . 10:00Beginner Computer . . . . 1:00
Our Kids Have Talent Show . . . . . . . . . . . . . . . 10:30
Video: The Love Letter . . . . 10:00Poetry Corner . . . . . . . . . . . . . 2:00
23 24 25 26 27
Ceramics . . . . . . . . . . . . . . . . 10:00Sisters at Heart . . . . . . . . . . 11:30
Garlic Days . . . . . . . . . . . . . . 11:00Farmers' Market Coupons . . Noon
Visit the Nurse . . . . . . . . . . . 10:00Christmas in July . . . . . 10:00Fitness Orientation . . . . . . . . 1:00Caregiver’s Support . . . . . . . . 2:00
Karaoke Sing-A Long . . . . . . 11:00Twelve O’clock Pizza . . . . . . NoonBirthday Celebration . . . . . . 12:30
Newcomers Coffee . . . . . . . . 10:00Visit the Barber . . . . . . . . . . 10:00Hand & Foot Canasta . . . . . . 10:00Creative Writing . . . . . . . . . . 1:00
30 31
Circuit Training . . . . . . . . . . . 2:30 Benny’s for Lunch . . . . Noon
1210 Charles St • La Plata, MD 20646 • 301-934-5423 or 301-870-2015
ClArk Senior CenTer Hours of Operation • 9:00–4:00, Mon-FriLuncheon at Noon–Reservation/Registration Required
Reserve lunch by 10:00am the preceding day.Calendar items marked by an * require reservation/appointment
July
Upcoming Event
School House rock Field TripApopculturephenomenoncomestotheCSMstage.Wewillcarpoolfromthe
Center.ReservationsandpaymentrequiredbyFri,Jul13.LunchatThreeBrothers(DutchTreat)aftertheshow.
Fri, Aug 10 • 9:30am • Fee: $5, plus lunch money
6 July2012•www.CharlesCountyMD.gov
inDiAn HeAD Senior CenTer100 Cornwallis Square (Village Green) • Indian Head, MD • 301-743-2125
Get your Latest SCOOP online!Visit www.CharlesCountyMD.gov/CS
Special Events & Daily Activities
Farmers' Market Coupon Distribution Seepage3fordetails.
Thu, Jul 5 10:00am-Noon Fee: FREE
Patriotic Poetry ContestBring with you the red, white and blue.Themostpatriotic“bringtearstoyoureyespoem”willwincash.
Fri, Jul 6 11:00am Fee: FREE
Music Spotlight: Dolly PartonDolly RebeccaPartonwasborn January 19,1946,oneof12childrenofRobertLeeParton,a tobacco farmer,andAvieLeeParton (néeOwens).Dollygrewuponarun-downfarmin Locust Ridge, Tennessee. At 12, she wasappearingonKnoxvilleTV,andat13shewasalready recording on a small label and ap-pearingattheGrandOleOpry.
Fri, Jul 6 12:30-1:00pm Fee: FREE
My Final wishes with Mr. Sherrod Asweageabigrelieffromburdenisgettingyouraffairs inorder.Prevent confusionandstress amonggrieving lovedones andgiveyourselfpeaceofmind.
Wed, Jul 11 11:00am-Noon Fee: FREE
Field Trip to waldorf Senior Center Join us for a special lunch at the WaldorfSeniorCenterincludingshoppingatthefirstFarmers'Market in the Jaycee's parking lot.Severallocalfarmershaveagreedtobringanarrayoffreshfruitsandlocallygrownvege-tables for you topurchasewith yournewlydistributed food coupons. We will meet attheIndianHeadSeniorCenterandrideoveronaschoolbus(nowheelchairaccess).
Tue, Jul 17 9:30am-1:30pm Fee: Lunch DonationPlease sign up not later than Wed, Jul 11
Book Club: Borderline by nevada BarrThe killings on Isle Royale have left Annadrained and haunted, her memories of hertimewiththewolfstudygroupforevermarredbythecarnageontheisland.Diagnosedwithpost-traumatic stress disorder, she is on ad-ministrative leave, per her superintendent’surging.Annawondersiftheleavemightnotbe permanent, either by her own choice orthatoftheNationalParkService.
Wed, Jul 25 11:00am-Noon Fee: FREE
Chess Tournament Chess is a mental game of strategy, evalu-ation, and patience. A study in the NewEnglandJournalofMedicinefoundthatchal-lengingyourbrainwithmentallystimulatinggameslikechesswillgreatlyincreasementalagilityandsharpenmemoryskills.
Every Wed 1:00-3:00pm Fee: FREE
For Your Health
Visit the nurseBlood pressure screening and a privatevisitwith Linda Barnes, RN, Charles CountyDepartmentofHealth.
