dpm dictionary€¦ · xls file · web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3...

1204
# 1

Upload: duongnhi

Post on 24-May-2018

246 views

Category:

Documents


3 download

TRANSCRIPT

Page 1: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

#1

Page 2: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Modifications in the DPM dictionary comparing to 2.1.0 releaseChange to the datatype of NB domain (from integer to string)

Color conventionNew information. For example new metrics, dimensions, domain members, hierarchies.Information change (other than label). For example worksheets containing new or change information.Deleted information (e.g. validity date removed for concepts that need to be used).Concept label change or technical reorganization of hierarchy not affecting instance comparability.

Page 3: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Release2.2.0 PWD Comments:

1. Detailed changes log for 2.2.0 PWD release (comparing to 2.1.0 release) is provided as a separate file in the publication package.

Page 4: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

# Owner Code Owner name Prefix Namespace1 s2c Solvency II - Common s2c http://eiopa.europa.eu/xbrl/s2c2 s2hd EIOPA HDT s2hd http://eiopa.europa.eu/xbrl/s2hd3 s2md EIOPA MDT s2md http://eiopa.europa.eu/xbrl/s2md4 eu Eurofiling eu http://www.eurofiling.info/xbrl

Page 5: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Root location Commenthttp://eiopa.europa.eu/eu/xbrl/s2chttp://eiopa.europa.eu/eu/xbrl/s2hdhttp://eiopa.europa.eu/eu/xbrl/s2mdhttp://www.eurofiling.info/eu/fr/xbrl

Page 6: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

# Domain code/name Domain label Domain type Owner1 met Metrics primary s2c2 BC Basic concepts explicit s2c3 MC Main categories explicit s2c4 AM Amount types explicit s2c5 VM Valuation methods explicit s2c6 DI Instant or duration explicit s2c7 TR Treatment of risk mitigation explicit s2c8 TB Type of businesses explicit s2c9 PU Purposes of assets/portfolio explicit s2c

11 SE Sectors explicit s2c13 CG Collaterals/Guarantees explicit s2c14 LB Lines of businesses explicit s2c15 EL Eligibility explicit s2c16 CS Consolidation scopes explicit s2c17 CM Controlling or minority interests explicit s2c18 CU Currencies explicit s2c19 GA Geographical areas explicit s2c20 PI Percentage intervals explicit s2c21 TS Types of string explicit s2c22 LT Types of trigger explicit s2c23 TD Types of date explicit s2c24 NT Types of number explicit s2c25 BR Brackets explicit s2c26 PP Types of percentage explicit s2c27 DC Types of decimal explicit s2c28 CE Types of income statement concepts explicit s2c29 TI Time intervals explicit s2c30 RT Risk types explicit s2c31 SC Status of claim explicit s2c32 PC Product characteristics explicit s2c33 EX Exposure types explicit s2c34 AP Approaches used explicit s2c35 ID Codes typed s2c36 NA Names typed s2c37 NB Integer numbers typed s2c38 ER Ratings typed s2c39 RA Agencies typed s2c40 TY Types typed s2c41 BT Types of boolean explicit s2c42 TP Templates explicit s2c43 AO Article 112 and 167 explicit s2c44 CN Content explicit s2c45 TL Types of URI explicit s2c46 DO Datapoint Owner explicit s2c47 NC NACE explicit s2c48 LA Languages explicit s2c49 TF Time reference explicit s2c50 CA Currency conversion approach explicit s2c

Page 7: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Prefix Namespace Location Datatype Creation date Validity date Last modified7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

string 7/7/2014string 7/7/2014string 7/7/2014 7/15/2017string 7/7/2014string 7/7/2014string 7/7/2014

7/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014

9/30/20159/30/20159/30/2015

Page 8: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Comment

Page 9: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

# Dimensi1 BC2 AL3 TT4 GR5 AS6 LB7 OB8 LS9 OS

10 OZ11 OF12 PF13 VG14 TA15 DD16 VP17 AD18 TQ19 VM20 VL21 AG22 HH23 SY24 DU25 XS26 EA27 DI28 RR29 IT30 CC31 HS32 AX33 TU34 TR35 RX36 XL37 IY38 IO39 OU40 PO41 PS42 AR43 EZ44 CT45 SV46 SO47 IS48 LF49 AY50 AC

Page 10: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

51 CG52 LW53 FF54 OT55 TG56 CB57 BL58 RB59 TB60 HG61 TZ62 SX63 RZ64 CZ65 IU66 RI67 UC68 BE69 TX70 OE71 EI72 MS73 MX74 QX75 LV76 CS77 AA78 RO79 LZ80 SM81 IG82 LL83 OC84 CR85 CD86 RC87 UR88 UU89 CJ90 LA91 LX92 EE93 BI94 CY95 AH96 CW97 PI98 TS99 ZR

101 TD102 NT

Page 11: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

103 NB104 NZ105 PP106 DC107 TE108 PY109 DY110 RM112 HD114 FZ115 IZ116 RT117 TV118 HC119 SH120 AB121 DV122 SB123 SD124 CH125 AI126 LY127 US128 YP129 EX130 II132 IP133 IB134 HX135 RD136 RE137 FC138 CE139 IX140 ZS141 CI142 RF143 UB144 SI145 CA146 OV147 MM148 CP149 SZ150 CK151 UX152 NX153 IR154 CF155 FI156 LM

Page 12: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

157 LC158 CL159 ST160 OD161 GX164 AZ165 VN166 NP167 NS168 NR169 WW170 LP171 WX172 MZ173 ER174 RA175 LT176 LD177 NF178 XA179 XB180 XC181 XD182 XE183 XF184 XG185 XH186 XI188 XK189 XM190 XN191 XO192 XU193 XP195 BX196 UG197 TP198 IC199 GC200 UI201 CO202 GO203 AO204 HO205 RY206 CN207 TL208 SU209 PN210 TC211 CV

Page 13: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

212 PC213 TH214 QS215 DO216 NC217 LI218 FN219 SN220 MT221 MP222 CX223 LR224 IW225 TF226 VV227 UW228 AE229 UD230 VI231 TM232 LN233 VB234 TK235 FM236 LE237 XR238 TO239 UH240 AT241 EN242 XT243 XZ244 LG245 DA246 DL247 DE248 DB249 RS250 IA251 FR252 NA252 CM252 AF253 DF254 XY255 ET256 YA257 YB258 YC259 YD260 YE

Page 14: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

261 YF262 LH263 YG264 YH265 YI266 YJ267 YK268 YL269 YM270 YN271 YO272 YR

Page 15: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Dimension labelBasic conceptsType of assets and/or liabilitiesType of transactionTypes of guarantees received [on- and off- balance]Type of assetsType of liabilitiesType of off balance sheets conceptsLong or short positionsTypes of sum insuredSum insured by the reporting entity including technical provisions [other than local GAAP specific]Own fundsTypes of performanceValuation generalTypes of amountDiscounted or undiscountedValuation of provisionsProspective or retrospectiveType of capital requirementValuation methodValuation of provisions [general]Changes in own fundsChanges in technical provisionsStatus of share payment, initial fund or mutual members accountDated or undatedChanges in excess of assets over liabilitiesSCR calculationInstant or durationValuation of recoverablesTreatment of risk mitigationCeded and not cededTypes of hedging strategiesApplicable standardType of underwriting modelTypes of reinsurance [traditional or not]Type of reinsurance treatyXL premiumsInsurance/tradeInvestment or own useTreatment of participations in relation to own fundsPortfolioPurposeSecuritisation assets related and not related to cedant held in trust with other third party than cedaRole of reporting entity in repo or securities lendingCounterpartiesReinsurance counterpartiesEntities under consolidationIssuer sectorLegal formActivity of brokerSPV authorisation conditions

Page 16: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Collateral/GuaranteeBeing collateral or notSPV sufficiently collateralised or notCapital protectionTypes of guaranteeInsurance classesLine of business [general]Related line of businessInsurance/reinsurance businessHomogenous risk groupsType of activityProduct with surrender option or notTypes of contractsProducts commercialized or notType of premiumReplication of product by a financial instrumentType of structured productsSolvency II own funds eligibilityTiersTypes of equityTreatment in relation to ring fencingAvailability to meet SCR criteriaAvailability to meet MCR criteriaConsolidated capital requirement or soloCounting under transitionalsConsolidation scopeAvailability of excess of assets over liabilities for RFF or MPRelation to groupLevel of influenceGroup solvency assessment [method chosen]Treatment of intra-group transactionsMinority or controlling interestsOriginal/exposure currencyCurrency receivedCurrency delivered/settlement/obligation currencyReporting currencyPlacement currency/currency of contractOriginal currency of underlyingCountry of custodyLocalization of activity [based on place of underwriting]Localization of activity [based on localization of risk]EEA or not EEACountries by amount of gross premiums writtenIssuer country/country of residenceCountry of authorisationRegionsThresholdTypes of stringTypes of triggering eventsTypes of datesTypes of number

Page 17: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Number of bracket [loss distribution]Number of bracket [risk portfolio]Types of percentageTypes of decimalTypes of income/expensesProjected yearsDevelopment yearsPrevious months/yearsTypes of hedged risksRisks inside or outside ring fenced fundsAcceptance/cover of risksRisk typesTreatment of componentsHedge applicationScenarios related to hedgingRisk scenarioDiversification of risk [on indicated level of risk aggregation]Status of claim at a beginning of periodStatus of claim at the end of periodChange of status during the periodType of claimCallable or PutableUnderlying securityPrepayments for structured productsExposure typesStandard or internal modelID code of productID code of underlyingID code of HRGRisk identification codeReinsurance program codeFacultative reinsurance placement identification codeIdentification code of entityIdentification code of investor/buyer/transferee/payer/reinsured/beneficiaryIdentification code of issuer/seller/transferor/receiver/reinsurer/providerCode of guaranteeCode reinsurerS.23.04.zz.03 line identificationS.23.04.zz.04 line identificationCode brokerCode of SPVS.23.04.zz.01 line identificationS.23.04.zz.02 line identificationS.23.04.zz.05 line identificationS.23.04.zz.06 line identificationCode of group of debtor pledging the collateralCode of componentID of counterparty [in repo/securities lending]CIC codeProduct classification IDCIC code [third digit] of most significant collateral

Page 18: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Limited CIC codeComposite limited CIC code of underlyingSection code in the treatyTreaty identification codeID of intragroup transactionGroup identification codeName of vesselName of platformName of reinsured entityName of related partyName of debtor pledging the collateralProgressive number of surplus/layer in programType of asset for which collateral is heldNature of exposureExternal ratingRating agencyLoss-absorbing capacity of technical provisionsLoss-absorbing capacity of deferred taxesNumber of fundS.06.02.zz.01 line identificationS.08.01.zz.01 line identificationS.08.02.zz.01 line identificationS.09.01.zz.01 line identificationS.06.03.zz.01 line identificationS.10.01.zz.01 line identificationS.11.01.zz.01 line identificationS.14.01.zz.01 line identificationS.15.01 line identificationS.30.02 line identification, non-lifeS.30.02 line identification, lifeRe-J2 line identificationS.31.01 line identificationS.31.02.zz.01 line identificationS.30.03 line identificationTypes of booleanNot recognized diversification of risk [on indicated level of risk aggregation between RFF and remainiTemplatesIssuer IDIssuer Group IDURICounterparty IDCounterparty Group IDArticle 112Home CountryReporting CountryContentTypes of URITypes of instruments or transactionsProportional or Non-proportionalType of collateralCode collateral/guarantee provider

Page 19: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Collateral portfolioTypes of Asset for which collateral is heldCredit Quality StepDatapoint OwnerNACELanguagesFund/Matching portfolio NumberSub Fund/Portfolio NumberMaterialMatching portfolio numberCode collateral/guarantee receiverLocation of the branchCode of underlying derivativeTransitional measure on technical provisionsTransitional adjustment on Technical ProvisionsUse of undertaking specific parametersArticle 304USP Standard Deviation gross/netImpact of the long term guarantees and transitional measuresIdentification of material investmentsLegal nature of SPVImpact on Assets/Liability/Off Balance SheetTime referenceFuture management actions regarding technical provisions and/or deferred taxesLife/non-life activityS.07.01.zz.01 line identificationTotal line of business or by currencyRecognized diversification of risk [on indicated level of risk aggregation between RFF and remaining]Article 167EncumbranceS.02.03.zz.03 line identificationE.01.01.zz.01 line identificationLocalization of activityDescription of the material class of assetsDescription of the material class of liabilitiesDescription of the material equity itemsDescription of the off-balance sheet obligationRisk arrangement codeIssues/ uses commenced prior to implementationCompliance with the fully funded requirement for the arrangementName of a branch included under Article 167Method of consolidationCurrency conversion approachDescription of the off-balance sheet itemS.23.04.zz.10 line identificationTypes of equityS.36.01.zz.01 line identificationS.36.02.zz.01 line identificationS.36.03.zz.01 line identificationS.36.04.zz.01 line identificationS.30.04.zz.01 line identification

Page 20: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

S.37.01.zz.01 line identificationLong term guarantees transitionals and measures adjustmentsS.23.04.zz.01 line identificationS.23.04.zz.02 line identificationS.23.04.zz.03 line identificationS.23.04.zz.04 line identificationS.23.04.zz.05 line identificationS.23.04.zz.06 line identificationT.99.01.01.01 line identification (Table)T.99.01.01.01 line identification (X axis)T.99.01.01.01 line identification (Y axis)T.99.01.01.01 line identification (Z axis)

Page 21: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable domain code Owner Dimension in MD Closed Restriction on content PrefixBC s2cMC s2cMC s2cMC s2cMC s2cMC s2cMC s2cMC s2cMC s2cMC s2cMC s2cMC s2cAM s2c yesAM s2c yesAM s2cAM s2cAM s2c yesAM s2cVM s2c yesVM s2c yesVM s2c yesVM s2c yesVM s2cVM s2cVM s2cVM s2c yesDI s2c yesVM s2cTR s2cTB s2cTB s2cAM s2c yesTB s2cTB s2cTB s2cAM s2cPU s2cPU s2cPU s2cPU s2cPU s2cPU s2cTB s2cSE s2cSE s2cSE s2c yesSE s2cSE s2cTB s2cTB s2c

Page 22: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

CG s2cCG s2cCG s2cCG s2cCG s2cLB s2cLB s2c yesLB s2c yesLB s2c yesLB s2cLB s2c yesLB s2cLB s2c yesLB s2cLB s2cLB s2cLB s2cEL s2cEL s2c yesEL s2c yesEL s2cEL s2cEL s2cCS s2cEL s2c yesCS s2c yesEL s2cCS s2cCS s2cCS s2cVM s2cCM s2cCU s2c yesCU s2c yesCU s2c yesCU s2c yesCU s2cCU s2cGA s2cGA s2c yesGA s2c yesGA s2c yesGA s2c yesGA s2cGA s2cGA s2cPI s2c yesTS s2cLT s2c yesTD s2cNT s2c

Page 23: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

BR s2c yesBR s2c yesPP s2cDC s2cCE s2cTI s2c yesTI s2c yesTI s2c yesRT s2c yesRT s2cRT s2c yesRT s2c yesRT s2cCG s2c yesRT s2cRT s2cRT s2c yesSC s2cSC s2cSC s2cSC s2cPC s2cPC s2cPC s2cEX s2c yesAP s2cID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/a

Page 24: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aNA s2c n/aNA s2c n/aNA s2c n/aNA s2c n/aNA s2c n/aNB s2c n/aTY s2c n/aTY s2c n/aER s2c n/aRA s2c n/aVM s2cVM s2cID s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aBT s2cRT s2cTP s2cID s2c n/aID s2c n/aID s2c n/aID s2c n/aID s2c n/aAO s2c yesGA s2cGA s2cCN s2cTL s2cMC s2c yesTB s2cMC s2cID s2c n/a

Page 25: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

CG s2cMC s2cBR s2c yesDO s2cNC s2cLA s2cID s2c n/aID s2c n/aAP s2c yesID s2c n/aID s2c n/aGA s2c yesID s2c n/aAP s2cVM s2cAP s2cAP s2cAP s2cVM s2c yesTB s2cSE s2cVM s2cTF s2c yesAP s2cTB s2c yesNB s2c n/aLB s2cRT s2cAO s2cCG s2c yesNB s2c n/aNB s2c n/aGA s2c yesNA s2cNA s2cNA s2cNA s2cID s2c n/aAP s2cAP s2cNA s2cCS s2c yesCA s2c yesNA s2cNB s2c n/aEX s2c yesNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/a

Page 26: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

NB s2c n/aVM s2cNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/aNB s2c n/a

Page 27: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Namespace Creation date Validity date Last modified Comments7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

Page 28: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 9/30/20157/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/2014 7/15/20167/7/2014 9/30/20157/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/2014 9/30/20157/7/2014 12/31/20137/7/2014 12/31/2013 Not used any more7/7/20147/7/2014 12/31/2013 Not used any more7/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/2014

Page 29: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/2017 7/15/20167/7/2014 7/15/2017 7/15/20167/7/20147/7/20147/7/2014 7/15/2017 7/15/20167/7/2014 7/15/2017 7/15/20167/7/2014 7/15/2017 7/15/20167/7/2014 7/15/2017 7/15/20167/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

Page 30: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/2014 9/30/20157/7/2014 9/30/20157/7/20147/7/2014 7/15/20167/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/2014 7/15/20167/7/2014 7/15/20167/7/2014 7/15/20167/7/2014 7/15/20167/7/2014 7/15/20167/7/2014 7/15/20167/7/2014 7/15/20167/7/2014 7/15/20167/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 7/15/20167/7/2014 12/31/20137/7/20147/7/2014 9/30/20157/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 9/30/20157/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 9/30/2015

Page 31: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/2014 12/31/2013

9/30/2015 12/31/20139/30/20159/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/20159/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/20159/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/20159/30/2015 12/31/20139/30/20159/30/2015 7/15/20169/30/2015 12/31/20139/30/20159/30/2015 12/31/20139/30/20159/30/2015 7/15/20169/30/2015 7/15/20169/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/20159/30/20159/30/20159/30/2015 7/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/2017

Page 32: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/2017

Page 33: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label NameMonetary mi1String si2Date di3Integer ii4Decimal pi5Percentage pi6Boolean bi7Type of capital requirement ei8Aggregation of capital requirement ei9Level of influence ei10Category ei11Composite undertaking ei12Type of undertakings (Preparatory scope) ei13Loss-absorbing capacity of deferred taxes ei14Long or short position (open) ei15Loss-absorbing capacity of technical provisions ei16Asset pledged as collateral ei17Participation (Group) ei18Reporting country ei19Model used ei20Currency used for reporting (Preparatory scope) ei21Country of authorisation ei22Inclusion in the scope of Group supervision ei23Valuation method ei24Valuation method (derivatives) ei25Swap received currency ei26Country of custody (including not applicable) ei27Geographical zone of issue ei28Use of derivative (Preparatory scope) ei29Participation (Solo) ei30Long or short position (closed) ei31Issuer Country (including not applicable) ei32Issuer country/country of residence ei33Link ti34CN/All members [1] ei35CN/All members [2] ei36CN/All members [3] ei37CN/All members [4] ei38CN/All members [5] ei39CN/All members [6] ei40CN/All members [7] ei41CN/All members [8] ei42CN/All members [9] ei43CN/All members [10] ei44CN/All members [11] ei45CN/All members [12] ei46CN/All members [13] ei47URI ui48RFF (Preparatory scope) ei49Consolidation method 1 used for group solvency assessment of at least one undertaking in the scopei50

Page 34: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Scenario A or B ei51Pure pi52Held in unit linked and index linked funds ei53Original currency of exposure/transaction/instrument ei54Swap delivered currency ei55Unwind trigger of contract ei56Method of group solvency calculation used (contribution to group TP) ei57Group solvency assessment [method chosen and under method 1, treatment of the undertaking] ei58Portfolio (investment, securities lending and repo) (Preparatory scope) ei59Portfolio (derivatives) ei60RO/All members [11] ei61Ancillary Own Funds ei62UU/All members [2] ei63Type of structured product (Preparatory scope) ei64AS/All members [5] ei65UR/All members [1] ei66Finite reinsurance or similar arrangements ei67VG/All members [1] ei68AC/All members [5] ei69AH/All members (Not applicable/All geographical areas) [1] ei70TT/All members (Equity-type, debt and asset transfer) [3] ei71TT/All members (Cost sharing, contingent liabilities [other than derivatives] and off-balance sheet i ei72TT/All members (Derivatives) [3] ei73ZR/All members [1] ei74Currency - Local or foreign ei75Activity code broker (Preparatory scope) ei76Type of repo/securities lending; Buyer or seller/Lender or borrower ei77Issuer sector ei78Capital protection ei79Underlying security ei80Callable or Putable ei81Synthetic structured product (Preparatory scope) ei82Prepayments for structured products ei83Use of financial instrument for replication ? (Y/N/P) ei84Type of premium (Preparatory scope) ei85Country of custody ei86Line of Business (Life and Health SLT) ei87Products commercialized or not ei88Types of hedging strategies ei89Type of reinsurance contract/treaty (Preparatory scope) ei90Type of underwriting model (SI, MPL, PML, EML or Other) ei91Placement currency/currency of contract ei92Line of business (Preparatory scope) ei93XL premium flat ei94AR/All members [11] ei95FF/All members [4] ei96ZR/All members [4] ei97Proportional ei98VG/All members [9] ei99AC/All members [7] ei100BL/All members (Total/NA) [8] ei101

Page 35: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

AH/All members (Not applicable/All geographical areas) [5] ei102Type of IGT (Derivatives) (Preparatory scope) ei103Type of IGT (Equity-type, debt and asset transfer) (Preparatory scope) ei104Type of IGT (Cost sharing, contingent liabilities [other than derivatives] and off-balance sheet item ei105Type of reinsurer (Preparatory scope) ei106Undertaking type ei107Types of guarantee (Preparatory scope) ei108Type of collateral (if applicable) ei109Collateral portfolio ei110Types of Asset for which collateral is held (Preparatory scope) ei111Credit quality step (Preparatory scope) ei112Relation to group (guarantees received) ei113Relation to group (guarantees given) ei114Types of triggering events of guarantee (guarantees received) ei115Types of triggering events of guarantee (guarantees given) ei116Basic Information ei117Balance Sheet (SPV) ei118Assets and liabilities by currency (Preparatory scope) ei119List of assets (Preparatory scope) ei120Open derivatives (Preparatory scope) ei121Life and Health SLT Technical Provisions (Preparatory scope) ei122Non-Life Technical Provisions (Preparatory scope) ei123Own funds (Preparatory scope) ei124Solvency Capital Requirement - SF (Preparatory scope) ei125Solvency Capital Requirement - PIM (Full scope) ei126Solvency Capital Requirement - IM (Full scope individual) ei127Solvency Capital Requirement - Market risk (Preparatory scope) ei128Solvency Capital Requirement - Counterparty default risk (Preparatory scope) ei129Solvency Capital Requirement - Life underwriting risk (Preparatory scope) ei130Solvency Capital Requirement - Health underwriting risk (Preparatory scope) ei131Solvency Capital Requirement - Non-Life underwriting risk (Preparatory scope) ei132Solvency Capital Requirement - Operational risk (Preparatory scope) ei133Solvency Capital Requirement - Non-Life Catastrophe risk (Preparatory scope) ei134Minimum Capital Requirement ei135Minimum Capital Requirement - Composite ei136Entities in the scope of the group ei137(Re)insurance Solo requirements ei138Non-(re)insurance Solo requirements ei139Group - contribution of TP ei140Accounting standard ei141Issuer sector - NACE ei142Basic Information - RFF and matching adjustment portfolios (Full scope individual) ei143Balance Sheet (Full scope individual) ei144Balance Sheet (Full scope group) ei145Basic Information - RFF and matching adjustment portfolios (Full scope group) ei146Assets and liabilities by currency (Full scope individual) ei147Assets and liabilities by currency (Full scope group) ei148Off-balance sheet items - general ei149Type of undertaking ei150Method of Calculation of the SCR ei151Regular/Ad-hoc submission (solo) ei152

Page 36: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Use of undertaking specific parameters (Individual) ei153Matching Adjustment ei154Volatility adjustment ei155Transitional measure on the risk-free interest rate ei156Transitional measure on technical provisions ei157Language of reporting ei158Initial submission or re-submission ei159Sub-group information ei160Accounting standards (Individual) ei161Accounting standards (Full scope) ei162Use of undertaking specific parameters (Group) ei163Method of group solvency calculation used (Basic information) ei164RFF,MAP or Remaining of a fund ei165RFF, MAP with sub RFF, MAP ei166Material ei167Article 304 ei168Premiums, claims and expenses by line of business (Individual) ei169Premiums, claims and expenses by country ei170List of assets (Full scope individual) ei171List of assets (Full scope group) ei172Collective investment undertakings - look-through approach (Individual) ei173Collective investment undertakings - look-through approach (Group) ei174Summary of assets ei175Open derivatives (Full scope individual) ei176Open derivatives (Full scope group) ei177Derivatives Transactions (Individual) ei178Derivatives Transactions (Group) ei179Life and Health SLT Technical Provisions (Full scope) ei180Life and Health SLT Technical Provisions (Full scope by country) ei181Non-Life Technical Provisions (Full scope) ei182Non-Life Technical Provisions (Full scope by country) ei183Off-balance sheet items - List of unlimited guarantees received by the undertaking ei184Off-balance sheet items - List of unlimited guarantees provided by the undertaking ei185Activity by country ei186Information on class 10 in Part A of Annex I of Solvency II Directive, excluding carrier's liability ei187Structured products (Individual) ei188Income/gains and losses in the period ei189Securities lending and repos (Individual) ei190Assets held as collateral (Individual) ei191Best estimate by currency and country - Life ei192Projection of future gross cash flows ei193Life obligations analysis ei194Description of the guarantees of variable annuities ei195Hedging of guarantees of variable annuities ei196Information on annuities stemming from Non-Life Insurance obligations ei197Best estimate by currency and country - Non Life ei198Projection of future cash flows ei199Non-life insurance claims ei200Development of the distribution of the claims incurred ei201Loss distribution risk profile ei202Non-life underwriting peak risks ei203

Page 37: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Non-life underwriting mass risks ei204Impact of long term guarantees and transitional measures ei205Projection of future cash flows (Best Estimate - Matching portfolios) ei206Information on the matching adjustment calculation ei207Information on the transitional on interest rates calculation ei208Overall calculation of the transitional on technical provisions ei209Detailed information by tiers on own funds (Full scope individual) ei210Annual movements on own funds (Full scope individual) ei212List of items on own funds (Group) ei214Participations held ei215Solvency Capital Requirement - Only SF (Full scope individual) ei216Solvency Capital Requirement - SF (Full scope group) ei217Solvency Capital Requirement - SF and PIM (Full scope group) ei218Solvency Capital Requirement - IM (Full scope group) ei219Solvency Capital Requirement - Market risk (Full scope individual) ei220Solvency Capital Requirement - Market risk (Full scope group) ei221Solvency Capital Requirement - Counterparty default risk (Full scope individual) ei222Solvency Capital Requirement - Counterparty default risk (Full scope group) ei223Solvency Capital Requirement - Life underwriting risk (Full scope individual) ei224Solvency Capital Requirement - Life underwriting risk (Full scope group) ei225Solvency Capital Requirement - Health underwriting risk (Full scope individual) ei226Solvency Capital Requirement - Health underwriting risk (Full scope group) ei227Solvency Capital Requirement - Non-Life underwriting risk (Full scope individual) ei228Solvency Capital Requirement - Non-Life underwriting risk (Full scope group) ei229Solvency Capital Requirement - Operational risk (Full scope individual) ei230Solvency Capital Requirement - Operational risk (Full scope group) ei231Solvency Capital Requirement - Simplifications (Full scope individual) ei232Solvency Capital Requirement - Simplifications (Full scope group) ei233Solvency Capital Requirement - Non-Life Catastrophe risk (Full scope individual) ei234Solvency Capital Requirement - Non-Life Catastrophe risk (Full scope group) ei235Excess of Assets over Liabilities ei236Excess of Assets over Liabilities - explained by investments and financial liabilities ei237Excess of Assets over Liabilities - explained by technical provisions ei238Detailed analysis per period - Technical flows versus Technical provisions ei239Facultative covers for non-life and life business basic data ei240Facultative covers for non-life and life business shares data ei241Outgoing Reinsurance Program basic data ei242Outgoing Reinsurance Program shares data ei243Share of reinsurers ei244Special Purpose Vehicles ei245IGT - Equity-type transactions, debt and asset transfer (Full scope individual) ei246IGT - Equity-type transactions, debt and asset transfer (Full scope group) ei247IGT - Derivatives (Full scope individual) ei248IGT - Derivatives (Full scope group) ei249IGT - Internal reinsurance (Full scope individual) ei250IGT - Internal reinsurance (Full scope group) ei251IGT - Cost Sharing, contingent liabilities, off BS and other items (Full scope individual) ei252IGT - Cost Sharing, contingent liabilities, off BS and other items (Full scope group) ei253Risk concentration ei254Portfolio (investment, securities lending and repo) (Full scope) ei255Infrastructure investment ei256

Page 38: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Underlying asset category ei257Currency of underlying ei258Provider of guarantee belonging to the same group ei259Receiver of guarantee belonging to the same group ei260Use of derivative (Full scope) ei261Unwind trigger of contract (Full scope) ei262Asset category ei263Collateral type ei264Type of structured product (Full scope) ei265Synthetic structured product (Full scope) ei266Sub RFF,MAP ei267Types of Asset for which collateral is held (Full scope) ei268Product classification ei269Type of premium (Full scope) ei270Ring-fenced fund/matching portfolio/remaining part ei271Types of guarantee (Full scope) ei272Line of Business (Full scope) ei273Delta hedged ei274Rho hedged ei275Gamma hedged ei276Vega hedged ei277FX hedged ei278Identification of the line of business ei279Line of business reported ei280Long or short position [open] ei281Long or short position [closed] ei282Type of underwriting model (Full scope) ei283USP Standard Deviation gross/net ei284Type of reinsurer (Full scope) ei285Type of reinsurance contract/treaty (Full scope) ei286Type of undertakings (Full scope) ei287Group solvency assessment (Full scope) ei288Tier ei289Credit quality step (Full scope) ei290Basis risk arising from risk-transfer structure ei291Basis risk arising from contractual terms ei292Entity Level/RFF or MAP/ Remaining Part ei293SPV fully funded in relation to cedant obligations ei294Identification of material investments held by cedant in SPV ei295Securitisation assets related to cedant held in trust with other third party than cedant / sponsor ei296Legal nature of SPV ei297Lines of Business SPV securitisation relates ei298Group or individual internal model ei299Type of IGT (Equity-type, debt and asset transfer) (Full scope) ei300Type of IGT (Derivatives) (Full scope) ei301Type of IGT (Cost sharing, contingent liabilities [other than derivatives] and off-balance sheet items ei302Type of reinsurance contract/treaty ITG (Full scope) ei303Nature of the exposure ei304Impact on: Assets / Liability / Off Balance Sheet ei305Type of Trigger(s) in the SPV ei306Counted under transitionals ei307

Page 39: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Method used to calculate the adjustment due to RFF/MAP nSCR aggregation ei308Consideration of the future management actions regarding technical provisions and/or deferred taxei309Swap delivered currency (for buyer) ei310Swap received currency (for buyer) ei311Currency used for reporting (Full scope) ei312RFF (Full scope) ei313SPV country of authorisation ei314SPV authorisation conditions ei315Method of group solvency calculation used ei316Issuing entity of the subordinated mutual members‘ accounts ei317Additional branch balance sheet information ei318Country of third country undertaking ei319Country of third country branch ei320Type of branch ei321Article 167 ei322Deposit Lodged as security in accordance with Article 162 2( e) ei323Confirmation that there are no rights of set off ei324Issuer Sector according to ESA 2010 ei325Country of residence for collective investment undertakings ei326Instrument classification according to ESA 2010 ei327Deposits to cedants - line-by-line reporting ei329Pension entitlements ei330Non-life Technical Provisions - reinsurance policies ei331Collective investment undertakings - look-through approach (Financial stability) ei332Securities lending and repos (Financial stability) ei333Solvency Capital Requirement - Only SF (Financial stability) ei334Duration of liabilities ei335Profit or loss sharing ei336Profit and Loss ei337Lapses (life business) ei338Risks assumed ei339Debt or other financing mechanism ei340Compliance with the fully funded requirement throughout the reporting period ei341Issues/uses commenced prior to implementation ei342Issuer sector (Full scope) ei344Detailed information by tiers on own funds (Full scope group) ei345Annual movements on own funds (Full scope group) ei346Balance Sheet (Full scope individual Ring-fenced fund/matching portfolio/remaining part) ei347Balance Sheet (Full scope group Ring-fenced fund/matching portfolio/remaining part) ei348Projection of future cash flows (Best Estimate - Matching portfolios) (Full scope Ring-fenced fund/mei349Information on the matching adjustment calculation (Full scope Ring-fenced fund/matching portfoliei350Valuation method (Full scope) ei351Instrument classification according to ESA 2010 (ECB add-on) ei352Participation (Full scope Individual) ei353Participation (Full scope Group) ei354Activity code broker (Full scope) ei355Country a branch included under Article 167 ei356Best estimate subject to volatility adjustment by country and currency ei357Own funds (Full scope individual) ei358Minimum Capital Requirement - Only life or only non-life insurance or reinsurance activity ei359Minimum Capital Requirement - Both life and non-life insurance activity ei360

Page 40: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Collateral portfolio (Full scope) ei361Valuation method (derivatives) (Full scope) ei362Premiums, claims and expenses by line of business (Group) ei363Structured products (Group) ei364Securities lending and repos (Group)[220] ei365Assets held as collateral (Group) ei366Own funds (Full scope group) ei367Balance Sheet (Finacial stability) ei368Premiums, claims and expenses by line of business (Financial stability) ei369Own funds (Finacial stability) ei370Entities in the scope of the group (Full scope) ei371(Re)insurance Solo requirements (Full scope) ei372Life and Health SLT Technical Provisions (Full scope Ring-fenced fund/matching portfolio/remaining ei373Non-Life Technical Provisions (Full scope Ring-fenced fund/matching portfolio/remaining part) ei374Issuer country (Full scope) ei375Issuer country/country of residence (Full scope) ei376Inclusion in the scope of Group supervision (Full scope) ei377Group - contribution of TP (Full scope) ei378List of assets (Financial stability) ei379List of items on own funds (Individual) ei380Simplifications - spread risk - bonds and loans ei381Captives simplifications - interest rate risk ei382Captives simplifications - spread risk on bonds and loans ei383Captives simplifications - market concentration risk ei384Simplifications - Counterparty default risk ei385Simplifications - mortality risk ei386Simplifications - longevity risk ei387Simplifications - disability-morbidity risk ei388Simplifications - lapse risk ei389Simplifications - life expense risk ei390Simplifications - life catastrophe risk ei391Simplifications - health mortality risk ei392Simplifications - health longevity risk ei393Simplifications - health disability-morbidity risk-medical expenses ei394Simplifications - health disability-morbidity risk-income protection ei395Simplifications - SLT lapse risk ei396Simplifications - health expense risk ei397Captives simplifications - premium and reserve risk ei398List of assets (Third country branches) ei399Collective investment undertakings - look-through approach (Third country branches) ei400Structured products (Third country branches) ei401Open derivatives (Third country branches) ei402Derivatives Transactions (Third country branches) ei403Securities lending and repos (Third country branches) ei404Assets held as collateral (Third country branches) ei405Life and Health SLT Technical Provisions (Third country branches) ei406Non-Life Technical Provisions (Third country branches) ei407Own funds (Third country branches) ei408Balance Sheet (Third country branches) ei409Premiums, claims and expenses by line of business (Third country branches) ei410Infrastructure investment [210] ei411

Page 41: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Product classification [210] ei412Portfolio (investment, securities lending and repo)[210] ei413Sub RFF, MAP [210] ei414RFF, MAP or Remaining of a fund [210] ei415Solvency Capital Requirement - Only SF (Full scope individual)[210] ei416Solvency Capital Requirement - SF (Full scope group)[210] ei417Assets and liabilities by currency (Full scope group)[210] ei418Line of Business (Full scope)[210] ei419Type of structured product (Full scope)[210] ei420Deposits to cedants - line-by-line reporting (Full scope individual)[210] ei421Best estimate subject to volatility adjustment by country and currency [210] ei422Premiums, claims and expenses by line of business (Individual)[210] ei423Own funds (Full scope individual)[210] ei424Balance Sheet (Finacial stability)[210] ei425Premiums, claims and expenses by line of business (Financial stability)[210] ei426Own funds (Financial stability)[210] ei427Own funds (Third country branches)[210] ei428Premiums, claims and expenses by line of business (Third country branches)[210] ei429Premiums, claims and expenses by country [210] ei430Reporting country [210] ei431Country of authorisation [210] ei432Collective investment undertakings - look-through approach (Individual)[210] ei433Collective investment undertakings - look-through approach (Group)[210] ei434Collective investment undertakings - look-through approach (Third country branches)[210] ei435Structured products (Individual)[210] ei436Structured products (Third country branches)[210] ei437Securities lending and repos (Individual)[210] ei438Deposits to cedants - line-by-line reporting (Third country branches)[210] ei439Country of third country undertaking [210] ei440Country of third country branch [210] ei441Development of the distribution of the claims incurred [220] ei442Loss distribution risk profile [220] ei443Non-life underwriting peak risks [220] ei444Non-life underwriting mass risks [220] ei445Solvency Capital Requirement - Market risk (Full scope individual)[220] ei446Solvency Capital Requirement - Market risk (Full scope group)[220] ei447Solvency Capital Requirement - Counterparty default risk (Full scope individual)[220] ei448Solvency Capital Requirement - Counterparty default risk (Full scope group)[220] ei449Solvency Capital Requirement - Life underwriting risk (Full scope individual)[220] ei450Solvency Capital Requirement - Life underwriting risk (Full scope group)[220] ei451Solvency Capital Requirement - Health underwriting risk (Full scope individual)[220] ei452Solvency Capital Requirement - Health underwriting risk (Full scope group)[220] ei453Solvency Capital Requirement - Non-Life underwriting risk (Full scope individual)[220] ei454Solvency Capital Requirement - Non-Life underwriting risk (Full scope group)[220] ei455Type of undertaking [220] ei456Type of branch [220] ei457Type of undertakings (Full scope)[220] ei458Regular/Ad-hoc submission (group) ei459Nominated ECAI ei460Structured products (Group)[220] ei461

Page 42: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Owner Data type Domain Hierarchy Member Period types2hd xbrli:monetaryItemType instants2hd xbrli:stringItemType instants2hd xbrli:dateItemType instants2hd xbrli:integerItemType instants2hd xbrli:decimalItemType instants2hd num:percentItemType instants2hd xbrli:booleanItemType instants2hd enum:enumerationItem AM 6 instants2hd enum:enumerationItem CS 4 instants2hd enum:enumerationItem CS 3 instants2hd enum:enumerationItem SE 8 instants2hd enum:enumerationItem SE 11 Total/NA instants2hd enum:enumerationItem SE 7 Total/NA instants2hd enum:enumerationItem VM 15 Total/NA instants2hd enum:enumerationItem MC 12 Open instants2hd enum:enumerationItem VM 14 Total/NA instants2hd enum:enumerationItem CG 2 instants2hd enum:enumerationItem PU 14 Total/NA instants2hd enum:enumerationItem GA 13 instants2hd enum:enumerationItem AP 2 instants2hd enum:enumerationItem CU 1 Total/NA instants2hd enum:enumerationItem GA 13 instants2hd enum:enumerationItem CS 2 Belonging to the instants2hd enum:enumerationItem VM 1 Total/NA instants2hd enum:enumerationItem VM 4 Total/NA instants2hd enum:enumerationItem CU 1 instants2hd enum:enumerationItem GA 1 instants2hd enum:enumerationItem GA 6 Not applicable/Alinstants2hd enum:enumerationItem PU 10 Total/NA instants2hd enum:enumerationItem PU 3 Total/NA instants2hd enum:enumerationItem MC 12 Closed instants2hd enum:enumerationItem GA 4 instants2hd enum:enumerationItem GA 4 Not applicable/Alinstants2hd true instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem CN 2 instants2hd enum:enumerationItem CN 3 instants2hd enum:enumerationItem CN 4 instants2hd enum:enumerationItem CN 5 instants2hd enum:enumerationItem CN 6 instants2hd enum:enumerationItem CN 7 instants2hd enum:enumerationItem CN 8 instants2hd enum:enumerationItem CN 9 instants2hd enum:enumerationItem CN 10 instants2hd enum:enumerationItem CN 11 instants2hd enum:enumerationItem CN 12 instants2hd enum:enumerationItem CN 13 instants2hd xbrli:anyURIItemType instants2hd enum:enumerationItem PU 12 Total/NA instants2hd enum:enumerationItem CS 5 Group instant

Page 43: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2hd enum:enumerationItem RT 10 Total/NA instants2hd num:percentItemType instants2hd enum:enumerationItem LB 4 Total/NA instants2hd enum:enumerationItem CU 1 Total/NA instants2hd enum:enumerationItem CU 1 instants2hd enum:enumerationItem LT 2 instants2hd enum:enumerationItem CS 10 Group instants2hd enum:enumerationItem CS 6 Group instants2hd enum:enumerationItem PU 7 Total/NA instants2hd enum:enumerationItem PU 9 Total/NA instants2hd enum:enumerationItem CS 2 instants2hd enum:enumerationItem EL 7 Total/NA instants2hd enum:enumerationItem CU 2 instants2hd enum:enumerationItem LB 24 Total/NA instants2hd enum:enumerationItem MC 5 instants2hd enum:enumerationItem CU 1 instants2hd enum:enumerationItem TB 4 Total/NA instants2hd enum:enumerationItem AM 1 instants2hd enum:enumerationItem TB 5 instants2hd enum:enumerationItem GA 1 Not applicable/Alinstants2hd enum:enumerationItem MC 3 Equity-type, debtinstants2hd enum:enumerationItem MC 3 Cost sharing, continstants2hd enum:enumerationItem MC 3 Derivatives instants2hd enum:enumerationItem LT 1 instants2hd enum:enumerationItem CU 2 Total/NA instants2hd enum:enumerationItem TB 6 instants2hd enum:enumerationItem TB 8 instants2hd enum:enumerationItem SE 6 Total/NA instants2hd enum:enumerationItem CG 5 instants2hd enum:enumerationItem PC 2 instants2hd enum:enumerationItem PC 1 instants2hd enum:enumerationItem MC 5 Structured notes ainstants2hd enum:enumerationItem PC 3 instants2hd enum:enumerationItem LB 22 Total/NA instants2hd enum:enumerationItem LB 21 Total/NA instants2hd enum:enumerationItem GA 1 Not applicable/Alinstants2hd enum:enumerationItem LB 20 Life and Health S instants2hd enum:enumerationItem LB 19 Total/NA instants2hd enum:enumerationItem TB 2 instants2hd enum:enumerationItem TB 5 Total/NA instants2hd enum:enumerationItem TB 3 instants2hd enum:enumerationItem CU 1 Total/NA instants2hd enum:enumerationItem LB 6 instants2hd enum:enumerationItem AM 7 instants2hd enum:enumerationItem PU 11 instants2hd enum:enumerationItem CG 4 instants2hd enum:enumerationItem LT 4 instants2hd enum:enumerationItem TB 9 instants2hd enum:enumerationItem AM 9 instants2hd enum:enumerationItem TB 7 instants2hd enum:enumerationItem LB 8 Total/NA instant

Page 44: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2hd enum:enumerationItem GA 5 Not applicable/Alinstants2hd enum:enumerationItem MC 2 Derivatives instants2hd enum:enumerationItem MC 2 Equity-type, debtinstants2hd enum:enumerationItem MC 2 Cost sharing, continstants2hd enum:enumerationItem SE 4 Reinsurance couninstants2hd enum:enumerationItem SE 10 Other than financiinstants2hd enum:enumerationItem CG 6 instants2hd enum:enumerationItem MC 18 instants2hd enum:enumerationItem CG 8 instants2hd enum:enumerationItem MC 20 instants2hd enum:enumerationItem BR 2 instants2hd enum:enumerationItem CS 2 instants2hd enum:enumerationItem CS 2 instants2hd enum:enumerationItem LT 1 instants2hd enum:enumerationItem LT 1 instants2hd enum:enumerationItem CN 2 instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem CN 3 instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem CN 4 instants2hd enum:enumerationItem CN 5 instants2hd enum:enumerationItem CN 6 instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem CN 7 instants2hd enum:enumerationItem CN 8 instants2hd enum:enumerationItem CN 9 instants2hd enum:enumerationItem CN 10 instants2hd enum:enumerationItem CN 10 instants2hd enum:enumerationItem CN 10 instants2hd enum:enumerationItem CN 10 instants2hd enum:enumerationItem CN 10 instants2hd enum:enumerationItem CN 10 instants2hd enum:enumerationItem CN 10 instants2hd enum:enumerationItem CN 11 instants2hd enum:enumerationItem CN 12 instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem CN 13 instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem AM 1 instants2hd enum:enumerationItem NC 1 instants2hd enum:enumerationItem CN 14 instants2hd enum:enumerationItem CN 81 instants2hd enum:enumerationItem CN 16 instants2hd enum:enumerationItem CN 17 instants2hd enum:enumerationItem CN 18 instants2hd enum:enumerationItem CN 19 instants2hd enum:enumerationItem CN 20 instants2hd enum:enumerationItem SE 13 instants2hd enum:enumerationItem AP 3 instants2hd enum:enumerationItem CS 12 instant

Page 45: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2hd enum:enumerationItem AP 4 instants2hd enum:enumerationItem PU 15 instants2hd enum:enumerationItem AP 5 instants2hd enum:enumerationItem AP 6 instants2hd enum:enumerationItem AP 7 instants2hd enum:enumerationItem LA 1 instants2hd enum:enumerationItem CS 13 instants2hd enum:enumerationItem CS 14 instants2hd enum:enumerationItem AM 10 instants2hd enum:enumerationItem AM 11 instants2hd enum:enumerationItem AP 8 instants2hd enum:enumerationItem CS 15 instants2hd enum:enumerationItem PU 16 instants2hd enum:enumerationItem PU 17 instants2hd enum:enumerationItem AP 11 instants2hd enum:enumerationItem AP 9 instants2hd enum:enumerationItem CN 82 instants2hd enum:enumerationItem CN 107 instants2hd enum:enumerationItem CN 23 instants2hd enum:enumerationItem CN 24 instants2hd enum:enumerationItem CN 25 instants2hd enum:enumerationItem CN 26 instants2hd enum:enumerationItem CN 27 instants2hd enum:enumerationItem CN 28 instants2hd enum:enumerationItem CN 29 instants2hd enum:enumerationItem CN 28 instants2hd enum:enumerationItem CN 29 instants2hd enum:enumerationItem CN 83 instants2hd enum:enumerationItem CN 31 instants2hd enum:enumerationItem CN 84 instants2hd enum:enumerationItem CN 33 instants2hd enum:enumerationItem CN 34 instants2hd enum:enumerationItem CN 35 instants2hd enum:enumerationItem CN 36 instants2hd enum:enumerationItem CN 37 instants2hd enum:enumerationItem CN 38 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 39 instants2hd enum:enumerationItem CN 40 instants2hd enum:enumerationItem CN 30 instants2hd enum:enumerationItem CN 30 instants2hd enum:enumerationItem CN 30 instants2hd enum:enumerationItem CN 41 instants2hd enum:enumerationItem CN 41 instants2hd enum:enumerationItem CN 42 instants2hd enum:enumerationItem CN 32 instants2hd enum:enumerationItem CN 32 instants2hd enum:enumerationItem CN 32 instants2hd enum:enumerationItem CN 32 instants2hd enum:enumerationItem CN 32 instants2hd enum:enumerationItem CN 32 instant

Page 46: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2hd enum:enumerationItem CN 32 instants2hd enum:enumerationItem CN 43 instants2hd enum:enumerationItem CN 44 instants2hd enum:enumerationItem CN 44 instants2hd enum:enumerationItem CN 45 instants2hd enum:enumerationItem CN 45 instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 46 instants2hd enum:enumerationItem CN 47 instants2hd enum:enumerationItem CN 48 instants2hd enum:enumerationItem CN 49 instants2hd enum:enumerationItem CN 50 instants2hd enum:enumerationItem CN 51 instants2hd enum:enumerationItem CN 52 instants2hd enum:enumerationItem CN 51 instants2hd enum:enumerationItem CN 52 instants2hd enum:enumerationItem CN 51 instants2hd enum:enumerationItem CN 52 instants2hd enum:enumerationItem CN 51 instants2hd enum:enumerationItem CN 52 instants2hd enum:enumerationItem CN 51 instants2hd enum:enumerationItem CN 52 instants2hd enum:enumerationItem CN 53 instants2hd enum:enumerationItem CN 54 instants2hd enum:enumerationItem CN 55 instants2hd enum:enumerationItem CN 56 instants2hd enum:enumerationItem CN 51 instants2hd enum:enumerationItem CN 52 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 57 instants2hd enum:enumerationItem CN 57 instants2hd enum:enumerationItem CN 58 instants2hd enum:enumerationItem CN 58 instants2hd enum:enumerationItem CN 58 instants2hd enum:enumerationItem CN 59 instants2hd enum:enumerationItem CN 60 instants2hd enum:enumerationItem CN 61 instants2hd enum:enumerationItem CN 62 instants2hd enum:enumerationItem CN 63 instants2hd enum:enumerationItem CN 64 instants2hd enum:enumerationItem CN 65 instants2hd enum:enumerationItem CN 66 instants2hd enum:enumerationItem CN 67 instants2hd enum:enumerationItem CN 68 instants2hd enum:enumerationItem PU 18 instants2hd enum:enumerationItem MC 27 instant

Page 47: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2hd enum:enumerationItem MC 26 instants2hd enum:enumerationItem CU 4 instants2hd enum:enumerationItem CS 11 instants2hd enum:enumerationItem CS 11 instants2hd enum:enumerationItem PU 19 instants2hd enum:enumerationItem LT 5 instants2hd enum:enumerationItem MC 28 instants2hd enum:enumerationItem MC 29 instants2hd enum:enumerationItem LB 26 instants2hd enum:enumerationItem MC 30 instants2hd enum:enumerationItem PU 28 instants2hd enum:enumerationItem MC 31 instants2hd enum:enumerationItem LB 27 instants2hd enum:enumerationItem LB 28 instants2hd enum:enumerationItem PU 20 instants2hd enum:enumerationItem CG 9 instants2hd enum:enumerationItem LB 29 instants2hd enum:enumerationItem CG 7 instants2hd enum:enumerationItem CG 7 instants2hd enum:enumerationItem CG 7 instants2hd enum:enumerationItem CG 7 instants2hd enum:enumerationItem CG 7 instants2hd enum:enumerationItem LB 30 instants2hd enum:enumerationItem LB 31 instants2hd enum:enumerationItem MC 32 instants2hd enum:enumerationItem MC 33 instants2hd enum:enumerationItem TB 10 instants2hd enum:enumerationItem AP 12 instants2hd enum:enumerationItem SE 14 instants2hd enum:enumerationItem TB 11 instants2hd enum:enumerationItem SE 15 instants2hd enum:enumerationItem CS 16 instants2hd enum:enumerationItem EL 13 instants2hd enum:enumerationItem BR 3 instants2hd enum:enumerationItem RT 13 instants2hd enum:enumerationItem RT 14 instants2hd enum:enumerationItem PU 21 instants2hd enum:enumerationItem SE 16 instants2hd enum:enumerationItem TB 12 instants2hd enum:enumerationItem TB 13 instants2hd enum:enumerationItem SE 17 instants2hd enum:enumerationItem LB 35 instants2hd enum:enumerationItem AP 13 instants2hd enum:enumerationItem MC 35 instants2hd enum:enumerationItem MC 36 instants2hd enum:enumerationItem MC 37 instants2hd enum:enumerationItem TB 14 instants2hd enum:enumerationItem EX 5 instants2hd enum:enumerationItem VM 22 instants2hd enum:enumerationItem LT 3 instants2hd enum:enumerationItem EL 14 instant