Thu, Jul 5 10:00am-Noon Fee: FREEWed, Jul 18 10:00am-Noon Fee: FREE
Protein is Gaining Positive research Attention for its Health BenefitsResearch on the expanding array of healthbenefits of higher-protein diets shows thatprotein isnot just for thebodybuilderandathlete anymore. New research is now dif-ferentiating between types of protein,identifying benefits of distributing proteinevenlythroughouttheday,anddiscoveringbenefits like bone health, weight manage-ment, blood glucose control, heart healthandpost-exercisere-hydrationandrecovery.
Mon, Jul 9 1:00-1:30pm Fee: FREE
Preparing a Diet Journal with CynthiaAfooddiaryhelpsyoufigureouthowmanycalories you are consuming each day andalso tells if you are getting enough fruits,vegetables,andwholegrains.
Fri, Jul 20 11:15am-Noon Fee: FREE
The Truth Behind nutrition TrendsInterestinnutritionanddiethasneverbeensohot.It’seasytogetcaughtintheswellofenthusiasm… jumping on every diet trendbandwagon.Someofthecurrenttrendsaregood,andsomeareawasteoftime.Staffwillsummarizebygivingthumbsupordowntothelatesttrendsaccordingtoresearch.
Tue, Jul 24 1:00-1:30pm Fee: FREE
Classes
Computer ClassLearn MS Word, access the internet orFacebook.Pleasepreregister.
Fri, Jul 13, 20 1:00-2:00pm Fee: $5, refundable upon registration
Fitness & Dance
Fitness TrainingThis fitness class has all of themajor com-ponents: cardio, flexibility, and strengthtrainingtogetyougoing.
Mon/Wed 9:15-10:00am Fee: Fitness Card
Tai Chi: Moving for Better BalanceImprovebalanceandmobilitywithCynthia.
Wed, Ongoing 10:30-11:30amFri, Ongoing 9:15-10:15amFee: Fitness Card
line DancingLearnthenewestlinedanceswithGeneva.
Thu, Ongoing 1:00pm Fee: FREE
AFePLow-impactseatedexercise.
Tue/Thu, Ongoing 10:30am Fee: FREE
Hats Off to the Men & Women of
our Armed Forces
Theseniorswillbehostingacourte-syluncheonformilitarypersonnel.Seniorscanprovidesmallpatriotictokens and thankyou cards.Don’tmissanopportunitytothankthemfortheirmanysacrificestoourgreatcountry.
Tue, Jul 3 11:00am-1:00pmFee: Generous Lunch Donation
TheLatestSCOOP 7
inDiAn HeAD Senior CenTer100 Cornwallis Square (Village Green) • Indian Head, MD • 301-743-2125
Hours of Operation • 9:00–3:00, Mon-FriLuncheon at Noon–Reservation/Registration Required
Reserve lunch by 10:00am the preceding day.
Monday Tuesday Wednesday Thursday Friday
Billiards/Cards . . . . . . . . . . . . 9:00Fitness Training . . . . . . . . . . . 9:15Bingo . . . . . . . . . . . . . . . . . . 10:00Bingo . . . . . . . . . . . . . . . . . . . 1:00
Billiards/Cards . . . . . . . . . . . . 9:00Bingo . . . . . . . . . . . . . . . . . . 10:00AFEP . . . . . . . . . . . . . . . . . . . 10:30Reflections . . . . . . . . . . . . . . . 1:00
Billiards/Cards . . . . . . . . . . . . 9:00Fitness Training . . . . . . . . . . . 9:15Quilt N’ Chicks . . . . . . . . . . . 10:00Tai Chi . . . . . . . . . . . . . . . . . . 10:30Tai Chi - Graduates . . . . . . . . 1:00Chess . . . . . . . . . . . . . . . .1:00-3:00
Billiards/Cards . . . . . . . . . . . . 9:00Oil Painting . . . . . . . . . . . . . 10:00AFEP . . . . . . . . . . . . . . . . . . . 10:30Line Dancing . . . . . . . . . . . . . 1:00
Billiards/Cards . . . . . . . . . . . . 9:00Tai Chi . . . . . . . . . . . . . . . . . . . 9:15Ceramics . . . . . . . . . . . . . . . . 10:00Canasta & Bid Whist . . . . . . 10:00
2 3 4 5 6
American Pride Week Craft . . . . . . . . . . . . . . 10:30-11:30Domino Tournament . . 12:45-2:00
Council Meeting . . . . . . . . . 10:00Hats off to the Men & Women of our Armed Forces . . . . . . . . . . 11:00-1:00
Independence DaySenior Center Closed
Farmer’s Market Coupon Distribution . . . . 10:00-NoonVisit the Nurse . . . . . .10:00-NoonMatter of Balance . . .10:00-NoonBunko . . . . . . . . . . . . . . . . . . 12:45
Patriotic Poetry Contest . . . 11:00Music Spotlight: Dolly Parton . . . . . . . . . . . . . 12:30Pictionary . . . . . . . . . . . . . . . . 1:00
9 10 11 12 13
UV Safety . . . . . . . . . . 11:00-11:30Protein is Gaining Positive Research Attention for its Health Benefits . . . . . . . . . . . . . . . . . 1:00
Nora Jones with Morning Wisdom . . . . . . . . . 10:00Tai Chi Make-Up Class . .2:00-3:00
My Final Wishes with Mr . Sherrod . . . . . . . . 11:00-NoonTest Your Memory Skills . . . . 1:00
Matter of Balance . . .10:00-NoonSenior I&A Outreach . . . . . . 10:00
Laughter is the Best Medicine: Growing Old is Not for Sissies . . . . . . . . . . . . . 11:00-11:30Computer Lab . . . . . . . . . . . . 1:00
16 17 18 19 20
Fly Swatter Game . . . 11:00-NoonJoint Council Luncheon NSC . . . . . . . . . . . . 11:00-1:00
Field Trip to Waldorf Senior Center . . . . . 9:30-1:30
Senior Center Closed
Visit the Nurse . . . . . .10:00-NoonGet Holistic w/Leola . . 11:30-1:00
Matter of Balance . . .10:00-NoonGet on Board the IHSC Soul Train Party with Charles Lee . . . . . . 10:30-1:00
How to Prepare a Diet Journal with Cynthia . . . . . . . . 11:15-NoonComputer Lab . . . . . . . . . . . . 1:00
23 24 25 26 27
Summer Grilling Safety Tips . . . . . . . . . . . . . . . . . . . . 11:00Mind Benders . . . . . . . . .1:00-2:00
Long and Short-Term Care Insurance . . . . . . . . . . 11:00-NoonThe Truth Behind the Latest Nutrition Trends . . . . . . . . . . 1:00
Book Club, Borderline by Nevada Barr . . . . . . . 11:00-NoonFight Inflammation the Natural Way . . . . . . . . 11:15-Noon
No Quiltin’ Chicks Today
Matter of Balance . . .10:00-NoonBunko . . . . . . . . . . . . . . . . . . 12:45
Seated Massage . . . . . . . . . . . 9:30Movie Presentation: Miracle . . . . . . . . . . . . . 11:30-1:30
30 31
Crocheted Necklace . . . . . . . 10:30Frozen Yogurt Delight . . . . . 12:30
Al & Company Comedy Show . . . . . . . . . . . . . . . . . . . . 11:00-11:45amPrayer Line with Gladys Parker . . . . . . . . . . . . . . . . . . . 1:00
July
Get on Board the IHSC Soul Train Party with Charles Lee
CharlesLeeisbackbypopulardemandasSoulTrain'sveryownDonCornelius. Gethereearlytoreserveyourdance-box.Thefuncontinueswithgames,
door-prizes,andlunch.
Thu, Jul 19 • 10:30am-1:00pm • Fee: $5Please sign up not later than Wed, Jul 11
8 July2012•www.CharlesCountyMD.gov
3092 Crain Hwy (Jaycees Bldg) • Waldorf, MD 20601 • 301-638-4420
wAlDorF Senior CenTer Get your Latest SCOOP online!Visit www.CharlesCountyMD.gov/CS
1812 Bicentennial BashWhat many have called the Second War of Independence, the War of 1812 was fought for two and a half years against the British over our freedom to trade without restrictions.
Start your day with some fun history and games, and then at 10:30am we welcome Rosalie Steirs Calvert portrayed by Mary Ann Jung, award winning actress who will take us on an adventure. We become a part of the action in the British versus the Americans. In 1794, sixteen year old Rosalie and her family fled Belgium to escape Napoleon’s advancing army. The vivacious Rosalie married George Calvert in 1799 and became mistress of his plantation, Mt. Albion. Later, she inherited her father’s planta-tion in Bladensburg, "Riversdale Plantation.”
Learn what it meant to be in charge of two growing plantations in early 1800's Maryland, re-live the dramatic Battle of Bladensburg, and discover what happened to Rosalie, her husband, and their nine children.