Page 48: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2hd enum:enumerationItem AP 18 instants2hd enum:enumerationItem AP 14 instants2hd enum:enumerationItem CU 5 instants2hd enum:enumerationItem CU 5 instants2hd enum:enumerationItem CU 5 instants2hd enum:enumerationItem PU 23 instants2hd enum:enumerationItem GA 5 instants2hd enum:enumerationItem TB 7 instants2hd enum:enumerationItem AM 14 instants2hd enum:enumerationItem CS 11 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem GA 18 instants2hd enum:enumerationItem GA 18 instants2hd enum:enumerationItem SE 13 instants2hd enum:enumerationItem AO 2 instants2hd enum:enumerationItem PU 24 instants2hd enum:enumerationItem PU 25 instants2hd enum:enumerationItem SE 18 instants2hd enum:enumerationItem GA 18 instants2hd enum:enumerationItem MC 39 instants2hd enum:enumerationItem CN 23 instants2hd enum:enumerationItem CN 94 instants2hd enum:enumerationItem CN 95 instants2hd enum:enumerationItem CN 73 instants2hd enum:enumerationItem CN 74 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 75 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem AP 15 instants2hd enum:enumerationItem AP 16 instants2hd enum:enumerationItem NC 1 instants2hd enum:enumerationItem CN 96 instants2hd enum:enumerationItem CN 96 instants2hd enum:enumerationItem CN 77 instants2hd enum:enumerationItem CN 78 instants2hd enum:enumerationItem CN 79 instants2hd enum:enumerationItem CN 79 instants2hd enum:enumerationItem VM 23 instants2hd enum:enumerationItem MC 48 instants2hd enum:enumerationItem PU 26 instants2hd enum:enumerationItem PU 27 instants2hd enum:enumerationItem TB 16 instants2hd enum:enumerationItem GA 5 instants2hd enum:enumerationItem CN 80 instants2hd enum:enumerationItem CN 82 instants2hd enum:enumerationItem CN 85 instants2hd enum:enumerationItem CN 86 instant

Page 49: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2hd enum:enumerationItem CG 11 instants2hd enum:enumerationItem VM 24 instants2hd enum:enumerationItem CN 87 instants2hd enum:enumerationItem CN 88 instants2hd enum:enumerationItem CN 89 instants2hd enum:enumerationItem CN 90 instants2hd enum:enumerationItem CN 87 instants2hd enum:enumerationItem CN 91 instants2hd enum:enumerationItem CN 91 instants2hd enum:enumerationItem CN 91 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 92 instants2hd enum:enumerationItem CN 93 instants2hd enum:enumerationItem GA 26 instants2hd enum:enumerationItem GA 18 instants2hd enum:enumerationItem CS 20 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 15 instants2hd enum:enumerationItem CN 1 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem AP 17 instants2hd enum:enumerationItem CN 97 instants2hd enum:enumerationItem CN 98 instants2hd enum:enumerationItem CN 99 instants2hd enum:enumerationItem CN 100 instants2hd enum:enumerationItem CN 100 instants2hd enum:enumerationItem CN 101 instants2hd enum:enumerationItem CN 102 instants2hd enum:enumerationItem CN 103 instants2hd enum:enumerationItem CN 104 instants2hd enum:enumerationItem CN 105 instants2hd enum:enumerationItem CN 106 instants2hd enum:enumerationItem CN 105 instants2hd enum:enumerationItem MC 50 instant

Page 50: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2hd enum:enumerationItem LB 48 instants2hd enum:enumerationItem PU 33 instants2hd enum:enumerationItem PU 34 instants2hd enum:enumerationItem PU 37 instants2hd enum:enumerationItem CN 108 instants2hd enum:enumerationItem CN 109 instants2hd enum:enumerationItem CN 110 instants2hd enum:enumerationItem LB 50 instants2hd enum:enumerationItem LB 51 instants2hd enum:enumerationItem CN 111 instants2hd enum:enumerationItem CN 112 instants2hd enum:enumerationItem CN 113 instants2hd enum:enumerationItem CN 113 instants2hd enum:enumerationItem CN 114 instants2hd enum:enumerationItem CN 114 instants2hd enum:enumerationItem CN 114 instants2hd enum:enumerationItem CN 115 instants2hd enum:enumerationItem CN 115 instants2hd enum:enumerationItem CN 116 instants2hd enum:enumerationItem GA 1 Not applicable/Alinstants2hd enum:enumerationItem GA 1 Not applicable/Alinstants2hd enum:enumerationItem CN 117 instants2hd enum:enumerationItem CN 118 instants2hd enum:enumerationItem CN 119 instants2hd enum:enumerationItem CN 120 instants2hd enum:enumerationItem CN 121 instants2hd enum:enumerationItem CN 39 instants2hd enum:enumerationItem CN 122 instants2hd enum:enumerationItem GA 1 Not applicable/Alinstants2hd enum:enumerationItem GA 1 Not applicable/Alinstants2hd enum:enumerationItem CN 123 instants2hd enum:enumerationItem CN 123 instants2hd enum:enumerationItem CN 123 instants2hd enum:enumerationItem CN 123 instants2hd enum:enumerationItem CN 124 instants2hd enum:enumerationItem CN 125 instants2hd enum:enumerationItem CN 124 instants2hd enum:enumerationItem CN 125 instants2hd enum:enumerationItem CN 124 instants2hd enum:enumerationItem CN 125 instants2hd enum:enumerationItem CN 124 instants2hd enum:enumerationItem CN 125 instants2hd enum:enumerationItem CN 124 instants2hd enum:enumerationItem CN 125 instants2hd enum:enumerationItem SE 21 instants2hd enum:enumerationItem SE 22 instants2hd enum:enumerationItem SE 23 instants2hd enum:enumerationItem CS 21 instants2hd enum:enumerationItem SE 24 instants2hd enum:enumerationItem CN 126 instant

Page 51: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modified Count Hierarchy Name Sign Weight7/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/20157/7/2014 9/30/20157/7/2014 9/30/20157/7/20147/7/2014 9/30/20157/7/2014 7/15/20167/7/2014 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 7/15/2016 9/30/20157/7/2014 9/30/20157/7/2014 9/30/20157/7/2014 9/30/20157/7/20147/7/20147/7/2014 12/31/20137/7/2014 9/30/2015 9/30/20157/7/2014 9/30/20157/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015

Page 52: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/2014 9/30/20157/7/2014 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/20157/7/2014 12/31/20137/7/2014 9/30/20157/7/2014 12/31/20137/7/2014 12/31/2013 9/30/20157/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013 9/30/20157/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 12/31/2013 9/30/20157/7/20147/7/20147/7/2014 12/31/2013 9/30/20157/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014 12/31/2013 9/30/20157/7/20147/7/20147/7/2014 12/31/2013 9/30/20157/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

Page 53: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 12/31/20137/7/2014 12/31/2013 9/30/20157/7/2014 12/31/2013 9/30/20157/7/2014 12/31/2013 9/30/20157/7/2014 12/31/2013 9/30/20157/7/2014 12/31/20137/7/2014 12/31/2013 9/30/20157/7/20147/7/2014 12/31/20137/7/2014 12/31/2013 9/30/20157/7/2014 12/31/2013 9/30/20157/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/20157/7/2014 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 9/30/2015 9/30/20157/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 9/30/20157/7/2014 9/30/20157/7/20147/7/2014 9/30/20157/7/2014 9/30/20157/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 7/15/20169/30/20159/30/2015 7/15/20179/30/20159/30/2015 7/15/2017

Page 54: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/2015 9/30/20159/30/20159/30/20159/30/2015 7/15/20169/30/20159/30/20159/30/20159/30/2015 7/15/20169/30/2015 7/15/2016 9/30/20159/30/20159/30/20159/30/2015 7/15/20169/30/2015 7/15/20169/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 7/15/20169/30/2015 9/30/20159/30/2015 7/15/20169/30/2015 7/15/20169/30/2015 12/31/20139/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/20159/30/20159/30/2015 7/15/20179/30/2015 7/15/20179/30/2015 7/15/2017

Page 55: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015 7/15/20179/30/20159/30/2015 12/31/20139/30/2015 12/31/20139/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 7/15/2016 9/30/20159/30/2015 7/15/20169/30/20159/30/20159/30/2015 7/15/20179/30/2015 7/15/20179/30/2015 7/15/20179/30/2015 7/15/20179/30/2015 7/15/20179/30/2015 7/15/20179/30/2015 7/15/20179/30/2015 7/15/20179/30/2015 7/15/20179/30/2015 7/15/20179/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 7/15/20169/30/2015 7/15/2016

Page 56: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 7/15/20169/30/20159/30/2015 7/15/20169/30/20159/30/2015 7/15/20169/30/20159/30/2015 12/31/20139/30/20159/30/2015 7/15/20169/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/20159/30/20159/30/2015 12/31/20139/30/20159/30/20159/30/20159/30/2015 7/15/20179/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/20159/30/20159/30/20159/30/20159/30/2015 7/15/20169/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/20159/30/2015

Page 57: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/20159/30/20159/30/2015 7/15/20169/30/2015 7/15/20169/30/2015 7/15/20179/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/2015 7/15/20169/30/2015 9/30/20159/30/2015 9/30/20159/30/2015 12/31/20139/30/2015 12/31/20139/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/2015 9/30/20159/30/2015 9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 9/30/20159/30/20159/30/20159/30/2015 12/31/20139/30/20159/30/2015 7/15/20169/30/2015 7/15/20169/30/2015 9/30/20159/30/2015 9/30/2015

Page 58: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/2015 7/15/20169/30/2015 7/15/20179/30/2015 7/15/20169/30/20159/30/2015 7/15/20169/30/2015 7/15/20169/30/2015 7/15/20169/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 7/15/20169/30/2015 7/15/20169/30/20159/30/20159/30/20159/30/2015 7/15/20169/30/20159/30/20159/30/2015 7/15/20169/30/20159/30/2015 7/15/20167/15/2016

Page 59: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/2016 7/15/20177/15/20167/15/2016 7/15/20177/15/20167/15/20167/15/20167/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/2017

Page 60: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Owner

Page 61: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

LabelMetric: Date|PO/Other than ring fenced funds|TD/Date of formal approval of internal modelMetric: Date|PO/Other than ring fenced funds|TD/Date of formal approval of partial internal modelMetric: Date|PO/Ring Fenced Funds|TD/Date of formal approval of internal modelMetric: Date|PO/Ring Fenced Funds|TD/Date of formal approval of partial internal modelMetric: Date|II/Full internal model|TD/Date of formal approval of internal modelMetric: Date|II/Partial internal model|TD/Date of formal approval of partial internal modelMetric: Decimal|BC/Liability|DC/Residual modified durationMetric: Decimal|DC/Age of beneficiaries [years] (old)Metric: Decimal|DC/Residual modified duration (old)Metric: Integer|NT/Number of obligationsMetric: Integer|II/Standard formula|NT/Number of claims|PO/Other than ring fenced fundsMetric: Integer|II/Standard formula|NT/Number of claims|PO/Ring Fenced FundsMetric: Integer|II/Standard formula|NT/Number of policyholders|PO/Other than ring fenced fundsMetric: Integer|II/Standard formula|NT/Number of policyholders|PO/Ring Fenced FundsMetric: Integer|II/Standard formula|NT/Number of vehicles policy limit above 24M€|PO/Other than ring fenced fundsMetric: Integer|II/Standard formula|NT/Number of vehicles policy limit above 24M€|PO/Ring Fenced FundsMetric: Integer|II/Standard formula|NT/Number of vehicles policy limit below or equal to 24M€|PO/Other than ring fenced fundsMetric: Integer|II/Standard formula|NT/Number of vehicles policy limit below or equal to 24M€|PO/Ring Fenced FundsMetric: Integer|II/Standard formula|NT/Number of people insured|PO/Other than ring fenced fundsMetric: Integer|II/Standard formula|NT/Number of people insured|PO/Ring Fenced FundsMetric: Integer|NT/Frequency of claimsMetric: Integer|NT/Number of claims|CH/Newly reported|SD/OpenMetric: Integer|NT/Number of claims|CH/Newly reported|SD/Settled [with payment]Metric: Integer|NT/Number of claims|CH/Newly reported|SD/Settled [without payment]Metric: Integer|NT/Number of claims|SD/Open and settled [with payment]Metric: Integer|NT/Number of claims|CH/Reopened|SD/OpenMetric: Integer|NT/Number of claims|CH/Reopened|SD/Settled [with payment]Metric: Integer|NT/Number of claims|SB/Open|SD/OpenMetric: Integer|NT/Number of claims|SB/Open|SD/Settled [with payment]Metric: Integer|NT/Number of claims|SB/Open|SD/Settled [without payment]Metric: Integer|LB/Claim provisions [other than local GAAP specific]|NT/Number of HRGsMetric: Integer|LB/Premium provisions [other than local GAAP specific]|NT/Number of HRGsMetric: Integer|NT/Number of underwriting risksMetric: Monetary|DD/Discounted|VP/Cash in-flows other than future premiums|BC/Liability|LB/Claim provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|VP/Cash in-flows other than future premiums|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|VP/Cash in-flows other than future premiums|BC/Liability|LB/Premium provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|VP/Future discretionary benefits|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|VP/Future discretionary benefits|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|PO/Other than ring fenced fundsMetric: Monetary|DD/Discounted|VP/Future discretionary benefits|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|PO/Other than ring fenced funds|IT/AfteMetric: Monetary|DD/Discounted|VP/Future discretionary benefits|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|PO/Ring Fenced FundsMetric: Monetary|DD/Discounted|VP/Future discretionary benefits|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|PO/Ring Fenced Funds|IT/After risk mitMetric: Monetary|DD/Discounted|VP/Future discretionary benefits|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|SO/Insurance/reinsurance sectorMetric: Monetary|DD/Discounted|VP/Future discretionary benefits|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|SO/Insurance/reinsurance sector|IT/AftMetric: Monetary|DD/Discounted|VP/Future discretionary benefits|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect other thMetric: Monetary|DD/Discounted|VP/Future expenses and cash out-flows other than guaranteed and discretionary benefits|BC/Liability|LB/Claim provisions [other than local GAAP Metric: Monetary|DD/Discounted|VP/Future expenses and cash out-flows other than guaranteed and discretionary benefits|BC/Liability|LB/Gross technical provisions [other than loMetric: Monetary|DD/Discounted|VP/Future expenses and cash out-flows other than guaranteed and discretionary benefits|BC/Liability|LB/Premium provisions [other than local GAMetric: Monetary|DD/Discounted|VP/Future guaranteed and discretionary benefits|BC/Liability|LB/Claim provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|VP/Future guaranteed and discretionary benefits|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|VP/Future guaranteed and discretionary benefits|BC/Liability|LB/Premium provisions [other than local GAAP specific]

Page 62: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|DD/Discounted|VP/Future guaranteed benefits|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|VP/Future premiums|BC/Liability|LB/Claim provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|VP/Future premiums|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|VP/Future premiums|BC/Liability|LB/Premium provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|BC/Liability|LB/Claim provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|BC/Liability|LB/Claim provisions [other than local GAAP specific]|CC/CededMetric: Monetary|DD/Discounted|BC/Liability|LB/Claim provisions [other than local GAAP specific]|CC/Not cededMetric: Monetary|DD/Discounted|BC/Reported but not settled claims [RBNS]Metric: Monetary|DD/Discounted|BC/Reported but not settled claims [RBNS]|CC/CededMetric: Monetary|DD/Discounted|BC/Reported but not settled claims [RBNS]|CC/Not cededMetric: Monetary|DD/Undiscounted|VP/Cash in-flows other than future premiums|BC/Projection of future cash flows|LB/Claim provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|VP/Cash in-flows other than future premiums|BC/Projection of future cash flows|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|VP/Cash in-flows other than future premiums|BC/Projection of future cash flows|LB/Premium provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|VP/Future expenses and cash out-flows other than guaranteed and discretionary benefits|BC/Projection of future cash flows|LB/Claim provisionsMetric: Monetary|DD/Undiscounted|VP/Future expenses and cash out-flows other than guaranteed and discretionary benefits|BC/Projection of future cash flows|LB/Gross technical pMetric: Monetary|DD/Undiscounted|VP/Future expenses and cash out-flows other than guaranteed and discretionary benefits|BC/Projection of future cash flows|LB/Premium provisiMetric: Monetary|DD/Undiscounted|VP/Future guaranteed and discretionary benefits|BC/Projection of future cash flows|LB/Claim provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|VP/Future guaranteed and discretionary benefits|BC/Projection of future cash flows|LB/Gross technical provisions [other than local GAAP specifMetric: Monetary|DD/Undiscounted|VP/Future guaranteed and discretionary benefits|BC/Projection of future cash flows|LB/Premium provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|VP/Future premiums|BC/Projection of future cash flows|LB/Claim provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|VP/Future premiums|BC/Projection of future cash flows|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|VP/Future premiums|BC/Projection of future cash flows|LB/Premium provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|BC/Assets|AS/Recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CC/CededMetric: Monetary|DD/Undiscounted|BC/Claims paidMetric: Monetary|DD/Undiscounted|BC/Liability|LB/Claim provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|BC/Liability|LB/Claim provisions [other than local GAAP specific]|CC/CededMetric: Monetary|DD/Undiscounted|BC/Liability|LB/Claim provisions [other than local GAAP specific]|CC/Not cededMetric: Monetary|DD/Undiscounted|BC/Liability|LB/New claim provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|BC/Reported but not settled claims [RBNS]Metric: Monetary|DD/Undiscounted|BC/Reported but not settled claims [RBNS]|CC/CededMetric: Monetary|DD/Undiscounted|BC/Reported but not settled claims [RBNS]|CC/Not cededMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]Metric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|IO/Participations [controlling]Metric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|IO/Participations [non-controlling]Metric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced fundsMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|TV/Not treated per components|IT/After risk mitigation effect otheMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|TV/Treated per components|IT/After risk mitigation effect other thMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced FundsMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|DV/Before diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|DV/Diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|TV/Not treated per components|IT/After risk mitigation effect other than froMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|TV/Treated per components|IT/After risk mitigation effect other than from fiMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|TV/Not treated per components|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]Metric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced fundsMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|TV/Not treated per components|IT/After risk mitigation effect oMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|TV/Treated per components|IT/After risk mitigation effect other

Page 63: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced FundsMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|TV/Not treated per components|IT/After risk mitigation effect other than fMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|TV/Treated per components|IT/After risk mitigation effect other than fromMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|TV/Not treated per components|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]Metric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IO/Participations [controlling]|SO/Credit institutions, investment firms andMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IO/Participations [controlling]|SO/Entities carrying out financial activitiesMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IO/Participations [controlling]|SO/Institutions for occupational retirement prMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IO/Participations [controlling]|SO/Non regulated entities carrying out financialMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IO/Participations [non-controlling]|SO/Entities carrying out financial activitieMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced fundsMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|SO/Insurance/reinsurance sectorMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced FundsMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|SO/Insurance/reinsurance sectorMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|SO/Insurance/reinsurance sectorMetric: Monetary|II/Standard formula|BC/Cost of claims|PO/Other than ring fenced fundsMetric: Monetary|II/Standard formula|BC/Cost of claims|PO/Ring Fenced FundsMetric: Monetary|II/Standard formula|BC/Expenses|PO/Other than ring fenced fundsMetric: Monetary|II/Standard formula|BC/Expenses|PO/Ring Fenced FundsMetric: Monetary|II/Standard formula|BC/Exposure|PO/Other than ring fenced fundsMetric: Monetary|II/Standard formula|BC/Exposure|PO/Other than ring fenced funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Exposure|PO/Ring Fenced FundsMetric: Monetary|II/Standard formula|BC/Exposure|PO/Ring Fenced Funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Largest known accident risk concentration|PO/Other than ring fenced fundsMetric: Monetary|II/Standard formula|BC/Largest known accident risk concentration|PO/Ring Fenced FundsMetric: Monetary|II/Standard formula|BC/Largest liability limit provided|PO/Other than ring fenced fundsMetric: Monetary|II/Standard formula|BC/Largest liability limit provided|PO/Ring Fenced FundsMetric: Monetary|II/Standard formula|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|PO/Other than ring fenced fundsMetric: Monetary|II/Standard formula|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|PO/Ring Fenced FundsMetric: Monetary|II/Standard formula|BC/Loss|PO/Other than ring fenced fundsMetric: Monetary|II/Standard formula|BC/Loss|PO/Ring Fenced FundsMetric: Monetary|II/Standard formula|BC/Premiums written|PO/Other than ring fenced fundsMetric: Monetary|II/Standard formula|BC/Premiums written|PO/Ring Fenced FundsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced fundsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|AB/Scenario A|IT/After risk mitigation [risk mitigation cost for reinsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|AB/Scenario AMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|AB/Scenario A|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|AB/Scenario A|IT/Risk mitigation effect other than from finite reinsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|AB/Scenario B|IT/After risk mitigation [risk mitigation cost for reinsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|AB/Scenario BMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|AB/Scenario B|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|AB/Scenario B|IT/Risk mitigation effect other than from finite reinsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Aviation [hull]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Aviation [liability]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Aviation|IT/After risk mitigation [risk mitigation cost for reinstaMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Aviation

Page 64: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Aviation|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Aviation|IT/Risk mitigation effect other than from finite reinsurMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|IT/After risk mitigation [risk mitigation cost for reinstalment premiuMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|IT/Risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|IT/Risk mitigation effect other than from finite reinsurance and risk Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced FundsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|AB/Scenario A|IT/After risk mitigation [risk mitigation cost for reinstalment prMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|AB/Scenario AMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|AB/Scenario A|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|AB/Scenario A|IT/Risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|AB/Scenario B|IT/After risk mitigation [risk mitigation cost for reinstalment prMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|AB/Scenario BMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|AB/Scenario B|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|AB/Scenario B|IT/Risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Aviation [hull]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Aviation [liability]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Aviation|IT/After risk mitigation [risk mitigation cost for reinstalment premMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/AviationMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Aviation|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Aviation|IT/Risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|IT/After risk mitigation [risk mitigation cost for reinstalment premium and otherMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|IT/Risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|IT/Risk mitigation effect other than from finite reinsurance and risk mitigationMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|SO/Insurance/reinsurance sectorMetric: Monetary|II/Standard formula|PO/Other than ring fenced fundsMetric: Monetary|II/Standard formula|PO/Other than ring fenced funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|PO/Ring Fenced FundsMetric: Monetary|II/Standard formula|PO/Ring Fenced Funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|BC/Additional itemMetric: Monetary|BC/Annual premiumMetric: Monetary|BC/AssetsMetric: Monetary|BC/Assets|AS/Loans on policies|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentsMetric: Monetary|BC/Assets|AS/Loans and mortgages to individuals|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentsMetric: Monetary|BC/Assets|AS/Other loans and mortgages|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentsMetric: Monetary|BC/Assets|BE/Basic own funds|AS/Ordinary shares|IO/Own instruments held directlyMetric: Monetary|BC/Assets|BE/Basic own funds|AS/Participations and related undertakings|OF/Article 68 [1] deduction|IO/Participations|OU/To be deducted|CT/Financial and credMetric: Monetary|BC/Assets|BE/Basic own funds|AS/Participations and related undertakings|OF/Article 68 [2] deduction|IO/Participations|OU/To be deducted|CT/Financial and credMetric: Monetary|BC/Assets|BE/Basic own funds|AS/Participations and related undertakings|OF/Deductions|IO/Participations|OU/To be deducted|CT/Financial and credit institutiMetric: Monetary|BC/Assets|EI/Not restrictedMetric: Monetary|BC/Assets|TB/Reinsurance accepted|AS/Reinsurance deposits|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentsMetric: Monetary|BC/Assets|AS/Corporate Bonds|IO/InvestmentMetric: Monetary|BC/Assets|AS/Government Bonds|IO/InvestmentMetric: Monetary|BC/Assets|AS/Bonds|IO/InvestmentMetric: Monetary|BC/Assets|AS/Claims recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Finite reinsurance|CC/CeMetric: Monetary|BC/Assets|AS/Claims recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Reinsurance counterparMetric: Monetary|BC/Assets|AS/Claims recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Reinsurance counterpartMetric: Monetary|BC/Assets|AS/Claims recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Reinsurance undertaking