Following the show, we will have a bicentennial lunch of hot dogs, beans, potato salad, cherry pie and more. Stay after lunch for more fun. This event is sponsored by the Senior Services of Charles County, Inc., and the Waldorf Senior Center Council.
Thu, Jul 5 10:00am-1:30pm Fee:$3,pluslunchdonation
Special Events & Daily Activities
Movie: Tower HeistComedy starring Ben Stiller, EddieMurphy,MatthewBroderickandothersaboutgroupofemployeeswhoworkatoneof themostluxurious and well-secured residences inNew York City where a Wall Street titanArthurShaw(AlanAlda)isunderhousearrestforstealingtwobillionfromhisinvestors.
Tue, Jul 10 10:00am-Noon Fee: FREE
Afternoon Book Club: The Summer kitchenLisaWingate takes us back to Blue SkyHillin the second of four books in this series.Facilitators:JulieBrasher&LisaClark,CharlesCountyPublicLibrarian.
Wed, Jul 11 1:00pm Fee: FREE
elder law AttorneysJacquelineByrd,JessicaEstesandBrian Ritter from the LawOffices of Byrd &Byrd will provide an overview of key elderlawmattersthenopenupthefloorforyourquestions.
Tue, Jul 24 10:30am Fee: FREE
week-long Yard Sale AllproceedsgototheWaldorfSeniorCenterCouncil. Bring in your items beginningMonday, July 23 throughThursday, July 26.We will not accept donations before or af-terthespecifieddates.SalebeginsMonday, July30.
Mon-Thu, Jul 30-Aug 2 9:00am-2:00pmFee: Your purchase
For Your Health
Seated MassageCathyPayne, LMTwill leave you feeling re-laxedandrejuvenated.
Thu, Jul 12 9:30-Noon Fee: 50¢/minute
Mango & Melon weekSpecialtreatspreparedforyoubyCindyandJulie and sponsored by theWaldorf SeniorCenterCouncil:
refreshing Mango & Melon saladWed, Jul 18 11:45am Fee: FREE
Mango MilkshakeThu, Jul 19 12:30pm Fee: FREE
new! Farmer’s Market ShoppingPlan to visit the center and shop for freshfruits and vegetables right in the parkinglot. Several local farmers are scheduled tobehere, inadditiontorepresentativesfromSenior Information & Assistance, Office onAgingprograms, and food stampeligibilityscreening to be offered. Take advantage ofthis wonderful opportunity just for seniorstohelpsupportlocalfarmers.
Tue, Jul 17 10:00am-1:00pmFee: Items marked individually
Senior information & Assistance outreachMeet privately with Ruth Anderson-Cole,Senior I&A Program Specialist, who willguide you through Medicare, health insur-ance,prescriptions,energyassistance,fraudprevention,andotherservicesasneeded.
Tue, Jul 19 10:00-Noon Fee: FREE
Visit the nurseBloodpressurescreeningandaprivatevisitwith Linda Van Hoy, RN, Charles CountyDepartmentofHealth.
Tue, Jul 3 10:00am-Noon Fee: FREEWed, Jul 25 10:00am-Noon Fee: FREE
Classes
water Based oilsMateriallistprovided.Instructor:PatArnold.
Tue, Jul 3 & 17 11:30am Fee: $5/class
Matter of BalanceLearntoviewfallsascontrollable,setgoalsfor increasing activity, and exercise to im-prove your overall strength and balance.Eightweekprogram,whichbeganMay9andendsJuly11.Instructor:JulieBrasher.
Wed, Jul 11 1:00-3:00pm Fee: FREE
Guitar lessonsSome experience required. Bring your ownguitartotheclassledbyThereseThiedeman.
Tue, Ongoing 10:00-11:00amFee: $5/class
Computer ClassPreregisterforapersonalizedone-hourses-sionwithRoseanneWindley.
Wed, Ongoing 9:00am-2:00pmFee: $63/6 week class
watercolorsMateriallistprovided.Instructor:PatArnold.
Thu, Ongoing 10:00amFee: $30/6 week class
TheLatestSCOOP 9
3092CrainHwy(JayceesBldg)•Waldorf,MD20601•301-638-4420
wAlDorF Senior CenTer Hours of Operation • 9:00–3:00, Mon-ThuLuncheon at Noon–Reservation/Registration Required
Reserve lunch by 10:00am the preceding day.
Monday Tuesday Wednesday Thursday
Pilates . . . . . . . . . . . . . . . . . . . 2:00 Total Body Conditioning . . . . 9:00Guitar Lessons . . . . . . . . . . . 10:00Line Dancing . . . . . . . . . . . . 10:15Dominos/Rummikub . . . . . . 10:30Double Deck Pinochle . . . . . NoonInspirations . . . . . . . . . . . . . 12:30Hatha Yoga . . . . . . . . . . . . . . . 2:00
Zumba GOLD . . . . . . . . . . . . . 9:00Computer Class . . . . . . .9:00-2:00AFEP . . . . . . . . . . . . . . . . . . . 10:00Bingo . . . . . . . . . . . . . . . . . . 10:30Dominos/Rummikub . . . . . . 10:30Cards & Games . . . . . . . . . . . . 1:00
Total Body Conditioning . . . . 9:00AFEP . . . . . . . . . . . . . . . . . . . 10:00Watercolors . . . . . . . . . . . . . 10:00Bingo . . . . . . . . . . . . . . . . . . 10:30Dominos/Rummikub . . . . . . 10:30Double Deck Pinochle . . . . . Noon
2 3 4 5
Explore Your Family History . . . . . . . . . . . . . . . . . . . . 9:00am-2:00pmSt . Charles Senior Club . . . . 10:00
Visit the Nurse . . . . . . . . . . . 10:00Water Based Oils . . . . . . . . . 11:30
Independence DaySenior Center Closed
1812 Bicentennial BASH . . . . . . . . . . . . . . . 10:00Rosalie’s War of 1812 . . 10:30
9 10 11 12
ROAD TRIP!: Bowie Bay Sox Depart WSC at 9:30amReturn to no later than 3:00pmSenior Center Closed
Movie: Tower Heist . . . . 10:00-Noon
Afternoon Book Club: The Summer Kitchen . . . . . . . 1:00Matter of Balance . . . . .1:00-3:00
Seated Massage . . . . . .9:30-Noon
16 17 18 19
Explore Your Family History . . . . . . . . . . . . . . . . . . . . 9:00am-2:00pmSt . Charles Senior Club . . . . 10:00
Farmer’s Market HERE in the Parking Lot . . . . . . 10:00-1:00Farmer’s Market Coupon Distribution . . . . . . . . . . . . . 10:00Water Based Oils . . . . . . . . . 11:30
Refreshing Mango & Melon Salad . . . . . . . . . . . . . . . . . . . 11:45
Senior I&A Outreach . . 10:00-NoonMango Milkshake . . . . . . . . 12:30
23 24 25 26
Senior Council Meeting . . . . . 9:30St . Charles Senior Club . . . . 10:00
Collecting & Pricing Yard Sale Items
Elder Law with Attorney, Jacqueline Byrd . . . . . . . . . . 10:30
Collecting & Pricing Yard Sale Items
Visit the Nurse . . . . . . . . . . . 10:00
Collecting & Pricing Yard Sale Items
Bingo . . . . . . . . . . . . . . . . . . 10:30
Collecting & Pricing Yard Sale Items
30 31
Week-Long Yard Sale . .9:00-2:00St . Charles Senior Club . . . . 10:00
Week-Long Yard Sale . .9:00-2:00 July
roAD TriP! Bowie Baysox Senior Bingo & BuffetWatch a Bowie Baysox vs. Akron Aerosgame indoors while playing bingoand winning special prizes. Plus… a two-hour lunch buffet featuring fruit salad,chicken salad, bread, pulled chicken BBQ, hotdogswithfixings,bakedbeans,chips,cookies,anddrinks.Transportation provided by Senior Services of CharlesCounty,Inc.SupportedbyWaldorfSeniorCenterCouncil.
Mon, Jul 9 Fee: $20/personDepart Center at 9:30am / Return no later than 3:00pm
explore Your Family HistorySearchforyourancestorswiththehelpofAncestry.com and MsComputerWiz, Roseanne Windley.One-on-one instruction will help you navigateAncestry.com,buildafamilytree,savepicturesanddocuments,exportafamilytree,andmuchmore.Youmayregisterforoneormorehours.CallorstopbytoRSVP.Offeredonlyondatesshown.
Mon, Jul 2 & Jul 16 9:00am-2:00pmFee: $15/hr
Fitness & Dance
PilatesStrengthens the back,abdominalmuscles, andhips. Instructor: DebiShanks.
Mon, Ongoing 2:00pmFee: Fitness Card
Hatha YogaSimpleposesforstrengthand balance. InstructorRandiMcWilliams
Tue, Ongoing 2:00pmFee: Fitness Card
Zumba GoldSame lively and funZumbathatyoulove,butwithslowerrhythmspe-cificallydesignedfortheolder adults. Instructor:JanStephenson
Wed, Ongoing 9:00amFee: $30/10 classes; $3 drop-in
AFeP Low-impact seatedexercise. Center StaffInstructors.