Page 65: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Assets|AS/Claims recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Special purpose vehicle Metric: Monetary|BC/Assets|AS/Claims recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CC/CededMetric: Monetary|BC/Assets|AS/Collateralised securities|IO/InvestmentMetric: Monetary|BC/Assets|AS/Deferred acquisition costs|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentsMetric: Monetary|BC/Assets|AS/Deferred tax|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentsMetric: Monetary|BC/Assets|AS/Deposits other than reinsurance deposits|IO/InvestmentMetric: Monetary|BC/Assets|AS/Derivatives|IO/InvestmentMetric: Monetary|BC/Assets|AS/Due in respect of own fund items or initial fund called up but not yet paid in|IO/Other than investment, own use, own instruments held directly andMetric: Monetary|BC/Assets|AS/Listed equity|IO/InvestmentMetric: Monetary|BC/Assets|AS/Unlisted equity|IO/InvestmentMetric: Monetary|VG/Solvency II|BC/Assets|AS/Collective investments undertakings|IO/InvestmentMetric: Monetary|BC/Assets|AS/Equity instruments|IO/Investment|CT/Alternative fundsMetric: Monetary|BC/Assets|AS/Equity instruments|IO/Investment|CT/Asset allocation fundsMetric: Monetary|BC/Assets|AS/Equity instruments|IO/Investment|CT/Debt fundsMetric: Monetary|BC/Assets|AS/Equity instruments|IO/Investment|CT/Equity fundsMetric: Monetary|BC/Assets|AS/Equity instruments|IO/Investment|CT/Infrastructure fundsMetric: Monetary|BC/Assets|AS/Equity instruments|IO/Investment|CT/Investment funds other than equity funds, debt funds, money market funds, asset allocation funds, real estate fMetric: Monetary|BC/Assets|AS/Equity instruments|IO/Investment|CT/Money market fundsMetric: Monetary|BC/Assets|AS/Equity instruments|IO/Investment|CT/Private equity fundsMetric: Monetary|BC/Assets|AS/Equity instruments|IO/Investment|CT/Real estate fundsMetric: Monetary|BC/Assets|AS/Equity instruments|IO/InvestmentMetric: Monetary|BC/Assets|AS/Cash and deposits|IO/Cash and cash equivalentsMetric: Monetary|BC/Assets|AS/Financial [other than receivables/payables and recoverables]|IO/InvestmentMetric: Monetary|BC/Assets|AS/Financial [other than receivables/payables and recoverables]|IO/Non-strategic participation [not deducted from own funds]|OU/Not to be deducteMetric: Monetary|BC/Assets|AS/Financial [other than receivables/payables and recoverables]|IO/Non-strategic participation [not deducted from own funds]|CT/Other than financial Metric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/InvestmentMetric: Monetary|BC/Assets|AS/Financial [other than receivables/payables and recoverables]|IO/Participations|CT/Corporate other than investment fundsMetric: Monetary|BC/Assets|AS/Financial [other than receivables/payables and recoverables]|IO/Participations|CT/Other than financial and credit institutionsMetric: Monetary|BC/Assets|AS/Financial [other than receivables/payables and recoverables]|IO/Strategic participation [not deducted from own funds]|OU/Not to be deductedMetric: Monetary|BC/Assets|AS/Financial [other than receivables/payables and recoverables]|IO/Strategic participation [not deducted from own funds]|CT/Financial and credit instiMetric: Monetary|BC/Assets|AS/Financial [other than receivables/payables and recoverables]|IO/Strategic participation [not deducted from own funds]|CT/Other than financial and cMetric: Monetary|BC/Assets|AS/Other investment|IO/InvestmentMetric: Monetary|BC/Assets|AS/Goodwill|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentsMetric: Monetary|BC/Assets|AS/Intangible other than goodwill and deferred acquisition costs|IO/Other than investment, own use, own instruments held directly and cash and cashMetric: Monetary|BC/Assets|AS/Mortgages and loans|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentsMetric: Monetary|BC/Assets|AS/Ordinary shares|IO/Own instruments held directlyMetric: Monetary|BC/Assets|AS/Other than intangible, deferred tax, pension benefit, property, plant and equipment, financial, reinsurance deposits, receivables/payables and due inMetric: Monetary|BC/Assets|AS/Other than property, plant and equipment, financial [other than receivables/payables insurance/reinsurance related and reinsurance deposits]|IO/Metric: Monetary|BC/Assets|AS/Pension benefit|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentsMetric: Monetary|BC/Assets|AS/Premium recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Finite reinsurance|CC/Metric: Monetary|BC/Assets|AS/Premium recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Reinsurance counterMetric: Monetary|BC/Assets|AS/Premium recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Reinsurance counterpaMetric: Monetary|BC/Assets|AS/Premium recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Reinsurance undertakiMetric: Monetary|BC/Assets|AS/Premium recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Special purpose vehiclMetric: Monetary|BC/Assets|AS/Premium recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CC/CededMetric: Monetary|BC/Assets|AS/Property, plant and equipment, Cash, Derivatives, Bonds, Equity instruments, Participations and related undertakings, Deposits other than reinsuraMetric: Monetary|BC/Assets|AS/Property, plant and equipment and financial [other than receivables/payables and recoverables]|IO/Other than investmentMetric: Monetary|BC/Assets|AS/Properties|IO/InvestmentMetric: Monetary|BC/Assets|AS/Properties|IO/Own useMetric: Monetary|BC/Assets|AS/Receivables/payables [insurance/reinsurance accepted]|IO/Other than investment, own use, own instruments held directly and cash and cash equivMetric: Monetary|BC/Assets|AS/Receivables/payables [reinsurance ceded]|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CC/C

Page 66: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Assets|AS/Receivables/payables [trade]|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentsMetric: Monetary|BC/Assets|AS/Recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Finite reinsurance|CC/Ceded|RRMetric: Monetary|BC/Assets|AS/Recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Insurance/reinsurance undertMetric: Monetary|BC/Assets|AS/Recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Reinsurance counterparties|CMetric: Monetary|BC/Assets|AS/Recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Reinsurance counterparties|CC/Metric: Monetary|BC/Assets|AS/Recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Reinsurance undertakings|CC/CMetric: Monetary|BC/Assets|AS/Recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Special purpose vehicle [SPV]|CMetric: Monetary|BC/Assets|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CC/Metric: Monetary|BC/Assets|AS/Reinsurance deposits and receivables/payables [insurance/reinsurance related]|IO/Other than investment, own use, own instruments held directly Metric: Monetary|BC/Assets|AS/Reinsurance deposits|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentsMetric: Monetary|BC/Assets|AS/Shares|IO/Own instruments held directlyMetric: Monetary|BC/Assets|AS/Structured notes|IO/InvestmentMetric: Monetary|BC/Claims incurredMetric: Monetary|BC/Claims incurred|AI/Other than salvages and subrogationsMetric: Monetary|BC/Claims incurred|AI/Other than salvages and subrogations|CC/CededMetric: Monetary|BC/Claims incurred|AI/Other than salvages and subrogations|CC/Not cededMetric: Monetary|BC/Claims incurred|SD/Open and settled [with payment]Metric: Monetary|BC/Claims incurred|CC/CededMetric: Monetary|BC/Claims incurred|CC/Not cededMetric: Monetary|BC/Claims paidMetric: Monetary|BC/Claims paid or due to be paid regarding surrender [full or partial] by policyholdersMetric: Monetary|BC/Claims paid|CC/CededMetric: Monetary|BC/Claims paid|CC/Not cededMetric: Monetary|BC/Cost of claimsMetric: Monetary|BC/Excess of assets over liabilitiesMetric: Monetary|BC/Excess of assets over liabilities|AA/Eligible for undertakingMetric: Monetary|BC/Excess of assets over liabilities|EI/Not restrictedMetric: Monetary|BC/Excess of assets over liabilities|EI/RestrictedMetric: Monetary|BC/Excess of assets over liabilities|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash anMetric: Monetary|BC/Excess of assets over liabilities|LB/Gross technical provisions [other than local GAAP specific]|XS/Variation explained by technical provisionsMetric: Monetary|BC/Excess of assets over liabilities|XS/Other variationMetric: Monetary|BC/Excess of assets over liabilities|XS/Variation explained by capital basic own fund items and other items approvedMetric: Monetary|BC/Excess of assets over liabilities|XS/Variation explained by deferred tax positionMetric: Monetary|BC/Excess of assets over liabilities|XS/Variation explained by dividend distributionMetric: Monetary|BC/Excess of assets over liabilities|XS/Variation explained by income tax [not deferred]Metric: Monetary|BC/Excess of assets over liabilities|XS/Variation explained by investments and financial liabilities managementMetric: Monetary|BC/Excess of assets over liabilities|XS/Variation explained by technical provisionsMetric: Monetary|BC/Excess of technical flow over technical provisionsMetric: Monetary|BC/Expected profits included in future premiums|BE/Basic own fundsMetric: Monetary|BC/ExpensesMetric: Monetary|BC/Expenses|TE/AcquisitionMetric: Monetary|BC/Expenses|TE/Acquisition|CC/CededMetric: Monetary|BC/Expenses|TE/Acquisition|CC/Not cededMetric: Monetary|BC/Expenses|TE/AdministrationMetric: Monetary|BC/Expenses|TE/Administration, investments management, claims management, acquisition and overheadMetric: Monetary|BC/Expenses|TE/Administration, investments management, claims management, acquisition and overhead|CC/CededMetric: Monetary|BC/Expenses|TE/Administration, investments management, claims management, acquisition and overhead|CC/Not cededMetric: Monetary|BC/Expenses|TE/Administration|CC/CededMetric: Monetary|BC/Expenses|TE/Administration|CC/Not cededMetric: Monetary|BC/Expenses|TE/Claims managementMetric: Monetary|BC/Expenses|TE/Claims management|CC/Ceded

Page 67: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Expenses|TE/Claims management|CC/Not cededMetric: Monetary|BC/Expenses|TE/CommissionsMetric: Monetary|BC/Expenses|TE/InvestmentMetric: Monetary|BC/Expenses|TE/Investment managementMetric: Monetary|BC/Expenses|TE/Investment management|CC/CededMetric: Monetary|BC/Expenses|TE/Investment management|CC/Not cededMetric: Monetary|BC/Expenses|TE/Other than administration, investments management, claims management, acquisition and overheadMetric: Monetary|BC/Expenses|TE/Other than administration, investments management, claims management, acquisition and overhead|CC/Not cededMetric: Monetary|BC/Expenses|TE/Other than investmentMetric: Monetary|BC/Expenses|TE/OverheadMetric: Monetary|BC/Expenses|TE/Overhead|CC/CededMetric: Monetary|BC/Expenses|TE/Overhead|CC/Not cededMetric: Monetary|BC/Expenses|CC/Not cededMetric: Monetary|BC/Exposure|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|BC/Foreseeable dividends, distributions and chargesMetric: Monetary|BC/Income|TE/DividendsMetric: Monetary|BC/Income|TE/InterestsMetric: Monetary|BC/Income|TE/InvestmentMetric: Monetary|BC/Income|TE/Investment other than dividends, rent and interestsMetric: Monetary|BC/Income|TE/RentMetric: Monetary|BC/LiabilityMetric: Monetary|BC/Liability|BE/Basic own funds|LB/Subordinated debt instrumentsMetric: Monetary|BC/Liability|BE/Other than basic own funds|LB/Subordinated debt instrumentsMetric: Monetary|BC/Liability|LB/Other than technical provisionsMetric: Monetary|BC/Liability|LB/Reserves and retained earningsMetric: Monetary|BC/Liability|LB/Technical provisionsMetric: Monetary|BC/Liability|SX/Product with surrender option|LB/Gross technical provisions [other than local GAAP specific]|VV/Amount before transitional on Technical ProvisioMetric: Monetary|BC/Liability|LB/Claim provisions [other than local GAAP specific]Metric: Monetary|BC/Liability|LB/Claim provisions [other than local GAAP specific]|IT/After risk mitigation effectMetric: Monetary|BC/Liability|LB/ContingentMetric: Monetary|BC/Liability|LB/Debt instruments [not subordinated]Metric: Monetary|BC/Liability|LB/Debt instruments [not subordinated]. Debts owed to credit institutionsMetric: Monetary|BC/Liability|LB/Debt instruments [not subordinated]. Financial liabilities other than debts owed to credit institutionsMetric: Monetary|BC/Liability|LB/Deferred taxMetric: Monetary|BC/Liability|LB/DerivativesMetric: Monetary|BC/Liability|LB/Gross technical provisions [local GAAP specific]Metric: Monetary|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|CC/Not ceded|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effectMetric: Monetary|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|BC/Liability|LB/Other than provisions, pension benefit, contingent, deferred tax, reinsurance deposit and financialMetric: Monetary|BC/Liability|LB/Other than technical provisions, contingent, financial [receivables/payables [trade]] and reinsurance depositMetric: Monetary|BC/Liability|LB/Pension benefitMetric: Monetary|BC/Liability|LB/Premium provisions [other than local GAAP specific]Metric: Monetary|BC/Liability|LB/Premium provisions [other than local GAAP specific]|IT/After risk mitigation effectMetric: Monetary|BC/Liability|LB/Provisions other than technical provisionsMetric: Monetary|BC/Liability|LB/Receivables/payables [insurance/reinsurance accepted]Metric: Monetary|BC/Liability|LB/Receivables/payables [reinsurance ceded]|CC/CededMetric: Monetary|BC/Liability|LB/Receivables/payables [trade]Metric: Monetary|BC/Liability|LB/Reinsurance deposits and receivables/payables [insurance/reinsurance related]Metric: Monetary|BC/Liability|LB/Reinsurance deposits|CC/Ceded

Page 68: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Liability|LB/Subordinated debt instrumentsMetric: Monetary|BC/Minimum capital requirement [MCR]Metric: Monetary|BC/Own fundsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Initial funds [members' contributions or the equivalent basic own fund item for mutual and mutuaMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Ordinary sharesMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Other items approved by supervisory authorityMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Own funds equivalent to the value of net deferred tax assetsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Preference sharesMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Available to meet SCR criteria|OF/Reconciliation reserveMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Share premium related to preference sharesMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Share premium related to ordinary sharesMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Subordinated debt instrumentsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Subordinated mutual member accountsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Surplus fundsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria [due to local restrictions]Metric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria [other than due to local restrictions]|OF/Ordinary shares|SY/CalMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria [other than due to local restrictions]|OF/Own funds equivalent tMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria [other than due to local restrictions]|OF/Preference sharesMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria [other than due to local restrictions]|OF/Share premium relateMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria [other than due to local restrictions]|OF/Subordinated debt inMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria [other than due to local restrictions]|OF/Subordinated mutuaMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria [other than due to local restrictions]|OF/Surplus fundsMetric: Monetary|BC/Own funds|LL/Minority interests|BE/Basic own fundsMetric: Monetary|BC/Own funds|LL/Minority interests|BE/Basic own funds|MS/Not available to meet SCR criteriaMetric: Monetary|BC/Own funds|BE/Ancillary own funds|EI/Not restricted|MS/Available to meet SCR criteriaMetric: Monetary|BC/Own funds|BE/Ancillary own funds|MS/Available to meet SCR criteria|OF/Other items of own fundsMetric: Monetary|BC/Own funds|BE/Ancillary own funds|MS/Not available to meet SCR criteria|OF/Own funds [before deductions] other than other items of own fundsMetric: Monetary|BC/Own funds|BE/Ancillary own funds|OF/Initial funds [members' contributions or the equivalent basic own fund item for mutual and mutual-type undertakingsMetric: Monetary|BC/Own funds|BE/Ancillary own funds|OF/Legally binding commitment to subscribe and pay for subordinated liabilities|SY/Callable on demandMetric: Monetary|BC/Own funds|BE/Ancillary own funds|OF/Letters of credit and guarantees other than under Article 96[2] of the Framework Directive [received]Metric: Monetary|BC/Own funds|BE/Ancillary own funds|OF/Letters of credit and guarantees under Article 96[2] of the Framework Directive [received]Metric: Monetary|BC/Own funds|BE/Ancillary own funds|OF/Ordinary shares|SY/Callable on demandMetric: Monetary|BC/Own funds|BE/Ancillary own funds|OF/Other items of own fundsMetric: Monetary|BC/Own funds|BE/Ancillary own funds|OF/Preference shares|SY/Callable on demandMetric: Monetary|BC/Own funds|BE/Ancillary own funds|OF/Supplementary members calls - other than under Article 96[3] of the Framework DirectiveMetric: Monetary|BC/Own funds|BE/Ancillary own funds|OF/Supplementary members calls under Article 96[3] of the Framework DirectiveMetric: Monetary|BC/Own funds|BE/Ancillary own fundsMetric: Monetary|BC/Own funds|BE/Basic or ancillary own funds|EI/Not restricted|MS/Available to meet SCR criteriaMetric: Monetary|BC/Own funds|BE/Basic or ancillary own funds|MS/Available to meet SCR criteria|SO/Insurance/reinsurance sectorMetric: Monetary|BC/Own funds|BE/Basic or ancillary own funds|EI/Not restricted|MS/Eligible to meet SCR criteriaMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restrictedMetric: Monetary|BC/Own funds|BE/Basic own funds|MS/Available to meet SCR criteria|OF/Reconciliation reserveMetric: Monetary|BC/Own funds|BE/Basic own funds|MS/Eligible to meet minimum SCR criteriaMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|MS/Not available to meet SCR criteriaMetric: Monetary|BC/Own funds|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Own funds [before deductions]Metric: Monetary|BC/Own funds|BE/Basic own funds|MX/Available to meet MCR criteriaMetric: Monetary|BC/Own funds|BE/Basic own funds|MX/Eligible to meet MCR criteriaMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Article 223 deductionMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Article 228 deductionMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Article 229 deductionMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Deductions|IO/Participations|CT/Financial and credit institutions

Page 69: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Initial funds [members' contributions or the equivalent basic own fund item for mutual and mutual-type Metric: Monetary|BC/Own funds|BE/Basic own funds|OF/Initial funds [members' contributions or the equivalent basic own fund item for mutual and mutual-type undertakings]|SY/CMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Initial funds [members' contributions or the equivalent basic own fund item for mutual and mutual-type undertakings]|SY/Metric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Ordinary sharesMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Oridinary shares|IO/Other than own instruments held directlyMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Ordinary shares|SY/Called up but not yet paid inMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Ordinary shares|SY/Paid inMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Other items approved by supervisory authorityMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Own funds [before deductions] other than reconciliation reserve|IO/Other than own instruments held direMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Own funds equivalent to the value of net deferred tax assetsMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Preference sharesMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Preference shares|DU/DatedMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Preference shares|DU/Undated with a call optionMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Preference shares|DU/Undated with no contractual opportunity to redeemMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Reconciliation reserveMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Share premium related to preference sharesMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Share premium related to ordinary sharesMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Subordinated debt instrumentsMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Subordinated debt instruments|DU/DatedMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Subordinated debt instruments|DU/Undated with a call optionMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Subordinated debt instruments|DU/Undated with no contractual opportunity to redeemMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Subordinated mutual member accountsMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Subordinated mutual member accounts|DU/DatedMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Subordinated mutual member accounts|DU/Undated with a call optionMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Subordinated mutual member accounts|DU/Undated with no contractual opportunity to redeemMetric: Monetary|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Surplus fundsMetric: Monetary|BC/Own funds|BE/Basic own funds|MS/Available to meet SCR criteria|OF/Own funds [before deductions] other than reconciliation reserve|IO/Other than own instrMetric: Monetary|BC/Own funds|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Own funds [before deductions] other than reconciliation reserve|IO/Other than own iMetric: Monetary|BC/Own funds|BE/Basic own funds|MS/Not available to meet SCR criteriaMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Own funds [before deductions] other than reconciliation reserve|IO/Other than own instruments held directly or indirectlMetric: Monetary|BC/Own funds|BE/Items for which a method was approvedMetric: Monetary|BC/Own funds|BE/Items for which an amount was approvedMetric: Monetary|BC/Own funds|BE/Not basic nor ancillary own funds|EI/Not restrictedMetric: Monetary|BC/Own funds|OF/Surplus fundsMetric: Monetary|BC/Own funds|AA/Attributable to shareholdersMetric: Monetary|BC/Own funds|MS/Not available to meet SCR criteriaMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/DeductionsMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Initial funds [members' contributions or the equivalent basic own fund item for mutual and mutual-type undertakings]Metric: Monetary|BC/Own funds|BE/Basic own funds|OF/Ordinary sharesMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Other items approved by supervisory authorityMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Other items of own fundsMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Own funds [before deductions]Metric: Monetary|BC/Own funds|OF/Own funds equivalent to the value of net deferred tax assetsMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Own funds equivalent to the value of net deferred tax assetsMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Preference shares and share premium related to preference sharesMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Preference sharesMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Reconciliation reserveMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Share premium related to preference sharesMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Share premium related to ordinary sharesMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Subordinated debt instrumentsMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Subordinated mutual member accounts

Page 70: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Own funds|BE/Basic own funds|OF/Surplus fundsMetric: Monetary|BC/Own funds|BE/Basic own fundsMetric: Monetary|BC/Own funds|BE/Not basic nor ancillary own fundsMetric: Monetary|BC/Own funds|SO/Credit institutions, investment firms and financial institutions, alternative investment funds managers, UCITS management companiesMetric: Monetary|BC/Own funds|SO/Institutions for occupational retirement provisionMetric: Monetary|BC/Own funds|SO/Non regulated entities carrying out financial activitiesMetric: Monetary|BC/Own funds|SO/Other than insurance/reinsurance sectorMetric: Monetary|BC/Own funds|IG/Excluding intra-group transactionsMetric: Monetary|BC/Payments for reported but not settled claims [RBNS]|CH/Newly reported|SD/OpenMetric: Monetary|BC/Payments for reported but not settled claims [RBNS]|CH/Newly reported|SD/Settled [with payment]Metric: Monetary|BC/Payments for reported but not settled claims [RBNS]|CH/Reopened|SD/OpenMetric: Monetary|BC/Payments for reported but not settled claims [RBNS]|CH/Reopened|SD/Settled [with payment]Metric: Monetary|BC/Payments for reported but not settled claims [RBNS]|SB/Open|SD/OpenMetric: Monetary|BC/Payments for reported but not settled claims [RBNS]|SB/Open|SD/Settled [with payment]Metric: Monetary|BC/Premiums writtenMetric: Monetary|BC/Premiums written|CC/CededMetric: Monetary|BC/Premiums written|CC/Not cededMetric: Monetary|BC/Profit/(loss)[after tax]Metric: Monetary|BC/Reported but not settled claims [RBNS]|CH/Newly reported|SD/OpenMetric: Monetary|BC/Reported but not settled claims [RBNS]|CH/Reopened|SD/OpenMetric: Monetary|BC/Reported but not settled claims [RBNS]|SB/Open|SD/OpenMetric: Monetary|BC/Reported but not settled claims [RBNS]|SB/Open|SD/Settled [with payment]Metric: Monetary|BC/Reported but not settled claims [RBNS]|SB/Open|SD/Settled [without payment]Metric: Monetary|BC/Restricted own fund items due to ring fencingMetric: Monetary|BC/Solvency capital requirement [SCR]Metric: Monetary|BC/Sum insuredMetric: Monetary|BC/Technical flowsMetric: Monetary|BC/Technical flows|CC/CededMetric: Monetary|BC/Valuation movements on financial liabilities and subordinated liabilitiesMetric: Monetary|BC/Valuation movements on investmentsMetric: Monetary|BC/Valuation movements on own sharesMetric: Pure|II/Standard formula|BC/Exposure|PO/Other than ring fenced fundsMetric: Pure|II/Standard formula|BC/Exposure|PO/Ring Fenced FundsMetric: Pure|II/Standard formula|PP/Factor applied for the revision shock|PO/Other than ring fenced fundsMetric: Pure|II/Standard formula|PP/Loss given default|PO/Other than ring fenced fundsMetric: Pure|II/Standard formula|PP/Probability of default|PO/Other than ring fenced fundsMetric: Pure|II/Standard formula|PP/Proportion of damage caused by scenario|PO/Other than ring fenced fundsMetric: Pure|II/Standard formula|PP/Risk charge factor|PO/Other than ring fenced fundsMetric: Pure|II/Standard formula|PP/Standard deviation - adjustment factor for non-proportional reinsurance [undertaking-specific parameter]|PO/Other than ring fenced fundsMetric: Pure|II/Standard formula|PP/Standard deviation [undertaking-specific parameter]|PO/Other than ring fenced fundsMetric: Pure|II/Standard formula|PP/Factor applied for the revision shock|PO/Ring Fenced FundsMetric: Pure|II/Standard formula|PP/Loss given default|PO/Ring Fenced FundsMetric: Pure|II/Standard formula|PP/Probability of default|PO/Ring Fenced FundsMetric: Pure|II/Standard formula|PP/Proportion of damage caused by scenario|PO/Ring Fenced FundsMetric: Pure|II/Standard formula|PP/Risk charge factor|PO/Ring Fenced FundsMetric: Pure|II/Standard formula|PP/Standard deviation - adjustment factor for non-proportional reinsurance [undertaking-specific parameter]|PO/Ring Fenced FundsMetric: Pure|II/Standard formula|PP/Standard deviation [undertaking-specific parameter]|PO/Ring Fenced FundsMetric: Pure|PP/Average profit [or loss] sharing [i.e. own fund share of gain/loss]Metric: Pure|PP/Inflation rateMetric: Pure|PP/Lapse/surrender rate contractsMetric: Pure|PP/Lapse/surrender rate volume