Wed/Th, Ongoing 10:00amFee: FREE
line DancingPopular and classic linedances.Instructor:CindyBladen.
Tue, Ongoing 10:15amFee: Fitness Card
Total Body ConditioningStrength, endurance,andflexibility.Instructor:ClairisaBryant.
Tue/Th, Ongoing 9:00amFee: Fitness Card
10 July2012•www.CharlesCountyMD.gov
Senior newS Get your Latest SCOOP online!Visit www.CharlesCountyMD.gov/CS
Treasure the ChesapeakeIn August, Senior Centerswill host a special day of eventsaimed at educating and celebrating life in and around theChesapeakeBay.Asidefrombeingagreatsourceforseafoodandrecreation,thebayisavaluableenvironmentalresource,vitaltoabalancedecosystem.
The Chesapeake Bay is North America’s largest estuary (anareawherefreshandsaltwatermix)andtheworld’sthirdlarg-est.Fromnorthtosouth,theBayisroughly200mileslong.
The day includes a delicious luncheon of cranberry juice,ovenfriedchicken,crabcake,cornonthecob,pacificblendvegetables,dinnerroll,tastydessert,andicedtea.
Details foreventsateachCenterarecoming in theAugustSCOOP. Eventswill takeplaceonThursday,August 23, andreservationsarerequired.
Healthy HydrationSummerishere,anditismoreimportantthaneverthatwedrinkourwater tohelpkeepourbodieshydrated.Water isnecessaryforthehealthyfunctionofallinternalorgans,andmustbeconsumedtoreplacetheamountlosteachdaydur-ingbasicactivities.
Inonehourofexercisethebodycanlosemorethanaquartofwater,dependingonexercise intensityandair tempera-ture.Ifthereisnotenoughwaterforthebodytocoolitselfthroughperspiration,thebodyentersastateofdehydration.Itisimportanttoknowthesignsandsymptomsofdehydra-tionandseekmedicalassistanceifyouareexperiencinganyofthefollowingsymptoms:
• Thirst• Decreasedurination• Feelingmoretiredthan
usual• Drymouth
• Chills• Dryskin• Increasedheartrateand
respirations• Musclecramps
To meet your daily hydration needs:
• Drinkaglassofwaterfirstthinginthemorning
• Duringhotweatherdrinkextrawater
• Drinkwaterduringleisuretimes;whileread-ing,watchingTV,andresting
• Drinkwaterbefore,dur-ingandafterexercise
• Drinkaglassofwaterwitheachmeal
• Drinkaglassofwaterbeforegoingtobed
Themostimportanttiptorememberaboutstayinghydratedduringthehotsummermonthsistocarryabottleofwaterwithyouatalltimesanddrinkbeforeyouarethirsty!
Elaine Kackley, Wellness Coordinator
eight Signs of elder AbusePayingattentiontocluesthatsomething’swrongwithanelderlyfriendor relative can pay off. The trick is to recognize the clueswhen theyappearandactfast.Whichsignalsshouldyoubeonthealertfor?Whilethesechangesdon’talwaysmeansomethingsinisterishappeningtheycanbeanindication.Look for:
• Anunexplainedchangefortheworseintheperson’sstandardofliving.
• Amarkeddifferenceinpersonalityorhabitsthatcoincidewiththearrivalofanewfriend,romanticinterest,caretakerorevenarelative.
• Changesinlong-standingfinancialarrangements,suchasanewwillorcashedCD.
• Forgeddocuments
• Signsthepersonisn’twellcaredforincludingchangesinhealth,personalhygiene,eat-inghabitsorsurroundings.
• Unexplainedchargesoncreditcardsorwithdrawalsfrombankaccounts.
• Thedisappearanceofjewelryorothervaluableitems.
• Substandardorunneededservices,suchasunnecessaryhomerepairs.
Scams targeting seniors can range from the simply ridiculous to thesublimelycomplicated.Expertssaythebestwaytokeepthievesoutofgrandmaandgrandpa’spocketbookistoknowwhat’soutthere.
Chicken Blueberry SaladItismuchlighterthanregularpastasaladandtakesadvantageoffreshblueberrieswhicharegreatinthesummer.Couldbeasidedishorgreatasaquicklunchordinner.Makes6servings.
Ingredients
• 1lbofskinlesschickenbreastcookedandchopped
• 8ozofwholewheatcorkscrewpastacookedanddrained
• 3tbsoliveoil
• 1shallotsliced
• 1/3supreducedsodiumchickenbroth
• 1/3cupfetacheese
• 3tbslimejuice
• 1cupfreshblueberries
• 1tbsthymefreshordried
• 1/4tspsalt
• 1tsplimezest
Directions
Place cooked chicken and cookedpasta into a large bowl. Then in asmallskilletsautetheshallotintheoliveoiluntilsoft,orabout3min.