Page 71: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Pure|PP/Percent of interest rateMetric: Pure|PP/Percentage of gross Technical Provisions concerned by used of simplified methods for calculationMetric: Pure|PP/Ratio of Eligible own funds to MCRMetric: Pure|PP/Ratio of Eligible own funds to minimum Group SCRMetric: Pure|PP/Ratio of Eligible own funds to SCRMetric: String|II/Standard formula|PO/Other than ring fenced funds|TS/Single name exposureMetric: String|II/Standard formula|PO/Ring Fenced Funds|TS/Single name exposureMetric: String|TS/Additional information in case of use of discount rates other than risk free ratesMetric: String|TS/Description of additional itemMetric: String|TS/Description of inflation rate usedMetric: String|TS/Description of own funds from the financial statements that should not be represented by the reconciliation reserve and do not meet the criteria to be classified asMetric: String|TS/Valuation basis for statutory accounts valueMetric: Monetary|II/Standard formula|BC/Exposure|OU/Not to be deducted|PO/Other than ring fenced funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Exposure|OU/Not to be deducted|PO/Ring Fenced Funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Exposure|AL/Credit derivatives|PO/Other than ring fenced funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Exposure|AL/Credit derivatives|PO/Ring Fenced Funds|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Exposure|AL/Equity instruments, loans and bonds|IO/Non-strategic participation [not deducted from own funds] and investments other thaMetric: Monetary|II/Standard formula|BC/Exposure|AL/Equity instruments, loans and bonds|IO/Non-strategic participation [not deducted from own funds] and investments other thaMetric: Monetary|II/Standard formula|BC/Exposure|AL/Equity instruments, loans and bonds|IO/Strategic participation [not deducted from own funds]|OU/Not to be deducted|PO/OtheMetric: Monetary|II/Standard formula|BC/Exposure|AL/Equity instruments, loans and bonds|IO/Strategic participation [not deducted from own funds]|OU/Not to be deducted|PO/RinMetric: Monetary|II/Standard formula|BC/Exposure|AL/Loans and bonds other than structured notes and collateralised securities|PO/Other than ring fenced funds|IT/After risk mitigMetric: Monetary|II/Standard formula|BC/Exposure|AL/Loans and bonds other than structured notes and collateralised securities|PO/Ring Fenced Funds|IT/After risk mitigation effeMetric: Monetary|II/Standard formula|BC/Exposure|AL/Structured notes and collateralised securities [tradable that are based on repackaged loans]|PO/Other than ring fenced funds|IMetric: Monetary|II/Standard formula|BC/Exposure|AL/Structured notes and collateralised securities [tradable that are based on repackaged loans]|PO/Ring Fenced Funds|IT/After riMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|OU/Not to be deducted|PO/Other than ring fenced funds|IT/After risk mitigation effect other than froMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|OU/Not to be deducted|PO/Ring Fenced Funds|IT/After risk mitigation effect other than from finite rMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Credit derivatives|PO/Other than ring fenced funds|IT/After risk mitigation effect other than from Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Credit derivatives|PO/Ring Fenced Funds|IT/After risk mitigation effect other than from finite reiMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Equity instruments, loans and bonds|IO/Non-strategic participation [not deducted from own funds] Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Equity instruments, loans and bonds|IO/Non-strategic participation [not deducted from own funds]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Equity instruments, loans and bonds|IO/Strategic participation [not deducted from own funds]|OU/NMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Equity instruments, loans and bonds|IO/Strategic participation [not deducted from own funds]|OU/Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Loans and bonds other than structured notes and collateralised securities|PO/Other than ring fenced Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Loans and bonds other than structured notes and collateralised securities|PO/Ring Fenced Funds|IT/AMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Structured notes and collateralised securities [tradable that are based on repackaged loans]|PO/OtheMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Structured notes and collateralised securities [tradable that are based on repackaged loans]|PO/RingMetric: Monetary|BC/Assets|OB/Collateral heldMetric: Monetary|BC/Assets|OB/Guarantees and letters of credit receivedMetric: Monetary|BC/Assets|AS/Derivatives|OB/Collateral heldMetric: Monetary|BC/Assets|AS/Loans and bonds|OB/Collateral heldMetric: Monetary|BC/Assets|AS/Other than loans, bonds, derivatives and reinsurance deposits|OB/Collateral heldMetric: Monetary|BC/Assets|AS/Reinsurance deposits|OB/Collateral held|CC/CededMetric: Monetary|BC/Liability|OB/Collateral pledgedMetric: Monetary|BC/Liability|LB/Debt instruments [not subordinated]|OB/Collateral pledgedMetric: Monetary|BC/Liability|LB/Derivatives|OB/Collateral pledgedMetric: Monetary|BC/Liability|LB/Reinsurance deposits|OB/Collateral pledgedMetric: Monetary|VG/Solvency II|BC/Off-balance sheet|OB/Collateral heldMetric: Monetary|BC/Off-balance sheet|OB/Collateral pledgedMetric: Monetary|BC/Off-balance sheet|OB/Contingent liabilitiesMetric: Monetary|BC/Off-balance sheet|OB/Limited guarantees and letters of credit received directlyMetric: Monetary|BC/Off-balance sheet|OB/Limited guarantees and letters of credit received for assets held

Page 72: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Off-balance sheet|OB/Unlimited guarantees and letters of credit givenMetric: Monetary|BC/Off-balance sheet|RO/Belonging to the same group|OB/Limited guarantees and letters of credit received directlyMetric: Monetary|BC/Off-balance sheet|RO/Belonging to the same group|OB/Unlimited guarantees and letters of credit givenMetric: Monetary|BC/Off-balance sheet|AS/Derivatives|OB/Collateral heldMetric: Monetary|BC/Off-balance sheet|AS/Loans and bonds|OB/Collateral heldMetric: Monetary|BC/Off-balance sheet|AS/Other than loans, bonds, derivatives and reinsurance deposits|OB/Collateral heldMetric: Monetary|BC/Off-balance sheet|AS/Reinsurance deposits|OB/Collateral held|CC/CededMetric: Monetary|BC/Off-balance sheet|LB/Debt instruments [not subordinated]|OB/Collateral pledgedMetric: Monetary|BC/Off-balance sheet|LB/Derivatives|OB/Collateral pledgedMetric: Monetary|BC/Off-balance sheet|LB/Other than debt instruments [not subordinated], derivatives and reinsurance deposit|OB/Collateral pledgedMetric: Monetary|BC/Off-balance sheet|LB/Reinsurance deposits|OB/Collateral pledgedMetric: Monetary|BC/Liability|LB/Other than debt instruments [not subordinated], derivatives and reinsurance deposit|OB/Collateral pledgedMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IO/Participations [controlling]Metric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IO/Participations [non-controlling]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine|IT/After risk mitigation [risk mitigation cost for reinstalMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine|IT/Risk mitigation effect other than from finite reinsurancMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/MarineMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IG/Excluding intra-group transactionsMetric: Pure|PP/Contribution to group technical provisions [excluding IGT] [%]Metric: Boolean|BX/Captives simplifications used, counterparty default riskMetric: Boolean|BX/Captives simplifications used, health underwriting riskMetric: Boolean|BX/Captives simplifications used, interest rate riskMetric: Boolean|BX/Captives simplifications used, life underwriting riskMetric: Boolean|BX/Captives simplifications used, market concentration riskMetric: Boolean|BX/Captives simplifications used, premium and reserve riskMetric: Boolean|BX/Captives simplifications used, spread riskMetric: Boolean|BX/Simplifications for counterparty default risk usedMetric: Boolean|BX/Simplifications for disability-morbidity risk usedMetric: Boolean|BX/Simplifications for health disability-morbidity risk usedMetric: Boolean|BX/Simplifications for health expense risk usedMetric: Boolean|BX/Simplifications for health longevity risk usedMetric: Boolean|BX/Simplifications for health mortality risk usedMetric: Boolean|BX/Simplifications for lapse risk usedMetric: Boolean|BX/Simplifications for life catastrophe risk usedMetric: Boolean|BX/Simplifications for life expense risk usedMetric: Boolean|BX/Simplifications for longevity risk usedMetric: Boolean|BX/Simplifications for mortality risk usedMetric: Boolean|BX/Simplifications for SLT lapse risk usedMetric: Boolean|BX/Simplifications for spread risk used - bonds and loansMetric: Integer|II/Standard formula|NT/Number of claimsMetric: Integer|II/Standard formula|NT/Number of policyholdersMetric: Integer|II/Standard formula|NT/Number of vehicles policy limit above 24M€Metric: Integer|II/Standard formula|NT/Number of vehicles policy limit below or equal to 24M€Metric: Integer|II/Standard formula|NT/Number of people insuredMetric: Monetary|II/Standard formula|BC/Cost of claimsMetric: Monetary|II/Standard formula|BC/ExpensesMetric: Monetary|II/Standard formula|BC/ExposureMetric: Monetary|II/Standard formula|BC/Exposure|AL/Credit derivatives|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Exposure|AL/Equity instruments, loans and bonds|IO/Non-strategic participation [not deducted from own funds] and investments other thanMetric: Monetary|II/Standard formula|BC/Exposure|IO/Strategic participation [not deducted from own funds]|OU/Not to be deducted|IT/After risk mitigation effect other than fromMetric: Monetary|II/Standard formula|BC/Exposure|AL/Loans and bonds other than structured notes and collateralised securities|IT/After risk mitigation effect other than from fini

Page 73: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|II/Standard formula|BC/Exposure|AL/Structured notes and collateralised securities [tradable that are based on repackaged loans]|IT/After risk mitigation effect otMetric: Monetary|II/Standard formula|BC/Exposure|OU/Not to be deducted|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Exposure|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Largest known accident risk concentrationMetric: Monetary|II/Standard formula|BC/Largest liability limit providedMetric: Monetary|II/Standard formula|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|II/Standard formula|BC/LossMetric: Monetary|II/Standard formula|BC/Premiums writtenMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Credit derivatives|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Equity instruments, loans and bonds|IO/Non-strategic participation [not deducted from own funds] aMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|IO/Strategic participation [not deducted from own funds]|OU/Not to be deducted|IT/After risk mitigatiMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Loans and bonds other than structured notes and collateralised securities|IT/After risk mitigation efMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Structured notes and collateralised securities [tradable that are based on repackaged loans]|IT/AfterMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|OU/Not to be deducted|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AB/Scenario A|IT/After risk mitigation [risk mitigation cost for reinstalment premium and other than frMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AB/Scenario AMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AB/Scenario A|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AB/Scenario A|IT/Risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AB/Scenario B|IT/After risk mitigation [risk mitigation cost for reinstalment premium and other than frMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AB/Scenario BMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AB/Scenario B|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AB/Scenario B|IT/Risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Aviation [hull]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Aviation [liability]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Aviation|IT/After risk mitigation [risk mitigation cost for reinstalment premium and other than fromMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/AviationMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Aviation|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Aviation|IT/Risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine|IT/After risk mitigation [risk mitigation cost for reinstalment premium and other than from fMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine|EA/Excluding the loss-absorbing capacity of technical provisionsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine|IT/Risk mitigation effect other than from finite reinsurance and risk mitigation cost for reiMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|IT/After risk mitigation [risk mitigation cost for reinstalment premium and other than from finite reinsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|IT/Risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|IT/Risk mitigation effect other than from finite reinsurance and risk mitigation cost for reinstalment Metric: Monetary|II/Standard formula|IT/After risk mitigation effect other than from finite reinsuranceMetric: Pure|II/Standard formula|BC/ExposureMetric: Pure|II/Standard formula|PP/Factor applied for the revision shockMetric: Pure|II/Standard formula|PP/Loss given defaultMetric: Pure|II/Standard formula|PP/Probability of defaultMetric: Pure|II/Standard formula|PP/Proportion of damage caused by scenarioMetric: Pure|II/Standard formula|PP/Risk charge factorMetric: Pure|II/Standard formula|PP/Standard deviation - adjustment factor for non-proportional reinsurance [undertaking-specific parameter]Metric: Pure|II/Standard formula|PP/Standard deviation [undertaking-specific parameter]Metric: String|II/Standard formula|TS/Single name exposureMetric: Boolean|BX/Elements of counterparty default risk covered by partial internal modelMetric: Boolean|BX/Elements of health underwriting risk covered by partial internal modelMetric: Boolean|BX/Elements of intangible asset risk covered by partial internal modelMetric: Boolean|BX/Elements of life underwriting risk covered by partial internal modelMetric: Boolean|BX/Elements of market risk covered by partial internal model

Page 74: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Boolean|BX/Elements of non-life underwriting risk covered by partial internal modelMetric: Boolean|BX/Elements of operational risk covered by partial internal modelMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|UG/Before diversification effect|IT/After risk mitigation effect other thaMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|UG/Before diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|UG/Before diversification effect|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|UG/Diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|IO/Participations [controlling]|UG/Before diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|IO/Participations [non-controlling]|UG/Before diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|UG/Before diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|UG/Before diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|TV/Not treated per components|UG/Before diversification effect|IT/After risk mitigation effect otherMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|UG/Before diversification effect|IT/After risk mitigation effect other Metric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|UG/Before diversification effect|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|UG/Diversification effectMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|UG/Before diversification effectMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|UG/Before diversification effectMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|TV/Not treated per components|UG/Before diversification effect|IT/After risk mitigation effect otMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|UG/Before diversification effectMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|UG/Diversification effectMetric: Boolean|BX/Simplifications for spread risk used - bonds and loans|PO/Other than ring fenced fundsMetric: Boolean|BX/Captives simplifications used, interest rate risk|PO/Other than ring fenced fundsMetric: Boolean|BX/Captives simplifications used, spread risk|PO/Other than ring fenced fundsMetric: Boolean|BX/Captives simplifications used, market concentration risk|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for spread risk used - bonds and loans|PO/Ring Fenced FundsMetric: Boolean|BX/Captives simplifications used, interest rate risk|PO/Ring Fenced FundsMetric: Boolean|BX/Captives simplifications used, spread risk|PO/Ring Fenced FundsMetric: Boolean|BX/Captives simplifications used, market concentration risk|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for counterparty default risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Captives simplifications used, counterparty default risk|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for counterparty default risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Captives simplifications used, counterparty default risk|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for mortality risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for longevity risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for disability-morbidity risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for lapse risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for life expense risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for life catastrophe risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Captives simplifications used, life underwriting risk|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for mortality risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for longevity risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for disability-morbidity risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for lapse risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for life expense risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for life catastrophe risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Captives simplifications used, life underwriting risk|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for health mortality risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for health longevity risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for health disability-morbidity risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for SLT lapse risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Simplifications for health expense risk used|PO/Other than ring fenced fundsMetric: Boolean|BX/Captives simplifications used, health underwriting risk|PO/Other than ring fenced funds

Page 75: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Boolean|BX/Simplifications for health mortality risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for health longevity risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for health disability-morbidity risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for SLT lapse risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Simplifications for health expense risk used|PO/Ring Fenced FundsMetric: Boolean|BX/Captives simplifications used, health underwriting risk|PO/Ring Fenced FundsMetric: Boolean|BX/Captives simplifications used, premium and reserve risk|PO/Other than ring fenced fundsMetric: Boolean|BX/Captives simplifications used, premium and reserve risk|PO/Ring Fenced FundsMetric: Type of capital requirementMetric: VG/All members [9]Metric: XL premium flatMetric: Model usedMetric: FF/All members [4]Metric: Asset pledged as collateralMetric: Capital protectionMetric: Types of guarantee (Preparatory scope)Metric: CIC codeMetric: CIC code [third digit] of most significant collateralMetric: Code brokerMetric: Code of fundMetric: Code of group of debtor pledging the collateralMetric: Code reinsurerMetric: Composite limited CIC code of underlyingMetric: Consolidation method 1 used for group solvency assessment of at least one undertaking in the scopeMetric: Level of influenceMetric: Aggregation of capital requirementMetric: RO/All members [11]|OB/Unlimited guarantees and letters of credit receivedMetric: Inclusion in the scope of Group supervisionMetric: Swap delivered currencyMetric: Swap received currencyMetric: Original currency of exposure/transaction/instrumentMetric: Currency used for reporting (Preparatory scope)Metric: Placement currency/currency of contractMetric: Currency - Local or foreignMetric: Date|OB/Unlimited guarantees and letters of credit given|TD/Application date of guaranteeMetric: Date|OB/Unlimited guarantees and letters of credit received|TD/Application date of guaranteeMetric: Date|TD/Date of approval of latest major change in internal modelMetric: Date|TD/Date of authorisationMetric: Date|TD/Date of decision related to solo capital add-onMetric: Date|TD/Date of inclusion in the scope of group supervisionMetric: Date|TD/Date of initial approval of internal modelMetric: Date|TD/Date rating assignedMetric: Date|TD/Effective date of agreement/contract underlying transaction if applicableMetric: Date|TD/End dateMetric: Date|TD/End date|IG/Intragroup transactionsMetric: Date|TD/Expiry date of agreement/contract underlying transaction if applicableMetric: Date|TD/First call dateMetric: Date|TD/Maturity dateMetric: Date|TD/Maturity date|IG/Intragroup transactionsMetric: Date|TD/Reference dateMetric: Date|TD/Reporting date

Page 76: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Date|TD/Start dateMetric: Date|TD/Start date|IG/Intragroup transactionsMetric: Date|TD/Trade dateMetric: Date|TD/Transaction/issue dateMetric: Date|TD/Transaction/issue date|IG/Intragroup transactionsMetric: Decimal|DC/Delta (old)Metric: Decimal|DC/Quantity (old)Metric: Decimal|DC/Quantity|OB/Collateral held (old)Metric: Decimal|NT/Number of months for notice (old)Metric: Ancillary Own Funds|OB/Unlimited guarantees and letters of credit receivedMetric: External ratingMetric: Facultative reinsurance placement identification codeMetric: AH/All members (Not applicable/All geographical areas) [5]Metric: Country of custody (including not applicable)Metric: Issuer Country (including not applicable)Metric: Group identification codeMetric: ID code of underlyingMetric: ID of counterparty [in repo/securities lending]Metric: Integer|DI/Year to Date|NT/Number of new contractsMetric: Integer|NT/Number of contractsMetric: Integer|NT/Number of surplus/layers in programMetric: Integer|NT/Number of underlying assetsMetric: Held in unit linked and index linked fundsMetric: Line of Business (Life and Health SLT)Metric: Products commercialized or notMetric: Type of premium (Preparatory scope)Metric: Use of financial instrument for replication ? (Y/N/P)Metric: ProportionalMetric: Type of structured product (Preparatory scope)Metric: Limited CIC codeMetric: ZR/All members [1]|OB/Unlimited guarantees and letters of credit givenMetric: Synthetic structured product (Preparatory scope)Metric: Long or short position (closed)Metric: Long or short position (open)Metric: Type of IGT (Cost sharing, contingent liabilities [other than derivatives] and off-balance sheet items and other) (Preparatory scope)Metric: Type of IGT (Derivatives) (Preparatory scope)Metric: Type of IGT (Equity-type, debt and asset transfer) (Preparatory scope)Metric: Monetary|TA/Balance of contractual amount|VG/Solvency II|BC/TransactionMetric: Monetary|TA/Top-ups|VG/Solvency II|BC/Transaction|DI/Year to DateMetric: Monetary|TA/Original contractual amount|VG/Solvency II|BC/TransactionMetric: Monetary|TA/Acquisition price [per unit]|VG/Solvency II|BC/AssetsMetric: Monetary|TA/Aggregate deductibles|VG/Solvency II|BC/Reinsurance contract/treaty cover conditionsMetric: Monetary|TA/Contribution to the group|VG/Solvency II|BC/Own funds|BE/Basic own funds|OF/Other items of own fundsMetric: Monetary|TA/Contribution to the group|VG/Solvency II|BC/Own funds|BE/Basic own funds|OF/Subordinated debt instrumentsMetric: Monetary|TA/Contribution to the group|VG/Solvency II|BC/Own funds|BE/Basic own funds|OF/Subordinated mutual member accountsMetric: Monetary|TA/Estimated subject|VG/Solvency II|BC/Premium incomeMetric: Monetary|TA/Estimated treaty|VG/Solvency II|BC/Premium incomeMetric: Monetary|TA/Far leg|VG/Solvency II|BC/Repo and securities lendingMetric: Monetary|TA/Inflow amount|VG/Solvency II|BC/Assets and/or liabilities|DI/Year to Date|AL/DerivativesMetric: Monetary|TA/Limit|VG/Solvency II|BC/Reinsurance contract/treaty cover conditionsMetric: Monetary|TA/Maximum cover per treaty|VG/Solvency II|BC/Reinsurance contract/treaty cover conditions

Page 77: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|TA/Maximum cover|VG/Solvency II|BC/Reinsurance contract/treaty cover conditionsMetric: Monetary|TA/Maximum cover|BC/Reinsurance contract/treaty cover conditions|IG/Intragroup transactionsMetric: Monetary|TA/Maximum loss under unwinding event|VG/Solvency II|BC/Assets and/or liabilities|AL/DerivativesMetric: Monetary|TA/Maximum value|VG/Solvency II|BC/Exposure|CC/CededMetric: Monetary|TA/Maximum value|VG/Solvency II|BC/LossMetric: Monetary|TA/Maximum value|VG/Solvency II|BC/Sum reinsuredMetric: Monetary|TA/Maximum value|VG/Solvency II|BC/Exposure|EX/Exposure other than reinsuranceMetric: Monetary|TA/Maximum value|VG/Solvency II|BC/Exposure|EX/Reinsurance exposureMetric: Monetary|TA/Maximum value|VG/Prudential|BC/Liability|RO/Belonging to the same group|LB/ContingentMetric: Monetary|TA/Maximum value|VG/Prudential|BC/Off-balance sheet|RO/Belonging to the same group|OB/Contingent liabilitiesMetric: Monetary|TA/Near leg|VG/Solvency II|BC/Repo and securities lendingMetric: Monetary|TA/Notional amount|VG/Solvency II|BC/AssetsMetric: Monetary|TA/Notional amount [at transaction date]|VG/Solvency II|BC/TransactionMetric: Monetary|TA/Notional amount|VG/Solvency II|BC/Assets and/or liabilities|AL/DerivativesMetric: Monetary|TA/Notional amount|VG/Solvency II|BC/TransactionMetric: Monetary|TA/Notional amount|BC/Off-balance sheet|OB/Collateral heldMetric: Monetary|TA/Outflow amount|VG/Solvency II|BC/Assets and/or liabilities|DI/Year to Date|AL/DerivativesMetric: Monetary|TA/Possible negative|BC/Solvency capital requirement [SCR]|FZ/Risks inside ring fenced funds/matching portfolios|UG/Before diversification effectMetric: Monetary|TA/Premium paid/received to date|BC/Assets and/or liabilities|AL/DerivativesMetric: Monetary|TA/Realized and not realized|VG/Solvency II|BC/Income|TE/Dividends|DI/Year to DateMetric: Monetary|TA/Realized and not realized|VG/Solvency II|BC/Income|TE/Interests|DI/Year to DateMetric: Monetary|TA/Realized and not realized|VG/Solvency II|BC/Income|TE/Rent|DI/Year to DateMetric: Monetary|TA/Realized|VG/Solvency II|BC/Income|DI/Year to DateMetric: Monetary|TA/Redemptions/prepayments/paybacks|VG/Solvency II|BC/Transaction|DI/Year to DateMetric: Monetary|TA/Result of transaction|BC/Transaction|DI/Year to Date|TT/Reinsurance contracts|IG/Intragroup transactionsMetric: Monetary|TA/Retention or priority|VG/Solvency II|BC/Reinsurance contract/treaty cover conditionsMetric: Monetary|TA/Surrender value|VG/Solvency II|BC/LiabilityMetric: Monetary|TA/Unit price|VG/Solvency II without accrued interests|BC/AssetsMetric: Monetary|VG/Solvency II|BC/Assets and/or liabilities|AL/DerivativesMetric: Monetary|VG/Accrued interests|BC/AssetsMetric: Monetary|VG/Accrued interests|BC/Off-balance sheet|OB/Collateral heldMetric: Monetary|VG/Prudential other than Solvency II|BC/AssetsMetric: Monetary|VG/Solvency II|BC/AssetsMetric: Monetary|VG/Prudential|BC/Off-balance sheet|OB/Collateral heldMetric: Monetary|VG/Solvency II|BC/Assets|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash eMetric: Monetary|VG/Solvency II|BC/Claims paid|DI/Year to DateMetric: Monetary|VG/Solvency II|BC/Excess of assets over liabilities|AA/Eligible for undertaking|EI/Restricted|FZ/Risks inside ring fenced fundsMetric: Monetary|VG/Solvency II|BC/Excess of assets over liabilities|AA/Eligible for undertaking|FZ/Risks inside ring fenced funds/matching portfoliosMetric: Monetary|VG/Solvency II|BC/Excess of assets over liabilities|FZ/Risks inside ring fenced funds/matching portfoliosMetric: Monetary|VG/Solvency II|BC/Excess of assets over liabilities|AS/Receivables/payables [reinsurance ceded]|IO/Other than investment, own use, own instruments held direcMetric: Monetary|VG/Solvency II|BC/ExposureMetric: Monetary|BC/Guarantees received [on- and off-balance]|GR/Collateral held|CC/CededMetric: Monetary|BC/Guarantees received [on- and off-balance]|GR/Financial guarantees|CC/CededMetric: Monetary|BC/Assets|GR/Cash deposits|CC/CededMetric: Monetary|BC/Guarantees received [on- and off-balance]|CC/CededMetric: Monetary|VG/Solvency II|BC/Income|TE/CommissionsMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|VL/Calculated as a whole and best estimateMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic own funds|TX/Tier 1|OF/Other items approved by supervisory authorityMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic own funds|TX/Tier 2|OF/Other items approved by supervisory authorityMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic own funds|TX/Tier 3|OF/Other items approved by supervisory authorityMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic own funds|OF/Other items of own funds