Totheskillet,addthebroth,fetaandlimejuiceandcookuntilthefetabeginstomelt,orabout2min.
Pourthesauceoverthepastaandchickenandthenaddtheblueberries,thyme,salt,andlimezestandtoss.Serveimmediatelyorrefrigerate.
Perserving:310calories,11gmfat,33carbs,23gmprotein,and5gmfiber
Senior CenTer Menu Lunch Cancellation PolicyIf you have a lunch reservation and cannot dine at the Center, please call the Senior Center PRIOR to the reservation day to cancel your meal. If the
meal is not cancelled, the County must still pay for the meal.
July
Monday Tuesday Wednesday Thursday Friday
2 3 4 5 6
Fruit Blend JuiceBeef Stew with Vegetables
(1½ cup)Spinach Salad
Whole Wheat BreadSeedless Grapes
Florida Orange JuiceNE Claim Chowder
N.Carolina BBQ Pork SandwichBoston Baked Beans
Cape Cod BlendHawaii Fruit SaladGeorgia Peach Pie
independence day holiday
senior cenTers closed
Apple JuiceHot Dogs with RollParty Hearty Beans
ColeslawDeluxe Fruit Salad
Cherry Pie
Grape JuiceFish Sandwich
Hawaiian Baked BeansChuckwagon Vegetables
Peaches
9 10 11 12 13
Orange JuiceStuffed CabbageMashed PotatoesSeasoned Corn
Tropical Fruit Salad
Apple JuiceChicken MarsalaParsley PotatoesBaby Sweet Peas
Whole Wheat BreadApricots
Orange JuiceBBQ Beef Cubes
Fluffy RiceBroccoli
Whole Wheat BreadFruit Cocktail
soup & sandWich day
Italian Wedding SoupCranberry Juice
Turkey Sandwich on Whole Wheat Bread
Lettuce/TomatoMetro Salad
Fresh Apple Slices
Grape JuiceMeat Lasagna
Three Bean SaladPacific Blend Vegetables
Dinner RollBanana
16 17 18 19 20
Pineapple JuiceSwedish MeatballsButtered Noodles
Fiesta Vegetable Blend Whole Wheat BreadTangy Cherry Salad
Orange Juice¼ Baked Chicken
Au Gratin PotatoesOrange Glazed Carrots
Garden Salad w/DressingCantaloupeCarrot Cake
LS Tomato JuiceBeef Brisket
Roasted Baby PotatoesCranberry Salsa SaladWhole Wheat Bread
Honeydew
Apple JuiceOven Fried ChickenBaked Sweet Potato
Corn on the CobGreen BeansDinner Roll
Orange Sections
Pineapple JuiceMeatloaf with Gravy
Mashed PotatoesBroccoli
Whole Wheat BreadPears
23 24 25 26 27
Apple JuiceStuffed PeppersCheesy Potatoes
Asian Blend VegetablesWhole Wheat Bread
Citrus Salad
Grape JuiceMac & Cheese (1 cup)Scalloped Tomatoes
ColeslawFruited Jello
Cranberry JuiceLiver & Onions
Fiesta Vegetable BlendFlorentine Bowtie Pasta
SaladCornbread
Deluxe Fruit Salad
BirThday celeBraTion
Orange JuiceAsian Chicken
Fluffy RiceCarrot Raisin Salad
Whole Wheat BreadRaisins
Birthday Cake
Pineapple JuiceMeat Chili with Beans
Buttered NoodlesCreamy Cucumber Salad
CornbreadFresh Apple Slices
30 31Pineapple Juice
Chophouse Burger on RollGerman Potato Salad
Cucumber Onion VinaigretteApricots
Cranberry JuiceTortilla Crusted TilapiaMashed Sweet Potato
Garden Salad w/DressingWhole Wheat Bread
Banana
Charles County Luncheon Program Available at Noon • Days Vary By CenterOpen to any Charles County resident, age 60 or older, for a donation. The suggested meal donation is $3, actual cost is $5.50 per person. All donations are used to provide meals for Charles County seniors. Guests (anyone age 59 or younger, or a non-county resident) may order lunch, but must pay the full price of $5.50. Lunch reservations must be made by 10:00am the preceding day. We appreciate your assistance in keeping costs down. Party and special event meal prices may vary.