Page 78: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic own funds|OF/Preference sharesMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic own funds|OF/Subordinated debt instrumentsMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic own funds|EI/Not restricted|OF/Subordinated mutual member accountsMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic own funds|OF/Subordinated mutual member accountsMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Not basic nor ancillary own fundsMetric: Monetary|VG/Solvency II|BC/Premiums writtenMetric: Monetary|VG/Solvency II|BC/Premiums written|CC/FacultativeMetric: Monetary|VG/Solvency II|BC/Repo and securities lendingMetric: Monetary|VG/Solvency II|BC/Sum insuredMetric: Monetary|VG/Solvency II|BC/Sum insured|OS/Other than retained by policyholder|CC/FacultativeMetric: Monetary|VG/Solvency II|BC/Sum insured|OS/Other than retained by policyholder|CC/Not cededMetric: Monetary|VG/Solvency II|BC/Sum insured|OS/Other than retained by policyholder|CC/Reinsurance other than facultativeMetric: Monetary|VG/Solvency II|BC/Sum insured|OS/Retained by policyholderMetric: Monetary|VG/Solvency II|BC/Sum insured|OS/Sum insured by the reporting entity not including technical provisions [other than local GAAP specific]Metric: Monetary|VG/Solvency II|BC/TransactionMetric: Monetary|VG/Solvency II|BC/Assets [of another entity]|PO/Other than ring fenced fundsMetric: Monetary|VG/Solvency II|BC/Assets [of another entity]|PO/Ring Fenced FundsMetric: Monetary|VG/Solvency II|BC/Off-balance sheet [of another entity]Metric: Monetary|VG/Statutory accounts|BC/AssetsMetric: Monetary|VG/Statutory accounts|BC/Income|DI/Year to DateMetric: Monetary|VG/Statutory accounts|BC/Premiums written|DI/Year to Date|IZ/Accepted during the period|CC/Not cededMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|TV/Treated per components|IT/After risk mitigation effect other thaMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|TV/Treated per components|IT/After risk mitigation effect other thanMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|TV/Treated per components|IT/After risk mitigation effect other than from finiMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|TV/Treated per components|IT/After risk mitigation effect other than from finiMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|IT/After risk mitigation effect other than from finite reinsurance|EA/ExclMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|IT/After risk mitigation effect other than from finite reinsurance|EA/InclMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|TV/Treated per components|IT/After risk mitigation effect other Metric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|TV/Treated per components|IT/After risk mitigation effect other tMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|TV/Treated per components|IT/After risk mitigation effect other than from fMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|TV/Treated per components|IT/After risk mitigation effect other than from fMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|IT/After risk mitigation effect other than from finite reinsurance|EA/EMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|IT/After risk mitigation effect other than from finite reinsurance|EA/InMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|EA/Capital add-onMetric: Monetary|BC/Assets|OE/Subordinated liabilities|AS/Financial [other than receivables/payables and recoverables]|IO/Participations in financial and credit institutions which aMetric: Monetary|BC/Assets|OE/Type 1 Equity|AS/Financial [other than receivables/payables and recoverables]|IO/Participations in financial and credit institutions which are consideMetric: Monetary|BC/Assets|OE/Type 2 Equity|AS/Financial [other than receivables/payables and recoverables]|IO/Participations in financial and credit institutions which are consideMetric: Monetary|BC/Assets|TX/Tier 1 – unrestricted|AS/Financial [other than receivables/payables and recoverables]|IO/Participations in financial and credit institutions which individuaMetric: Monetary|BC/Assets|TX/Tier 1 – unrestricted|AS/Financial [other than receivables/payables and recoverables]|IO/Participations in financial and credit institutions which when agMetric: Monetary|BC/Assets|TX/Tier 1 – restricted|AS/Financial [other than receivables/payables and recoverables]IO/Participations in financial and credit institutions which individuallyMetric: Monetary|BC/Assets|TX/Tier 1 – restricted|AS/Financial [other than receivables/payables and recoverables]|IO/Participations in financial and credit institutions which when aggreMetric: Monetary|BC/Assets|TX/Tier 1 and Tier 2|AS/Financial [other than receivables/payables and recoverables]|IO/Participations in financial and credit institutions which individually Metric: Monetary|BC/Assets|TX/Tier 1 and Tier 2|AS/Financial [other than receivables/payables and recoverables]|IO/Participations in financial and credit institutions which when aggregMetric: Monetary|BC/Assets|TX/Tier 2|AS/Financial [other than receivables/payables and recoverables]|IO/Participations in financial and credit institutions which individually exceed 10% Metric: Monetary|BC/Assets|TX/Tier 2|AS/Financial [other than receivables/payables and recoverables]|IO/Participations in financial and credit institutions which when aggregated exceedMetric: Monetary|BC/Assets|BL/Life and Health SLT|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash andMetric: Monetary|BC/Assets|BL/Non-life and Health non-SLT|AS/Claims recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directMetric: Monetary|BC/Assets|BL/Non-life and Health non-SLT|AS/Premium recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held direMetric: Monetary|BC/Assets|AS/Financial [other than receivables/payables and recoverables]|IO/Non-strategic participation [not deducted from own funds]Metric: Monetary|BC/Assets|AS/Financial [other than receivables/payables and recoverables]|IO/Participations in financial and credit institutions which are considered strategic as dMetric: Monetary|BC/Assets|AS/Financial [other than receivables/payables and recoverables]|IO/Strategic participation [not deducted from own funds]

Page 79: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Assets|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CC/CMetric: Monetary|VG/Solvency II|BC/Assets|AS/Recoverables|IO/Other than investment, own use, own instruments and cash and cash equivalents|RR/Before the adjustment for expMetric: Monetary|BC/Claims paid|DI/Year to Date|IG/Intragroup transactionsMetric: Monetary|BC/Economical result|DI/Year to Date|BL/Variable annuities|TB/Direct Business|SH/Assuming hedgingMetric: Monetary|BC/Economical result|DI/Year to Date|BL/Variable annuities|TB/Direct Business|SH/Not assuming hedgingMetric: Monetary|VG/Solvency II|BC/Eligible own funds in accordance with local rulesMetric: Monetary|BC/Excess of assets over liabilities|AS/Receivables/payables [reinsurance ceded]|IO/Other than investment, own use, own instruments held directly and cash anMetric: Monetary|VG/Solvency II|BC/Liability|BL/Health non-SLT|LB/Gross technical provisions [other than local GAAP specific]|VV/Amount before transitional on Technical ProvisiMetric: Monetary|VG/Solvency II|BC/Liability|BL/Health non-SLT|LB/Gross technical provisions [other than local GAAP specific]|IG/Excluding intra-group transactions|VV/Amount befMetric: Monetary|VG/Solvency II|BC/Liability|BL/Health SLT and annuities stemming from non-life insurance contracts and relating to health insurance obligations|LB/Gross technicaMetric: Monetary|VG/Solvency II|BC/Liability|BL/Life and annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obliMetric: Monetary|VG/Solvency II|BC/Liability|BL/Life and annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obliMetric: Monetary|VG/Solvency II|BC/Liability|BL/Life [other than Index-linked and unit-linked insurance and Health SLT]|LB/Gross technical provisions [other than local GAAP specifiMetric: Monetary|VG/Solvency II|BC/Liability|BL/Non-life|LB/Gross technical provisions [other than local GAAP specific]|VV/Amount before transitional on Technical ProvisionsMetric: Monetary|VG/Solvency II|BC/Liability|BL/Non-life|LB/Gross technical provisions [other than local GAAP specific]|IG/Excluding intra-group transactions|VV/Amount before traMetric: Monetary|VG/Solvency II|BC/Liability|BL/Unit-linked or index-linked|LB/Gross technical provisions [other than local GAAP specific]|VV/Amount before transitional on TechniMetric: Monetary|VG/Solvency II|BC/Liability|BL/Unit-linked or index-linked|LB/Gross technical provisions [other than local GAAP specific]|IG/Excluding intra-group transactions|VMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|CC/CededMetric: Monetary|VG/Solvency II|BC/Local capital requirementMetric: Monetary|VG/Solvency II|BC/Local minimum capital requirementMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|EE/EEA|OF/Ordinary shares|SY/Called up but not yet paid inMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|EE/EEA|OF/Own funds equivalent to the value of net deferred Metric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|EE/EEA|OF/Preference sharesMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|EE/EEA|OF/Subordinated debt instrumentsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|EE/EEA|OF/Subordinated mutual member accountsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|EE/EEA|OF/Surplus fundsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|EE/Not EEA countriesMetric: Monetary|BC/Own funds|BE/Ancillary own funds|MS/Available to meet SCR criteriaMetric: Monetary|BC/Own funds|BE/Basic or ancillary own funds|MS/Available to meet SCR criteriaMetric: Monetary|VG/Solvency II|BC/PerformanceMetric: Monetary|VG/Solvency II|BC/Performance|PF/InvestmentMetric: Monetary|VG/Solvency II|BC/Performance|PF/UnderwritingMetric: Monetary|BC/Shareholder value|AA/Attributable to shareholders|EI/Restricted|FZ/Risks inside ring fenced funds/matching portfoliosMetric: Monetary|BC/Shareholder value|AA/Attributable to shareholders|FZ/Risks inside ring fenced funds/matching portfoliosMetric: Monetary|BC/Solvency capital requirement [SCR]|FZ/Risks inside ring fenced funds/matching portfolios|UG/Before diversification effectMetric: Monetary|VG/Solvency II|BC/Solvency capital requirement [SCR]|RT/Counterparty default risk|UG/Before diversification effect|EA/Excluding the loss-absorbing capacity of tMetric: Monetary|VG/Solvency II|BC/Solvency capital requirement [SCR]|RT/Health underwriting risk|UG/Before diversification effect|EA/Excluding the loss-absorbing capacity of teMetric: Monetary|VG/Solvency II|BC/Solvency capital requirement [SCR]|RT/Life underwriting risk|UG/Before diversification effect|EA/Excluding the loss-absorbing capacity of technMetric: Monetary|VG/Solvency II|BC/Solvency capital requirement [SCR]|RT/Market risk|UG/Before diversification effect|EA/Excluding the loss-absorbing capacity of technical proviMetric: Monetary|VG/Solvency II|BC/Solvency capital requirement [SCR]|RT/Non-life underwriting risk|UG/Before diversification effect|EA/Excluding the loss-absorbing capacity of tMetric: Monetary|VG/Solvency II|BC/Solvency capital requirement [SCR]|RT/Operational risk|UG/Before diversification effect|EA/Including the loss-absorbing capacity of technical Metric: Monetary|BC/Assets|OE/Subordinated liabilities|AS/Financial [other than receivables/payables and recoverables]|IO/Non-strategic participation [not deducted from own fuMetric: Monetary|BC/Assets|OE/Subordinated liabilities|AS/Financial [other than receivables/payables and recoverables]|IO/Strategic participation [not deducted from own funds]Metric: Monetary|BC/Assets|OE/Type 1 Equity|AS/Financial [other than receivables/payables and recoverables]|IO/Non-strategic participation [not deducted from own funds]Metric: Monetary|BC/Assets|OE/Type 1 Equity|AS/Financial [other than receivables/payables and recoverables]|IO/Strategic participation [not deducted from own funds]Metric: Monetary|BC/Assets|OE/Type 2 Equity|AS/Financial [other than receivables/payables and recoverables]|IO/Non-strategic participation [not deducted from own funds]Metric: Monetary|BC/Assets|OE/Type 2 Equity|AS/Financial [other than receivables/payables and recoverables]|IO/Strategic participation [not deducted from own funds]Metric: Name of debtor pledging the collateralMetric: Name of reinsured entityMetric: Nature of exposureMetric: Callable or Putable

Page 80: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Underlying securityMetric: Prepayments for structured productsMetric: Pure|TA/Aggregate deductibles|BC/Reinsurance contract/treaty cover conditionsMetric: Pure|TA/Limit|BC/Reinsurance contract/treaty cover conditionsMetric: Pure|TA/Retention or priority|BC/Reinsurance contract/treaty cover conditionsMetric: Pure|VG/Solvency II without accrued interests|PP/Percentage of par valueMetric: Pure|BL/Health non-SLT|PP/Contribution to group technical provisions [%]|IG/Excluding intra-group transactionsMetric: Pure|BL/Health SLT and annuities stemming from non-life insurance contracts and relating to health insurance obligations|PP/Contribution to group technical provisions [%]|Metric: Pure|BL/Life and annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligations [other than unit-linked oMetric: Pure|BL/Non-life|PP/Contribution to group technical provisions [%]|IG/Excluding intra-group transactionsMetric: Pure|BL/Unit-linked or index-linked|PP/Contribution to group technical provisions [%]|IG/Excluding intra-group transactionsMetric: Pure|BL/Variable annuities|TB/Direct Business|PP/Percentage of the level of guaranteeMetric: Pure|PP/Attachment pointMetric: Pure|PP/Detachment pointMetric: Pure|PP/Fixed annual returnMetric: Pure|PP/Loss given defaultMetric: Pure|PP/Percent of the issue held by entities in the groupMetric: Pure|PP/Percent of voting rightsMetric: Pure|PP/Percent used for the establishment of accounting consolidated accountsMetric: Pure|PP/Percentage of share reinsurerMetric: Pure|PP/Proportion of the subscribed capital that is held, directly or indirectly, by the participating undertaking in the undertakingMetric: Pure|PP/Proportional share retainedMetric: Pure|PP/XL rate 1Metric: Pure|PP/XL rate 2Metric: Product classification IDMetric: Progressive number of surplus/layer in programMetric: AR/All members [11]Metric: Participation (Solo)Metric: Portfolio (investment, securities lending and repo) (Preparatory scope)Metric: Use of derivative (Preparatory scope)Metric: Rating agencyMetric: Reinsurance program codeMetric: Risk identification codeMetric: Undertaking typeMetric: Issuer sectorMetric: Composite undertakingMetric: Section code in the treatyMetric: String|II/Full internal model|PO/Other than ring fenced funds|TV/Treated per components|TS/Description of componentMetric: String|II/Full internal model|PO/Ring Fenced Funds|TV/Treated per components|TS/Description of componentMetric: String|II/Full internal model|TV/Treated per components|TS/Description of componentMetric: String|II/Partial internal model|PO/Other than ring fenced funds|TV/Treated per components|TS/Description of componentMetric: String|II/Partial internal model|PO/Ring Fenced Funds|TV/Treated per components|TS/Description of componentMetric: String|II/Partial internal model|TV/Treated per components|TS/Description of componentMetric: String|BL/Variable annuities|TB/Direct Business|TS/Description of guarantees [cover term]Metric: String|BL/Variable annuities|TB/Direct Business|TS/Description of guarantees [general]Metric: String|BL/Variable annuities|TB/Direct Business|HD/Hedged risks other than delta, rho, gamma, vega and FX|TS/Names of hedged risksMetric: String|BL/Variable annuities|TB/Direct Business|TS/Product denominationMetric: String|OB/Unlimited guarantees and letters of credit given|TS/Name of receiver of guaranteeMetric: String|TT/Credit protection derivatives|TS/Name of counterparty for which credit protection is purchasedMetric: String|TT/Futures, forwards, options and other derivatives|TS/Description of asset/liability underlying the derivativeMetric: String|TT/Swaps - interest rate|TS/Swap delivered interest rate [for buyer]

Page 81: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: String|TT/Swaps - interest rate|TS/Swap received interest rate [for buyer]Metric: String|TS/Counterparty groupMetric: String|TS/Issuer groupMetric: String|TS/Item titleMetric: String|OB/Unlimited guarantees and letters of credit received|TS/Name of collateral/guarantee providerMetric: String|TS/Trigger valueMetric: String|TS/Contract nameMetric: String|TS/Counterparty IDMetric: String|TS/Accounting standardMetric: String|TS/Coupon/interest rateMetric: String|TS/Description of ancillary own fundsMetric: String|TS/Description of average guaranteed rate to the policy holder over the life time of the contractMetric: String|TS/Description of basis risk arising from contractual termsMetric: String|TS/Description of basis risk arising from risk-transfer structureMetric: String|TS/Description of cases where either the reinsurer's participation is at conditions different from those of the standard facultative or treaty placement, or to provide aMetric: String|TS/Description of countries or group of countriesMetric: String|TS/Description of criteria of influence other than percent of capital share, Percent used for the establishment of accounting consolidated accounts and percent of votinMetric: String|TS/Description of further call datesMetric: String|TS/Description of impact on: assets/liability/off-balance sheetMetric: String|TS/Description of incentives to redeemMetric: String|TS/Description of inclusion of catastrophic guaranteesMetric: String|BE/Basic own funds|TS/Description of item approved by supervisory authority as basic own fundsMetric: String|TS/Description of legal natureMetric: String|TS/Description of material investments held by cedant in securitisationMetric: String|TS/Description of preference shareMetric: String|TS/Description of reason[s] stated by the supervisor in it’s decision related to capital add-onMetric: String|TS/Description of riskMetric: String|TS/Description of subordinated MMAMetric: String|TS/Description of trigger eventMetric: String|TS/Description of trigger valueMetric: String|TS/Description of type of productMetric: String|TS/Description risk category coveredMetric: String|TS/Description, if approval of full internal model for calculating solo SCR regards a solo internal model or group internal modelMetric: String|TS/Description, where partial internal model was used in standard formula [if anywhere]Metric: String|TS/Description, where simplifications were used in standard formula [if anywhere]Metric: String|TS/Description, where undertaking specific parameters were used in standard formula [if anywhere]Metric: String|TS/Descriptions of reinstatementsMetric: String|TS/Explanation if the item has been bought backMetric: String|TS/Incorporation numberMetric: String|TS/Legal formMetric: String|TS/Legal name of undertakingMetric: String|TS/Name of brokerMetric: String|TS/Name of counterpartyMetric: String|TS/Name of insured entityMetric: String|TS/Name of investor/buyer/transferee/payer/reinsured/beneficiaryMetric: String|TS/Name of issuer/seller/transferor/receiver/reinsurer/providerMetric: String|TS/Name of reinsurerMetric: String|TS/Name of ring fenced fundMetric: String|TS/Name of SPVMetric: String|TS/Name of Supervisory AuthorityMetric: String|TS/Name of the counterparty of the Group

Page 82: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: String|TS/Names of group entities subject to the exposureMetric: String|TS/Product denominationMetric: String|TS/Type of risk transferredMetric: String|TS/Variable annual returnMetric: AC/All members [7]Metric: Activity code broker (Preparatory scope)Metric: Type of repo/securities lending; Buyer or seller/Lender or borrowerMetric: Types of hedging strategiesMetric: Type of reinsurance contract/treaty (Preparatory scope)Metric: Finite reinsurance or similar arrangementsMetric: Type of underwriting model (SI, MPL, PML, EML or Other)Metric: Treaty identification codeMetric: Type of asset for which collateral is heldMetric: Loss-absorbing capacity of deferred taxesMetric: Loss-absorbing capacity of technical provisionsMetric: Valuation methodMetric: Type of reinsurer (Preparatory scope)Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine tanker collision [hull]|EA/Excluding the loss-absorbing capMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine tanker collision [liability]|EA/Excluding the loss-absorbing Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine tanker collision [oil pollution liability]|EA/Excluding the loMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine tanker collision|IT/After risk mitigation [risk mitigation coMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine tanker collision|IT/Risk mitigation effect other than from fMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine tanker collision|IT/Risk mitigation cost for reinstalment pMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine tanker collision|EA/Excluding the loss-absorbing capacity Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine platform explosion [property damage]|EA/Excluding the loMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine platform explosion [removal of wreckage]|EA/Excluding theMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine platform explosion [loss of production income]|EA/ExcludinMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine platform explosion [capping of the well or making the well Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine platform explosion [liability insurance and reinsurance obliMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine platform explosion|IT/After risk mitigation [risk mitigationMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine platform explosion|IT/Risk mitigation effect other than froMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine platform explosion|IT/Risk mitigation cost for reinstalmenMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|RT/Marine platform explosion|EA/Excluding the loss-absorbing capaciMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine tanker collision [hull]|EA/Excluding the loss-absorbing capacity of tMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine tanker collision [liability]|EA/Excluding the loss-absorbing capacity oMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine tanker collision [oil pollution liability]|EA/Excluding the loss-absorbiMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine tanker collision|IT/After risk mitigation [risk mitigation cost for reinMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine tanker collision|IT/Risk mitigation effect other than from finite reinsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine tanker collision|IT/Risk mitigation cost for reinstalment premiums|EAMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine tanker collision|EA/Excluding the loss-absorbing capacity of technicMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine platform explosion [property damage]|EA/Excluding the loss-absorbiMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine platform explosion [removal of wreckage]|EA/Excluding the loss-absoMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine platform explosion [loss of production income]|EA/Excluding the lossMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine platform explosion [capping of the well or making the well secure]|EAMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine platform explosion [liability insurance and reinsurance obligations]|EMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine platform explosion|IT/After risk mitigation [risk mitigation cost for rMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine platform explosion|IT/Risk mitigation effect other than from finite reMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine platform explosion|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|RT/Marine platform explosion|EA/Excluding the loss-absorbing capacity of techMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision [hull]|EA/Excluding the loss-absorbing capacity of technical provisionsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision [liability]|EA/Excluding the loss-absorbing capacity of technical provisions

Page 83: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision [oil pollution liability]|EA/Excluding the loss-absorbing capacity of technicalMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision|IT/After risk mitigation [risk mitigation cost for reinstalment premium and oMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision|IT/Risk mitigation effect other than from finite reinsurance|EA/Excluding thMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision|IT/Risk mitigation cost for reinstalment premiums|EA/Excluding the loss-absMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision|EA/Excluding the loss-absorbing capacity of technical provisionsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion [property damage]|EA/Excluding the loss-absorbing capacity of technicaMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion [removal of wreckage]|EA/Excluding the loss-absorbing capacity of techMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion [loss of production income]|EA/Excluding the loss-absorbing capacity ofMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion [capping of the well or making the well secure]|EA/Excluding the loss-abMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion [liability insurance and reinsurance obligations]|EA/Excluding the loss-abMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion|IT/After risk mitigation [risk mitigation cost for reinstalment premium anMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion|IT/Risk mitigation effect other than from finite reinsurance|EA/ExcludingMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion|IT/Risk mitigation cost for reinstalment premiums|EA/Excluding the lossMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion|EA/Excluding the loss-absorbing capacity of technical provisionsMetric: String|II/Partial internal model|TV/Treated per components|UG/Before diversification effect|TS/Description of componentMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|UG/Before diversification effect|IT/After risk mitigation effect other tMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|UG/Before diversification effect|IT/After risk mitigation effect other tMetric: String|II/Full internal model|TV/Treated per components|UG/Before diversification effect|TS/Description of componentMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|UG/Before diversification effect|IT/After risk mitigation effect other thanMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|TV/Treated per components|UG/Before diversification effect|IT/After risk mitigation effect other thanMetric: BooleanMetric: String|TP/Basic Information|TS/Template reporting statusMetric: String|TP/Balance Sheet|TS/Template reporting statusMetric: String|TP/Assets and liabilities by currency|TS/Template reporting statusMetric: String|TP/List of assets|TS/Template reporting statusMetric: String|TP/Open derivatives|TS/Template reporting statusMetric: String|TP/Life and Health SLT Technical Provisions|TS/Template reporting statusMetric: String|TP/Non-Life Technical Provisions|TS/Template reporting statusMetric: String|TP/Own funds|TS/Template reporting statusMetric: String|TP/Solvency Capital Requirement - SF|TS/Template reporting statusMetric: String|TP/Solvency Capital Requirement - PIM|TS/Template reporting statusMetric: String|TP/Solvency Capital Requirement - IM|TS/Template reporting statusMetric: String|TP/Solvency Capital Requirement - Market risk|TS/Template reporting statusMetric: String|TP/Solvency Capital Requirement - Counterparty default risk|TS/Template reporting statusMetric: String|TP/Solvency Capital Requirement - Life underwriting risk|TS/Template reporting statusMetric: String|TP/Solvency Capital Requirement - Health underwriting risk|TS/Template reporting statusMetric: String|TP/Solvency Capital Requirement - Non-Life underwriting risk|TS/Template reporting statusMetric: String|TP/Solvency Capital Requirement - Operational risk|TS/Template reporting statusMetric: String|TP/Solvency Capital Requirement - Non-Life Catastrophe risk|TS/Template reporting statusMetric: String|TP/Minimum Capital Requirement|TS/Template reporting statusMetric: String|TP/Minimum Capital Requirement - Composite|TS/Template reporting statusMetric: String|TP/Entities in the scope of the group|TS/Template reporting statusMetric: String|TP/(Re)insurance Solo requirements|TS/Template reporting statusMetric: String|TP/Non-(re)insurance Solo requirements|TS/Template reporting statusMetric: String|TP/Group - contribution of TP|TS/Template reporting statusMetric: Issuer IDMetric: Issuer Group IDMetric: Counterparty IDMetric: Counterparty Group IDMetric: String|PO/Other than ring fenced funds|TS/Single name exposure codeMetric: String|TS/Issuer Sector

Page 84: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: String|II/Standard formula|TS/Single name exposure codeMetric: Monetary|DD/Discounted|VP/Future discretionary benefits|II/Standard formula or partial internal model|BC/Liability|LB/Gross technical provisions [other than local GAAP spMetric: Monetary|DD/Discounted|VP/Future discretionary benefits|II/Standard formula or partial internal model|BC/Liability|LB/Gross technical provisions [other than local GAAP specMetric: Monetary|DD/Discounted|VP/Future discretionary benefits|II/Partial internal model|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|VP/Future discretionary benefits|II/Partial internal model|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mMetric: Monetary|DD/Discounted|VP/Future discretionary benefits|II/Full internal model|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Discounted|VP/Future discretionary benefits|II/Full internal model|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitiMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|UG/Before diversification effectMetric: Country of authorisationMetric: String|TS/Legal name of groupMetric: Group solvency assessment [method chosen and under method 1, treatment of the undertaking]Metric: Methodology used for group solvency calculationMetric: Country of custodyMetric: Issuer country/country of residenceMetric: Geographical zone of issueMetric: Line of business (Preparatory scope)Metric: BL/All members (Total/NA) [8]Metric: Unwind trigger of contractMetric: ZR/All members [4]Metric: Participation (Group)Metric: Portfolio (derivatives)Metric: RFF (Preparatory scope)Metric: Type of undertakings (Preparatory scope)Metric: CategoryMetric: Valuation method (derivatives)Metric: Monetary|VG/Prudential|BC/AssetsMetric: Reporting countryMetric: LinkMetric: CN/All members [1]|TP/(Re)insurance Solo requirementsMetric: CN/All members [1]|TP/Balance SheetMetric: CN/All members [1]|TP/Entities in the scope of the groupMetric: CN/All members [1]|TP/Group - contribution of TPMetric: CN/All members [1]|TP/List of assetsMetric: CN/All members [1]|TP/Own fundsMetric: CN/All members [10]|TP/Solvency Capital Requirement - Counterparty default riskMetric: CN/All members [10]|TP/Solvency Capital Requirement - Health underwriting riskMetric: CN/All members [10]|TP/Solvency Capital Requirement - Life underwriting riskMetric: CN/All members [10]|TP/Solvency Capital Requirement - Market riskMetric: CN/All members [10]|TP/Solvency Capital Requirement - Non-Life Catastrophe riskMetric: CN/All members [10]|TP/Solvency Capital Requirement - Non-Life underwriting riskMetric: CN/All members [10]|TP/Solvency Capital Requirement - Operational riskMetric: CN/All members [11]|TP/Minimum Capital RequirementMetric: CN/All members [12]|TP/Minimum Capital Requirement - CompositeMetric: CN/All members [13]|TP/Non-(re)insurance Solo requirementsMetric: Basic Information|TP/Basic InformationMetric: CN/All members [3]|TP/Assets and liabilities by currencyMetric: CN/All members [4]|TP/Open derivativesMetric: CN/All members [5]|TP/Life and Health SLT Technical ProvisionsMetric: CN/All members [6]|TP/Non-Life Technical ProvisionsMetric: CN/All members [7]|TP/Solvency Capital Requirement - SFMetric: CN/All members [8]|TP/Solvency Capital Requirement - PIM

Page 85: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: CN/All members [9]|TP/Solvency Capital Requirement - IMMetric: URI|TL/Identification code of entityMetric: URI|TL/Identification code of groupMetric: Scenario A or BMetric: PureMetric: String|TS/Number of fundMetric: String|TS/Issuer codeMetric: String|TS/Issuer group codeMetric: String|TS/CIC codeMetric: String|TS/External ratingMetric: String|TS/Rating agencyMetric: String|TS/ID code of underlyingMetric: String|TS/Counterparty codeMetric: String|TS/Counterparty group codeMetric: String|TS/Currency (ISO code)Metric: UU/All members [2]Metric: UC/All members [24]Metric: AS/All members [5]Metric: UR/All members [1]Metric: VG/All members [1]Metric: AC/All members [5]Metric: AH/All members (Not applicable/All geographical areas) [1]Metric: TT/All members (Equity-type, debt and asset transfer) [3]Metric: TT/All members (Cost sharing, contingent liabilities [other than derivatives] and off-balance sheet items and other) [3]Metric: TT/All members (Derivatives) [3]Metric: String|TS/Composite limited CIC codeMetric: String|TS/CIC code [third digit] of most significant collateralMetric: String|TS/Limited CIC codeMetric: String|TS/ID of counterparty [in repo/securities lending]Metric: String|TS/Type of asset for which collateral is heldMetric: String|TS/Name of debtor pledging the collateralMetric: String|TS/Code of groupMetric: String|TS/Product classification IDMetric: String|TS/Reinsurance program codeMetric: String|TS/Risk identification codeMetric: String|TS/Facultative reinsurance placement identification codeMetric: String|TS/Code reinsurerMetric: String|TS/Code brokerMetric: String|TS/Name of reinsured entityMetric: String|TS/Nature of exposureMetric: String|TS/Code of group of debtor pledging the collateralMetric: String|TS/Composite limited CIC code of underlyingMetric: Integer|NT/Number of reinstatementsMetric: Type of collateral (if applicable)Metric: Pure|PP/Percentage of the reinsurers limit collateralisedMetric: String|TS/Code collateral providerMetric: Pure|TA/Reinsurance Commission [Maximum]Metric: Pure|TA/Reinsurance Commission [Minimum]Metric: Pure|TA/Reinsurance Commission [Expected]Metric: Pure|TA/Overriding Commission [Maximum]Metric: Pure|TA/Overriding Commission [Minimum]

Page 86: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Pure|TA/Overriding Commission [Expected]Metric: Pure|TA/Profit Commission [Maximum]Metric: Pure|TA/Profit Commission [Minimum]Metric: Pure|TA/Profit Commission [Expected]Metric: Monetary|BC/Assets|CC/Ceded|RR/Adjustment for expected losses due to counterparty defaultMetric: Collateral portfolioMetric: URI|TL/Counterparty CodeMetric: URI|OB/Unlimited guarantees and letters of credit received|TL/Code of provider of guaranteeMetric: URI|OB/Unlimited guarantees and letters of credit given|TL/Code of receiver of guaranteeMetric: String|OB/Unlimited guarantees and letters of credit received|TS/Description of trigger eventMetric: String|OB/Unlimited guarantees and letters of credit given|TS/Description of trigger eventMetric: String|OB/Unlimited guarantees and letters of credit given|TS/Legal name of undertakingMetric: Monetary|BC/Off-balance sheet|RO/Belonging to the same group|OB/Guarantees and letters of credit givenMetric: Monetary|BC/Off-balance sheet|RO/Belonging to the same group|OB/Guarantees and letters of credit receivedMetric: Monetary|TA/Maximum value|VG/Solvency II|BC/Off-balance sheet|OB/Unlimited guarantees and letters of credit givenMetric: Monetary|BC/Off-balance sheet|OB/Guarantees and letters of credit receivedMetric: Monetary|BC/Liability|OB/Guarantees and letters of credit givenMetric: Monetary|BC/Liability|RO/Belonging to the same group|OB/Guarantees and letters of credit givenMetric: Monetary|BC/Assets|RO/Belonging to the same group|OB/Guarantees and letters of credit receivedMetric: Monetary|BC/Off-balance sheet|RO/Belonging to the same group|OB/Contingent liabilitiesMetric: ZR/All members [1]|OB/Unlimited guarantees and letters of credit receivedMetric: String|OB/Unlimited guarantees and letters of credit received|TS/Legal name of undertakingMetric: Ancillary Own Funds|OB/Unlimited guarantees and letters of credit givenMetric: RO/All members [11]|OB/Unlimited guarantees and letters of credit givenMetric: Types of Asset for which collateral is held (Preparatory scope)Metric: Monetary|TA/Unit price|VG/Prudential|BC/Off-balance sheetMetric: Monetary|BC/Liability and Off-balance sheet liabilities|LB/Contingent|OB/Contingent liabilitiesMetric: Credit quality step (Preparatory scope)Metric: Relation to group (guarantees received)Metric: Relation to group (guarantees given)Metric: Types of triggering events of guarantee (guarantees received)Metric: Types of triggering events of guarantee (guarantees given)Metric: Basic InformationMetric: Balance Sheet (SPV)Metric: Assets and liabilities by currency (Preparatory scope)Metric: List of assets (Preparatory scope)Metric: Open derivatives (Preparatory scope)Metric: Life and Health SLT Technical Provisions (Preparatory scope)Metric: Non-Life Technical Provisions (Preparatory scope)Metric: Own funds (Preparatory scope)Metric: Solvency Capital Requirement - SF (Preparatory scope)Metric: Solvency Capital Requirement - PIM (Full scope)Metric: Solvency Capital Requirement - IM (Full scope individual)Metric: Solvency Capital Requirement - Market risk (Preparatory scope)Metric: Solvency Capital Requirement - Counterparty default risk (Preparatory scope)Metric: Solvency Capital Requirement - Life underwriting risk (Preparatory scope)Metric: Solvency Capital Requirement - Health underwriting risk (Preparatory scope)Metric: Solvency Capital Requirement - Non-Life underwriting risk (Preparatory scope)Metric: Solvency Capital Requirement - Operational risk (Preparatory scope)Metric: Solvency Capital Requirement - Non-Life Catastrophe risk (Preparatory scope)Metric: Minimum Capital Requirement

Page 87: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Minimum Capital Requirement - CompositeMetric: Entities in the scope of the groupMetric: (Re)insurance Solo requirementsMetric: Non-(re)insurance Solo requirementsMetric: Group - contribution of TPMetric: Accounting standardMetric: Issuer sector - NACEMetric: Monetary|II/Standard formula|BC/Loss given defaultMetric: Monetary|BC/Excess of assets over liabilities|LL/Controlling interestsMetric: Monetary|BC/Assets|LL/Controlling interests|AS/Shares|IO/Own instruments held directly or indirectlyMetric: Monetary|BC/Foreseeable dividends, distributions and charges|LL/Controlling interestsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Available to meet SCR criteria|OF/Own funds [before deductions] other than reconciliation reserveMetric: Monetary|BC/Own funds|LL/Controlling interests|MS/Available to meet SCR criteriaMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Own funds [before deductions] other than reconciliation resMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic or ancillary own funds|MS/Eligible to meet SCR criteriaMetric: Monetary|VG/Solvency II|BC/Solvency capital requirement [SCR]|EA/Capital add-onMetric: Basic Information - RFF and matching adjustment portfolios (Full scope individual)Metric: Balance Sheet (Full scope individual)Metric: Balance Sheet (Full scope group)Metric: Basic Information - RFF and matching adjustment portfolios (Full scope group)Metric: Assets and liabilities by currency (Full scope individual)Metric: Assets and liabilities by currency (Full scope group)Metric: Off-balance sheet items - generalMetric: Type of undertakingMetric: Method of Calculation of the SCRMetric: Regular/Ad-hoc submission (solo)Metric: Use of undertaking specific parameters (Individual)Metric: Matching AdjustmentMetric: Volatility adjustmentMetric: Transitional measure on the risk-free interest rateMetric: Transitional measure on technical provisionsMetric: Language of reportingMetric: Initial submission or re-submissionMetric: Sub-group informationMetric: Accounting standards (Individual)Metric: Accounting standards (Full scope)Metric: Use of undertaking specific parameters (Group)Metric: Method of group solvency calculation used (Basic information)Metric: RFF,MAP or Remaining of a fundMetric: RFF, MAP with sub RFF, MAPMetric: MaterialMetric: Article 304Metric: Monetary|BC/Assets|AS/Recoverables not recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|Metric: Premiums, claims and expenses by line of business (Individual)Metric: Premiums, claims and expenses by countryMetric: List of assets (Full scope individual)Metric: List of assets (Full scope group)Metric: Collective investment undertakings - look-through approach (Individual)Metric: Collective investment undertakings - look-through approach (Group)Metric: Summary of assetsMetric: Open derivatives (Full scope individual)

Page 88: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Open derivatives (Full scope group)Metric: Derivatives Transactions (Individual)Metric: Derivatives Transactions (Group)Metric: Life and Health SLT Technical Provisions (Full scope)Metric: Life and Health SLT Technical Provisions (Full scope by country)Metric: Non-Life Technical Provisions (Full scope)Metric: Non-Life Technical Provisions (Full scope by country)Metric: Off-balance sheet items - List of unlimited guarantees received by the undertakingMetric: Off-balance sheet items - List of unlimited guarantees provided by the undertakingMetric: Activity by countryMetric: Information on class 10 in Part A of Annex I of Solvency II Directive, excluding carrier's liabilityMetric: Structured products (Individual)Metric: Income/gains and losses in the periodMetric: Securities lending and repos (Individual)Metric: Assets held as collateral (Individual)Metric: Best estimate by currency and country - LifeMetric: Projection of future gross cash flowsMetric: Life obligations analysisMetric: Description of the guarantees of variable annuitiesMetric: Hedging of guarantees of variable annuitiesMetric: Information on annuities stemming from Non-Life Insurance obligationsMetric: Best estimate by currency and country - Non LifeMetric: Projection of future cash flowsMetric: Non-life insurance claimsMetric: Development of the distribution of the claims incurredMetric: Loss distribution risk profileMetric: Non-life underwriting peak risksMetric: Non-life underwriting mass risksMetric: Impact of long term guarantees and transitional measuresMetric: Projection of future cash flows (Best Estimate - Matching portfolios)Metric: Information on the matching adjustment calculationMetric: Information on the transitional on interest rates calculationMetric: Overall calculation of the transitional on technical provisionsMetric: Detailed information by tiers on own funds (Full scope individual)Metric: Annual movements on own funds (Full scope individual)Metric: List of items on own funds (Group)Metric: Participations heldMetric: Solvency Capital Requirement - Only SF (Full scope individual)Metric: Solvency Capital Requirement - SF (Full scope group)Metric: Solvency Capital Requirement - SF and PIM (Full scope group)Metric: Solvency Capital Requirement - IM (Full scope group)Metric: Solvency Capital Requirement - Market risk (Full scope individual)Metric: Solvency Capital Requirement - Market risk (Full scope group)Metric: Solvency Capital Requirement - Counterparty default risk (Full scope individual)Metric: Solvency Capital Requirement - Counterparty default risk (Full scope group)Metric: Solvency Capital Requirement - Life underwriting risk (Full scope individual)Metric: Solvency Capital Requirement - Life underwriting risk (Full scope group)Metric: Solvency Capital Requirement - Health underwriting risk (Full scope individual)Metric: Solvency Capital Requirement - Health underwriting risk (Full scope group)Metric: Solvency Capital Requirement - Non-Life underwriting risk (Full scope individual)Metric: Solvency Capital Requirement - Non-Life underwriting risk (Full scope group)

Page 89: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Solvency Capital Requirement - Operational risk (Full scope individual)Metric: Solvency Capital Requirement - Operational risk (Full scope group)Metric: Solvency Capital Requirement - Simplifications (Full scope individual)Metric: Solvency Capital Requirement - Simplifications (Full scope group)Metric: Solvency Capital Requirement - Non-Life Catastrophe risk (Full scope individual)Metric: Solvency Capital Requirement - Non-Life Catastrophe risk (Full scope group)Metric: Excess of Assets over LiabilitiesMetric: Excess of Assets over Liabilities - explained by investments and financial liabilitiesMetric: Excess of Assets over Liabilities - explained by technical provisionsMetric: Detailed analysis per period - Technical flows versus Technical provisionsMetric: Facultative covers for non-life and life business basic dataMetric: Facultative covers for non-life and life business shares dataMetric: Outgoing Reinsurance Program basic dataMetric: Outgoing Reinsurance Program shares dataMetric: Share of reinsurersMetric: Special Purpose VehiclesMetric: IGT - Equity-type transactions, debt and asset transfer (Full scope individual)Metric: IGT - Equity-type transactions, debt and asset transfer (Full scope group)Metric: IGT - Derivatives (Full scope individual)Metric: IGT - Derivatives (Full scope group)Metric: IGT - Internal reinsurance (Full scope individual)Metric: IGT - Internal reinsurance (Full scope group)Metric: IGT - Cost Sharing, contingent liabilities, off BS and other items (Full scope individual)Metric: IGT - Cost Sharing, contingent liabilities, off BS and other items (Full scope group)Metric: Risk concentrationMetric: Portfolio (investment, securities lending and repo) (Full scope)Metric: String|TS/CustodianMetric: Infrastructure investmentMetric: String|TS/Internal ratingMetric: Monetary|BC/Assets|AS/Assets [listed]Metric: Monetary|BC/Assets|AS/Assets that are not listed in a stock exchangeMetric: Monetary|BC/Assets|AS/Assets that are not exchange tradableMetric: Underlying asset categoryMetric: Currency of underlyingMetric: Monetary|BC/Assets|AL/FuturesMetric: Monetary|BC/Assets|AL/Call OptionsMetric: Monetary|BC/Assets|AL/Put OptionsMetric: Monetary|BC/Assets|AL/SwapsMetric: Monetary|BC/Assets|AL/Credit derivativesMetric: Provider of guarantee belonging to the same groupMetric: Monetary|TA/Maximum value|VG/Solvency II|BC/Off-balance sheet|OB/Guarantees and letters of credit givenMetric: Receiver of guarantee belonging to the same groupMetric: Monetary|BC/Liability|LB/Gross technical provisions [local GAAP specific]|CC/CededMetric: Monetary|BC/Liability|LB/Gross technical provisions [local GAAP specific]|CC/Not cededMetric: Monetary|TA/Profit and loss to date|VG/Solvency II|BC/Profit/(loss)[after tax]|DI/Year to DateMetric: Use of derivative (Full scope)Metric: Monetary|VG/Solvency II|BC/Premium paid|DI/Year to Date|AL/DerivativesMetric: Monetary|VG/Solvency II|BC/Premium received|DI/Year to Date|AL/DerivativesMetric: Unwind trigger of contract (Full scope)Metric: Monetary|TA/Profit and loss to date|DI/Year to DateMetric: Monetary|BC/Assets|AL/Forwards

Page 90: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Asset categoryMetric: Collateral typeMetric: Integer|CB/Motor vehicle liability insurance [except carrier's liability]|NT/Frequency of claimsMetric: Monetary|BC/Cost of claims|CB/Motor vehicle liability insurance [except carrier's liability]Metric: Type of structured product (Full scope)Metric: Synthetic structured product (Full scope)Metric: Sub RFF,MAPMetric: Monetary|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|VV/Amount before transitional on Technical ProvisionsMetric: Monetary|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect|VV/Amount before transitional on Technical ProvisionsMetric: Monetary|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|VV/Amount of the transitional on Technical ProvisionsMetric: Monetary|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect|VV/Amount of the transitional on Technical ProvisionsMetric: Monetary|TF/Use of transitional measure on the risk-free interest rate|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|TF/Use of transitional measure on the risk-free interest rate|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|LH/Amount before LTG mMetric: Monetary|TF/Use of volatility adjustment|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|TF/Use of volatility adjustment|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|LH/Amount before LTG measuresMetric: Monetary|TF/Use of matching adjustment|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|TF/Use of matching adjustment|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|LH/Amount before LTG measuresMetric: Types of Asset for which collateral is held (Full scope)Metric: Product classificationMetric: Type of premium (Full scope)Metric: Ring-fenced fund/matching portfolio/remaining partMetric: Types of guarantee (Full scope)Metric: Date|BL/Variable annuities|TB/Direct Business|TD/Final date of guaranteeMetric: Date|BL/Variable annuities|TB/Direct Business|TD/Initial date of guaranteeMetric: Integer|NT/Number of HRGs in productMetric: Line of Business (Full scope)Metric: Monetary|DD/Undiscounted|BC/Projection of future cash flows|AS/Recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash eqMetric: Delta hedgedMetric: Rho hedgedMetric: Gamma hedgedMetric: Vega hedgedMetric: FX hedgedMetric: Identification of the line of businessMetric: Line of business reportedMetric: Long or short position [open]Metric: Long or short position [closed]Metric: Monetary|BC/Liability|LB/Other than technical provisions, contingent, derivatives, debt instruments [not subordinated], reinsurance deposits and receivables/payables [insuMetric: Type of underwriting model (Full scope)Metric: Boolean|BX/Simplifications for health disability-morbidity risk-income protection usedMetric: Monetary|II/Standard formula|BC/Loss|AS/MortgagesMetric: USP Standard Deviation gross/netMetric: String|TS/Activity code brokerMetric: Type of reinsurer (Full scope)Metric: Type of reinsurance contract/treaty (Full scope)Metric: String|TS/Description of the reinsurers limit collateralisedMetric: Type of undertakings (Full scope)Metric: Group solvency assessment (Full scope)Metric: Date|TD/Date of noticeMetric: TierMetric: Credit quality step (Full scope)Metric: Basis risk arising from risk-transfer structure

Page 91: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Basis risk arising from contractual termsMetric: Entity Level/RFF or MAP/ Remaining PartMetric: SPV fully funded in relation to cedant obligationsMetric: Identification of material investments held by cedant in SPVMetric: Securitisation assets related to cedant held in trust with other third party than cedant / sponsorMetric: Legal nature of SPVMetric: Lines of Business SPV securitisation relatesMetric: Pure|PP/Aggregate deductibles (%)Metric: Pure|PP/Reinsurance Commission [Maximum]Metric: Pure|PP/Reinsurance Commission [Minimum]Metric: Pure|PP/Reinsurance Commission [Expected]Metric: Pure|PP/Overriding Commission [Maximum]Metric: Pure|PP/Overriding Commission [Minimum]Metric: Pure|PP/Overriding Commission [Expected]Metric: Pure|PP/Profit Commission [Maximum]Metric: Pure|PP/Profit Commission [Minimum]Metric: Pure|PP/Profit Commission [Expected]Metric: Group or individual internal modelMetric: Method of group solvency calculation used (contribution to group TP)Metric: Type of IGT (Equity-type, debt and asset transfer) (Full scope)Metric: Type of IGT (Derivatives) (Full scope)Metric: Type of IGT (Cost sharing, contingent liabilities [other than derivatives] and off-balance sheet items and other) (Full scope)Metric: Type of reinsurance contract/treaty ITG (Full scope)Metric: Issuer sector (Full scope)Metric: Nature of the exposureMetric: Impact on: Assets / Liability / Off Balance SheetMetric: Type of Trigger(s) in the SPVMetric: Counted under transitionalsMetric: Method used to calculate the adjustment due to RFF/MAP nSCR aggregationMetric: Pure|II/Standard formula|PP/Risk rateMetric: Decimal|II/Standard formula|DC/Run off periodMetric: String|TS/Undertaking identification codeMetric: String|OB/Unlimited guarantees and letters of credit received|TS/Code of provider of guaranteeMetric: String|OB/Unlimited guarantees and letters of credit given|TS/Code of receiver of guaranteeMetric: Consideration of the future management actions regarding technical provisions and/or deferred taxesMetric: Pure|PP/Largest accident risk concentration of an insurance or reinsurance undertakingMetric: Swap delivered currency (for buyer)Metric: Swap received currency (for buyer)Metric: Pure|PP/Interest rateMetric: Pure|PP/Annual effective rateMetric: Pure|PP/Portion of the difference applied at the reporting dateMetric: Pure|PP/Adjustment to risk free rateMetric: Decimal|DC/Residual modified duration of obligationsMetric: Pure|PP/Portion of the difference adjustedMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect|VV/Amount of the transitional on TechnicaMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect|IG/Excluding intra-group transactions|VVMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect|VV/Amount of technical provisions subject tMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect|IG/Excluding intra-group transactions|VV/AMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect|VV/Amount of technical provisions subjectMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect|IG/Excluding intra-group transactions|VV/Metric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect|VV/Amount of technical provisions subje

Page 92: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigation effect|IG/Excluding intra-group transactions|VMetric: Monetary|TA/Maximum value|VG/Prudential|BC/Off-balance sheet|OB/Guarantees and letters of credit givenMetric: Monetary|TA/Collateralized assets value|VG/Prudential|BC/Assets|OB/Guarantees and letters of credit receivedMetric: Monetary|II/Standard formula|BC/Sum insured|OS/Sum insured by the reporting entity not including technical provisions [other than local GAAP specific]|CC/FacultativeMetric: Pure|II/Standard formula|PP/Termination ratesMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|VG/Solvency II|BC/Assets|PO/Ring Fenced FundsMetric: Monetary|VG/Solvency II|BC/Assets|PO/Other than ring fenced fundsMetric: Monetary|VG/Solvency II|BC/Off-balance sheetMetric: Monetary|VG/Solvency II|BC/Assets and/or liabilities|AL/Receivables/payables [reinsurance ceded]Metric: Monetary|VG/Prudential|BC/TransactionMetric: Currency used for reporting (Full scope)Metric: RFF (Full scope)Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|UG/Before diversification effect|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|AL/Equity instruments, loans and bonds|IO/Non-strategic participation [not deducted from own funds] aMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|UG/Before diversification effect|UH/Before diversification effectMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|UG/Before diversification effect|UH/Before diversification effectMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|PO/Matching Adjustment Portfolios|UG/Before diversification effect|UH/Before diversification effectMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|UG/Before diversification effect|UH/Diversification effectMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|IO/Participations [controlling]|UG/Before diversification effectMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IT/After risk mitigation effect other than from finite reinsurance|EA/IncludingMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|UG/Diversification effect|IT/After risk mitigation effect other than from finitMetric: Monetary|II/Partial internal model|BC/Solvency capital requirement [SCR]|IT/After risk mitigation effect other than from finite reinsurance|EA/Including the loss-absorbing cMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|UG/Before diversification effect|UH/Before dMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|UG/Before diversification effect|UH/Before diversificaMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|PO/Matching Adjustment Portfolios|UG/Before diversification effect|UH/BeforMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|UG/Before diversification effect|UH/Diversification effectMetric: Monetary|II/Standard formula or partial internal mode|BC/Solvency capital requirement [SCR]|AL/Equity instruments, loans and bonds|IO/Non-strategic participation [not deMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IO/Participations [controlling]|UG/Before diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|AL/Equity instruments, loans and bonds|IO/Non-strategic participation [not deducted from own funds]Metric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Other than ring fenced funds|UG/Before diversification effect|UH/Before diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Ring Fenced Funds|UG/Before diversification effect|UH/Before diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|UG/Before diversification effect|UH/Diversification effectMetric: Monetary|TA/Contribution to the group|VG/Solvency II|BC/Solvency capital requirement [SCR]|UG/Before diversification effectMetric: Monetary|VG/Solvency II|BC/Solvency capital requirement [SCR]|UG/Before diversification effectMetric: Monetary|VG/Solvency II|BC/Minimum capital requirement [MCR]|UG/Before diversification effectMetric: Monetary|BC/Solvency capital requirement [SCR]|UG/Before diversification effectMetric: Monetary|BC/Minimum capital requirement [MCR]|UG/Before diversification effectMetric: SPV country of authorisationMetric: SPV authorisation conditionsMetric: Method of group solvency calculation usedMetric: String|TS/Name of ring-fenced fund/Matching adjustment portfolioMetric: Monetary|BC/Assets|AS/Collective investments undertakings|IO/InvestmentMetric: Monetary|BC/Assets|AS/Other investments|IO/InvestmentMetric: Monetary|BC/Assets|AS/Property, plant and equipment, Cash, Derivatives, Bonds, Equity instruments, Participations and related undertakings, Deposits other than reinsurMetric: Monetary|BC/Assets|AS/Recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CC/CededMetric: Monetary|BC/Off-balance sheet|OB/Guarantees and letters of credit givenMetric: Monetary|BC/Off-balance sheet|OB/Collateral heldMetric: Monetary|BC/Assets|AS/Government BondsMetric: Monetary|BC/Assets|AS/Corporate BondsMetric: Monetary|BC/Assets|AS/Equity instruments