Clark Senior Center . . . . . . . . . . . . . . . . . . . . . . . . Tue-Fri Nanjemoy Senior Center . . . . . . . . . . . . . . . . . Mon-ThuIndian Head Senior Center . . . . . . . . . . . . . . . . Mon-Fri Waldorf Senior Center . . . . . . . . . . . . . . . . . . . Mon-Thu
Ondayswherepotatoes,corn,beans,and/orpeasareusedforthemeal'sstarchcomponent,anadditional
starchsuchasbread,crackers,ormuffinsisavailableforthoseparticipatinginthe
CACFPprogram.
1% Milk Included With All Meals
The information contained in this monthly publication has been brought to you as a public service by the Charles County Department of Communit y Ser vices . For more information about news for Charles County senior citizens, please contact the Richard R. Clark Senior Center at 301-934-5423 or 301-870-2015.
Charles County Commissioners
The SCOOP
Equal Opportunity County
Learn more at…www.CharlesCountyMD.gov
Department of Community Services8190 Port Tobacco Road • Port Tobacco, MD
301-934-9305 • 301-870-3388MD Relay: 711 • Relay TDD: 1-800-735-2258
Mission Statement – The mission of Charles County Government is to provide our citizens the highest quality service possible in a timely, efficient, and courteous manner. To achieve this goal, our government must be operated in an open and accessible atmosphere, be based on comprehensive long- and short-term planning, and have an appropriate managerial organization tempered by fiscal responsibility.
Vision Statement – Charles County is a place where all people thrive and businesses grow and prosper; where the preservation of our heritage and environment is paramount; where government services to its citizens are provided at the highest level of excellence; and where the quality of life is the best in the nation.
Americans With Disabilities – The Department of Community Services welcomes the participation of individuals with disabilities. As with all County Government, we comply fully with the Americans With Disabilities Act in making reasonable accommodations to encourage involvement. If you require special assistance and would like to participate in our programs, please contact the Department of Community Services.
Publication Changes & Cancellations Programs and activities have been confirmed at the time this publication goes to press. However, changes or cancellations can occur. For information, check with the Senior Center that has scheduled the program.
Senior Center Inclement Weather PolicyWhen Charles County Public Schools are closed due to inclement weather, Charles County's Senior Centers will also be closed. Senior Centers do not necessarily open late or close early as with Charles County Public Schools. Please tune your radio to 1560AM or 98.3FM for closing announcements. Community Services will also provide closing information as soon as possible through the Inclement Weather Hotline. Call 301-934-9305 or 301-870-3388 and immediately press extension 5197 for delays and cancellation listings.
Canada & new england 9 Days/8 nightsGetonboardtheEnchantmentoftheSeasinBaltimoreandheadoutforaroundtriptour of Canada and New England. VisitPortland, Bar Harbor, Saint John (Bay ofFundy), and Halifax. Day seven and eighttakes you back to sea providing time toenjoyalloftheship'samenitiesbeforere-turningtoBaltimore.PassportRequired.
Trip Date: Sep 6Cabin Range: $993/pp; $1,863/pp dblDeposit: $350/pp double occupancy; or $700/pp single occupancy due at sign up Balance Due: May 23
Southern Caribbean13 Days/12 NightsStops at Tortola, British Virgin Islands,known for their white sandy beaches; StJohn’s Antigua where you can snorkel,scuba dive or just relax; St. Maarten; St.Thomas; Puerto Rico; and finally Haiti.Enjoywalking tours,beaches, restaurants,and shopping. Thosewho book early getthebestcabinlocations.
Trip Date: Feb 25-Mar 9, 2013Cabin Range: $1,076-$1,901/pp dblDeposit: $550/pp double occupancy; or $1,100/pp single occupancy due at sign upBalance Due: Oct 21, 2012
Toby’s Dinner Theatre
legally Blonde…The MusicalColumbia, MD
Thismuchfunshouldn’tbelegal!Basedonthehitmovieofthesamename,LegallyBlonde,theMusicalistheaward-win-ning Broadway sensation. This all singing, all dancing, feelgoodmusicalcomedywillbethehighlightofyouryear.
Wed, Aug 8303112-TR • Registration Deadline: Jul 7Departure: Clark Senior Ctr 8:25am, and
Waldorf Jaycees 8:45amEst. Return: 5:30pm
Trip Fee: $82
Community Service offers even more trips! Check them out online at:
www.CharlesCountyParks.com
Senior Services TripsFor reservations or more information please call 301-645-2800.
Royal Caribbean Cruises Aboard the Enchantment of the Seas!
Community Services Senior TripsFor information please call 301-934-9305 or 301-870-3388, ext. 5159.
Online registration is available at www.CharlesCountyParks.com