Page 93: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Assets|AS/Collective investments undertakingsMetric: Monetary|BC/Assets|AS/Structured notesMetric: Monetary|BC/Assets|AS/Collateralised securitiesMetric: Monetary|BC/Assets|AS/Cash and depositsMetric: Monetary|BC/Assets|AS/Mortgages and loansMetric: Monetary|BC/Assets|AS/PropertiesMetric: Monetary|BC/Assets|AS/Other investmentsMetric: Monetary|BC/Assets|AS/FuturesMetric: Monetary|BC/Assets|AS/Call OptionsMetric: Monetary|BC/Assets|AS/Put OptionsMetric: Monetary|BC/Assets|AS/SwapsMetric: Monetary|BC/Assets|AS/ForwardsMetric: Monetary|BC/Assets|AS/Credit derivativesMetric: Monetary|TA/Acquisition value|VG/Solvency II|BC/AssetsMetric: Monetary|TA/Premium paid to date|VG/Solvency II|BC/Assets and/or liabilities|AL/DerivativesMetric: Monetary|TA/Premium received to date|VG/Solvency II|BC/Assets and/or liabilities|AL/DerivativesMetric: Monetary|VG/Solvency II|BC/Profit/(loss)|DI/Year to DateMetric: Monetary|TA/Realized|VG/Solvency II|BC/Profit/(loss)|DI/Year to DateMetric: Monetary|TA/Not realized|VG/Solvency II|BC/Profit/(loss)|DI/Year to DateMetric: Monetary|TA/Far leg|VG/Solvency II|BC/RepoMetric: Monetary|BC/Assets|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Reinsurance counterparties|CC/CededMetric: Monetary|DD/Undiscounted|BC/Projection of future cash flows|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held dMetric: String|BL/Variable annuities|TB/Direct Business|TS/Description of productMetric: Monetary|BC/Assets|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Metric: Monetary|BC/Liability|LB/Premium provisions [other than local GAAP specific]|VV/Amount before transitional on Technical ProvisionsMetric: Monetary|BC/Assets|AS/Premium recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalMetric: Monetary|BC/Liability|LB/Premium provisions [other than local GAAP specific]|IT/After risk mitigation effect|VV/Amount before transitional on Technical ProvisionsMetric: Monetary|BC/Liability|LB/Claim provisions [other than local GAAP specific]|VV/Amount before transitional on Technical ProvisionsMetric: Monetary|BC/Assets|AS/Claims recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalenMetric: Monetary|BC/Liability|LB/Claim provisions [other than local GAAP specific]|IT/After risk mitigation effect|VV/Amount before transitional on Technical ProvisionsMetric: Monetary|BC/Own funds|BE/Basic or ancillary own funds|MS/Eligible to meet SCR criteriaMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Ancillary own fundsMetric: Monetary|TA/Possible negative|VG/Solvency II|BC/Solvency capital requirement [SCR]|FZ/Risks inside ring fenced funds/matching portfolios|UG/Before diversification effecMetric: Monetary|VG/Solvency II|BC/Solvency capital requirement [SCR]|FZ/Risks inside ring fenced funds/matching portfolios|UG/Before diversification effectMetric: Monetary|VG/Solvency II|BC/Adjustment for restricted own fund items in respect of matching adjustment portfolios and ring fenced funds|FZ/Risks inside ring fenced fundsMetric: Monetary|VG/Solvency II|BC/Own funds|AA/Eligible for undertaking|FZ/Risks inside ring fenced funds/matching portfoliosMetric: Monetary|VG/Solvency II|BC/Own funds|LL/Minority interests|BE/Basic own funds|MS/Not available to meet SCR criteriaMetric: Monetary|VG/Solvency II|BC/Own funds|MS/Not available to meet SCR criteriaMetric: Monetary|VG/Solvency II|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|EE/Not EEA countriesMetric: Monetary|VG/Solvency II|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Surplus fundsMetric: Monetary|VG/Solvency II|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Ordinary shares|SY/Called up but not yet paMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Ancillary own funds|MS/Not available to meet SCR criteria|OF/Own funds [before deductions] other than other items of own fMetric: Monetary|VG/Solvency II|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Subordinated mutual member accountsMetric: Monetary|VG/Solvency II|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Preference sharesMetric: Monetary|VG/Solvency II|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Subordinated debt instrumentsMetric: Monetary|VG/Solvency II|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Own funds equivalent to the value of net deMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic own funds|MS/Not available to meet SCR criteriaMetric: Monetary|BC/Assets|TX/Tier 1 and Tier 2|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which individually exceed 10% of items iMetric: Monetary|BC/Assets|TX/Tier 1 – restricted|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which individually exceed 10% of items Metric: Monetary|BC/Assets|TX/Tier 1 – unrestricted|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which individually exceed 10% of iteMetric: Monetary|BC/Assets|TX/Tier 2|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which individually exceed 10% of items included in

Page 94: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/Other strategic participationsMetric: Monetary|BC/Assets|OE/Type 1 Equity|AS/Participations and related undertakings|IO/Other strategic participationsMetric: Monetary|BC/Assets|OE/Type 2 Equity|AS/Participations and related undertakings|IO/Other strategic participationsMetric: Monetary|BC/Assets|OE/Subordinated liabilities|AS/Participations and related undertakings|IO/Other strategic participationsMetric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/Other non-strategic participationsMetric: Monetary|BC/Assets|OE/Type 1 Equity|AS/Participations and related undertakings|IO/Other non-strategic participationsMetric: Monetary|BC/Assets|OE/Type 2 Equity|AS/Participations and related undertakings|IO/Other non-strategic participationsMetric: Monetary|BC/Assets|OE/Subordinated liabilities|AS/Participations and related undertakings|IO/Other non-strategic participationsMetric: Monetary|BC/Assets|TX/Tier 1 and Tier 2|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which when aggregated exceed 10% of iteMetric: Monetary|BC/Assets|TX/Tier 1 – restricted|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which when aggregated exceed 10% of iMetric: Monetary|BC/Assets|TX/Tier 1 – unrestricted|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which when aggregated exceed 10% ofMetric: Monetary|BC/Assets|TX/Tier 2|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which when aggregated exceed 10% of items includedMetric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which are considered strategic as defined in Article 171Metric: Monetary|BC/Assets|OE/Type 1 Equity|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which are considered strategic as definMetric: Monetary|BC/Assets|OE/Type 2 Equity|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which are considered strategic as definMetric: Monetary|BC/Assets|OE/Subordinated liabilities|AS/Participations and related undertakings|IO/Participations in financial and credit institutions which are considered strategMetric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Financial and credit institutionsMetric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/Participations|CT/Other than financial and credit institutionsMetric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Other than financial and credit institutionsMetric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/Non-strategic participation [not deducted from own funds]|CT/Other than financial and credit institutioMetric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/ParticipationsMetric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|OU/Not to be deductedMetric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/Non-strategic participation [not deducted from own funds]|OU/Not to be deductedMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|UG/Diversification effect|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|DD/Discounted|VP/Future discretionary benefits|II/Standard formula|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IT/After risk mitigMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|IO/Participations [non-controlling]|UG/Before diversification effectMetric: String|II/Partial internal model|TS/Description of componentMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IT/After risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|AL/Equity instruments, loans and bonds|IO/Non-strategic participation [not dMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IO/Participations [non-controlling]|UG/Before diversification effectMetric: String|II/Full internal model|TS/Description of componentMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|IT/After risk mitigation effect other than from finite reinsurance|EA/Including the loss-absorbing capaMetric: Monetary|BC/Solvency capital requirement [SCR]|IO/Participations [controlling]|UG/Before diversification effectMetric: Monetary|II/Standard formula|BC/AssetsMetric: Decimal|II/Standard formula|DC/Modified durationMetric: Monetary|II/Standard formula|BC/PaymentsMetric: Pure|PP/Ratio of insured persons using hospitalisationMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Own funds [before deductions] other than reconciliation reserveMetric: Monetary|BC/Assets|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/Metric: Monetary|VG/Solvency II|BC/Assets|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash eqMetric: Monetary|VG/Solvency II|BC/Liability|BL/Health SLT and annuities stemming from non-life insurance contracts and relating to health insurance obligations|LB/Gross technicaMetric: Pure|BL/Life [other than Index-linked and unit-linked insurance and Health SLT]|PP/Contribution to group technical provisions [%]|IG/Excluding intra-group transactionsMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|VV/Amount of the transitional on Technical ProvisionsMetric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IG/Excluding intra-group transactions|VV/Amount of the transitional onMetric: Monetary|VG/Solvency II|TF/Use of transitional measure on the risk-free interest rate|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IG/Excluding intra-group transactions|VV/Amount of technical provisions sMetric: Monetary|VG/Solvency II|TF/Use of volatility adjustment|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IG/Excluding intra-group transactions|VV/Amount of technical provisionsMetric: Monetary|VG/Solvency II|TF/Use of matching adjustment|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|VG/Solvency II|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]|IG/Excluding intra-group transactions|VV/Amount of technical provisioMetric: String|TS/List the counterparty of the subordinated liabilities

Page 95: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|VG/Solvency II|BC/Assets|AS/Recoverables|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|RR/Before the adjusMetric: Monetary|TA/Result of transaction|VG/Solvency II|BC/Transaction|DI/Year to Date|TT/Reinsurance contractsMetric: Monetary|BC/Assets|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/RMetric: Monetary|BC/Assets|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/RMetric: Monetary|BC/Assets|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/SpMetric: Monetary|BC/Assets|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalents|CT/FiMetric: Monetary|BC/Own funds|BE/Basic or ancillary own funds|MX/Eligible to meet MCR criteriaMetric: Issuing entity of the subordinated mutual members‘ accountsMetric: Monetary|VG/Solvency II|BC/Solvency capital requirement [SCR]|UG/Before diversification effect|IS/Contribution to the groupMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic own funds|OF/Subordinated debt instruments|IS/Contribution to the groupMetric: String|TS/Name of issuer/seller/transferor/receiver/reinsurer/providorMetric: Monetary|VG/Solvency II|BC/Own funds|BE/Basic own funds|OF/Other items of own funds|IS/Contribution to the groupMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteriaMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Surplus fundsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Subordinated mutual member accountsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Preference sharesMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Subordinated debt instrumentsMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Own funds equivalent to the value of net deferred tax asseMetric: Monetary|BC/Assets|AS/Premium recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivaleMetric: Monetary|BC/Assets|AS/Premium recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalMetric: Monetary|BC/Assets|AS/Premium recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivaleMetric: Monetary|BC/Assets|AS/Premium recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivaleMetric: Monetary|BC/Assets|AS/Premium recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalMetric: Monetary|BC/Assets|AS/Claims recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentMetric: Monetary|BC/Assets|AS/Claims recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalenMetric: Monetary|BC/Assets|AS/Claims recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentMetric: Monetary|BC/Assets|AS/Claims recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalentMetric: Monetary|BC/Assets|AS/Claims recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash equivalenMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Ordinary shares|SY/Called up but not yet paid inMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|PO/Matching Adjustment Portfolios|UG/Before diversification effect|UH/Before diversification effecMetric: Monetary|BC/Liability|LB/Other than reserves and retained earningsMetric: Pure|PP/Ratio of insured persons using medical practitionerMetric: Pure|PP/Ratio of insured persons using no formal medical careMetric: Additional branch balance sheet informationMetric: String|TS/Legal name of branchMetric: String|TS/Branch identification codeMetric: String|TS/Name of a branches included under Article 167Metric: String|TS/Countries of branches included under Article 167Metric: Country of third country undertakingMetric: Country of third country branchMetric: Type of branchMetric: Article 167Metric: Deposit Lodged as security in accordance with Article 162 2( e)Metric: Confirmation that there are no rights of set offMetric: String|TS/Description of encumbered assetsMetric: String|TS/Description of encumbranceMetric: String|TS/Description of the balance sheet liabilityMetric: Monetary|TA/Amount subject to prior security interests|VG/Solvency II|BC/AssetsMetric: Monetary|TA/Value net of encumbrance|VG/Solvency II|BC/AssetsMetric: Monetary|VG/Solvency II|BC/Liability|LB/Receivables/payables [insurance/reinsurance related]Metric: Monetary|TA/Preferential claim|VG/Solvency II|BC/Liability|LB/Receivables/payables [insurance/reinsurance related]

Page 96: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|TA/Value net of preferential claim|VG/Solvency II|BC/Liability|LB/Receivables/payables [insurance/reinsurance related]Metric: Monetary|BC/Liability|CY/Home country|LB/Debt instruments [not subordinated]. Debts owed to credit institutionsMetric: Monetary|BC/Liability|CY/Euro area other than home country|LB/Debt instruments [not subordinated]. Debts owed to credit institutionsMetric: Monetary|BC/Liability|CY/Non-euro area|LB/Debt instruments [not subordinated]. Debts owed to credit institutionsMetric: Monetary|BC/Liability|CY/Home country|LB/Debt instruments [not subordinated]. Financial liabilities other than debts owed to credit institutionsMetric: Monetary|BC/Liability|CY/Euro area other than home country|LB/Debt instruments [not subordinated]. Financial liabilities other than debts owed to credit institutionsMetric: Monetary|BC/Liability|CY/Non-euro area|LB/Debt instruments [not subordinated]. Financial liabilities other than debts owed to credit institutionsMetric: Monetary|BC/Liability|LB/Debt instruments [not subordinated]. Financial liabilities other than debtsMetric: Issuer Sector according to ESA 2010Metric: Country of residence for collective investment undertakingsMetric: Instrument classification according to ESA 2010Metric: Monetary|BC/Liability|RZ/Pension entitlements|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|BC/Liability|RZ/Pillar II pension entitlements|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|BC/Liability|RZ/Pillar II defined benefit pension entitlements|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|BC/Liability|RZ/Pillar II defined contribution pension entitlements|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|BC/Liability|RZ/Pillar II hybrid pension entitlements|LB/Gross technical provisions [other than local GAAP specific]Metric: Deposits to cedants - line-by-line reportingMetric: Pension entitlementsMetric: Non-life Technical Provisions - reinsurance policiesMetric: Collective investment undertakings - look-through approach (Financial stability)Metric: Securities lending and repos (Financial stability)Metric: Solvency Capital Requirement - Only SF (Financial stability)Metric: Duration of liabilitiesMetric: Profit or loss sharingMetric: Profit and LossMetric: Lapses (life business)Metric: Pure|PP/Average profit/(loss) sharingMetric: Risks assumedMetric: Debt or other financing mechanismMetric: String|TS/Code of SPVMetric: Integer|NT/Number of separate risk arrangementsMetric: Compliance with the fully funded requirement throughout the reporting periodMetric: Monetary|BC/Assets|AS/Deposits and loans claimsMetric: Monetary|BC/Assets|AS/Securitised loansMetric: Monetary|BC/Assets|AS/Debt securitiesMetric: Monetary|BC/Assets|AS/Other securitised assetsMetric: Monetary|BC/Assets|AS/Equity and collective investment unitsMetric: Monetary|BC/Assets|AS/DerivativesMetric: Monetary|BC/Assets|AS/Non-financial assets (including fixed assets)Metric: Monetary|BC/Assets|AS/Total of other material classes of assetsMetric: Monetary|BC/Assets|AS/Remaining assetsMetric: Monetary|AS/Deposits and loans claimsMetric: Monetary|BC/Liability|LB/Loans and deposits receivedMetric: Monetary|BC/Liability|LB/Debt securities issuedMetric: Monetary|BC/Liability|LB/Total of other material classes of liabilitiesMetric: Monetary|BC/Liability|LB/Remaining liabilitiesMetric: Monetary|BC/EquityMetric: Monetary|BC/Off-balance sheet|OB/Guarantees receivedMetric: Monetary|BC/Off-balance sheet|OB/Off-balance sheet items other than guarantees received and collateral heldMetric: Monetary|VG/Statutory accounts|BC/Off-balance sheet|OB/Off-balance sheet items other than guarantees received and collateral heldMetric: Monetary|VG/Statutory accounts|BC/Off-balance sheet|OB/Off-balance sheet obligations other than collateral pledged

Page 97: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/ExposureMetric: Date|TD/Insurance dateMetric: Issues/uses commenced prior to implementationMetric: String|TS/Name of cedantMetric: String|TS/Cedant codeMetric: Monetary|TA/Aggregate maximum value per arrangement|VG/Solvency II|BC/ExposureMetric: Monetary|VG/Solvency II|BC/Liability|LB/Debt securities issuedMetric: String|TS/Description of the debt or other financing mechanism issued for arrangementMetric: Detailed information by tiers on own funds (Full scope group)Metric: Annual movements on own funds (Full scope group)Metric: Balance Sheet (Full scope individual Ring-fenced fund/matching portfolio/remaining part)Metric: Balance Sheet (Full scope group Ring-fenced fund/matching portfolio/remaining part)Metric: Projection of future cash flows (Best Estimate - Matching portfolios) (Full scope Ring-fenced fund/matching portfolio/remaining part)Metric: Information on the matching adjustment calculation (Full scope Ring-fenced fund/matching portfolio/remaining part)Metric: Monetary|BC/Adjustment for restricted own fund items in respect of matching adjustment portfolios and ring fenced fundsMetric: Monetary|BC/Adjustment for restricted own fund items in respect of matching adjustment portfolios and ring fenced funds|AA/Eligible for undertakingMetric: Valuation method (Full scope)Metric: Instrument classification according to ESA 2010 (ECB add-on)Metric: Monetary|BC/Off-balance sheet|OB/Off-balance sheet obligations other than collateral pledgedMetric: Participation (Full scope Individual)Metric: Participation (Full scope Group)Metric: Monetary|BC/Mortality risk stress for the purpose of matching adjustmentMetric: Activity code broker (Full scope)Metric: Country a branch included under Article 167Metric: Monetary|VG/Solvency II|BC/Liability|LB/Receivables/payables [trade]Metric: Monetary|TA/Preferential claim|VG/Solvency II|BC/Liability|LB/Receivables/payables [trade]Metric: Monetary|TA/Value net of preferential claim|VG/Solvency II|BC/Liability|LB/Receivables/payables [trade]Metric: Monetary|BC/Adjustment for restricted own fund items in respect of matching adjustment portfolios and ring fenced funds|LL/Controlling interests|MS/Not available to meetMetric: Monetary|BC/Shareholder value|AA/Attributable to shareholdersMetric: Monetary|BC/Own funds|AA/Eligible for undertakingMetric: Monetary|TA/Write-offs/write-downs|VG/Solvency II|BC/AssetsMetric: Monetary|DD/Undiscounted|VP/Longevity,mortality and revision obligations cash outflows|BC/Projection of future cash flows|LB/Gross technical provisions [other than locaMetric: Monetary|DD/Undiscounted|VP/Expenses cash outflows|BC/Projection of future cash flows|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|VP/De-risked assets cash-flows|BC/Projection of future cash flows|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|VP/Positive undiscounted mismatch|BC/Projection of future cash flows|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|DD/Undiscounted|VP/Negative undiscounted mismatch|BC/Projection of future cash flows|LB/Gross technical provisions [other than local GAAP specific]Metric: Pure|PP/Annual effective rate applied to the CF of the obligationsMetric: Pure|PP/Annual effective rate of the best estimateMetric: Pure|PP/Probability of defaultMetric: Pure|PP/Cost of downgradeMetric: Pure|PP/Increase of fundamental spread for sub investment grade assetsMetric: Pure|PP/Matching adjustment to the risk free rateMetric: Monetary|BC/Assets|AS/Assets linked to inflationMetric: Monetary|BC/Assets|AS/Assets where third party can change the cash flowsMetric: Pure|PP/Return on assetsMetric: Monetary|BC/Surrended contractsMetric: Integer|NT/Number of surrender options exercisedMetric: Monetary|BC/Assets applied to pay surrendersMetric: Decimal|DC/Residual modified duration of liabilitiesMetric: Monetary|BC/Liability|LB/Debt instruments [not subordinated]. Debts owed to non-credit institutionsMetric: Monetary|BC/Liability|CY/Home country|LB/Debt instruments [not subordinated]. Debts owed to non-credit institutions

Page 98: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Liability|CY/Euro area other than home country|LB/Debt instruments [not subordinated]. Debts owed to non-credit institutionsMetric: Monetary|BC/Liability|CY/Non-euro area|LB/Debt instruments [not subordinated]. Debts owed to non-credit institutionsMetric: Monetary|TF/Use of transitional measure on technical provisions|BC/Liability|LB/Gross technical provisions [other than local GAAP specific]Metric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Ordinary shares|SY/Paid inMetric: Monetary|BC/Assets|LL/Controlling interests|BE/Basic own funds|AS/Ordinary shares|IO/Own instruments held directlyMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Available to meet SCR criteria|OF/Ordinary shares|IO/Other than own instruments held directly orMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Initial funds [members' contributions or the equivalent basic own fund item for mutual and mutualMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria [other than due to local restrictions]|OF/Initial funds [members'Metric: Decimal|DC/QuantityMetric: Decimal|DC/Residual modified durationMetric: Decimal|DC/DeltaMetric: Decimal|DC/Quantity|OB/Collateral heldMetric: Decimal|DC/Age of beneficiaries [years]Metric: Decimal|NT/Number of months for noticeMetric: String|TS/Name of vessel with the biggest sum insuredMetric: String|TS/Name of platform with the biggest sum insuredMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision [hull]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision [liability]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision [oil pollution liability]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision|IT/After risk mitigation [risk mitigation cost for reinstalment premium and Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision|IT/Risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collision|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine tanker collisionMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion [property damage]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion [removal of wreckage]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion [loss of production income]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion [capping of the well or making the well secure]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion [liability insurance and reinsurance obligations]Metric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion|IT/After risk mitigation [risk mitigation cost for reinstalment premium aMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion|IT/Risk mitigation effect other than from finite reinsuranceMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosion|IT/Risk mitigation cost for reinstalment premiumsMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|RT/Marine platform explosionMetric: Best estimate subject to volatility adjustment by country and currencyMetric: Own funds (Full scope individual)Metric: Minimum Capital Requirement - Only life or only non-life insurance or reinsurance activityMetric: Minimum Capital Requirement - Both life and non-life insurance activityMetric: Collateral portfolio (Full scope)Metric: Valuation method (derivatives) (Full scope)Metric: Monetary|BC/Restricted own fund items due to ring fencing and matching portfolioMetric: Premiums, claims and expenses by line of business (Group)Metric: Structured products (Group)Metric: Securities lending and repos (Group)[220]Metric: Assets held as collateral (Group)Metric: Own funds (Full scope group)Metric: Monetary|BC/Assets|AS/Other than intangible, deferred tax, pension benefit, property, plant and equipment, financial, reinsurance deposits, receivables/payables, recoverabMetric: Monetary|BC/Assets|AS/Other than property, plant and equipment, financial [other than receivables/payables insurance/reinsurance related, recoverables recognised for TMetric: Balance Sheet (Finacial stability)Metric: Premiums, claims and expenses by line of business (Financial stability)Metric: Own funds (Finacial stability)Metric: Monetary|BC/Assets|OF/Article 68 [1] deduction|IO/Participations [deducted from own funds]|CT/Financial and credit institutionsMetric: Monetary|BC/Assets|TX/Tier 1 – restricted|OF/Article 68 [1] deduction|IO/Participations [deducted from own funds]|CT/Financial and credit institutions

Page 99: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Assets|TX/Tier 1 – unrestricted|OF/Article 68 [1] deduction|IO/Participations [deducted from own funds]|CT/Financial and credit institutionsMetric: Monetary|BC/Assets|TX/Tier 2|OF/Article 68 [1] deduction|IO/Participations [deducted from own funds]|CT/Financial and credit institutionsMetric: Monetary|BC/Assets|OF/Article 68 [2] deduction|IO/Participations [deducted from own funds]|CT/Financial and credit institutionsMetric: Monetary|BC/Assets|TX/Tier 1 – restricted|OF/Article 68 [2] deduction|IO/Participations [deducted from own funds]|CT/Financial and credit institutionsMetric: Monetary|BC/Assets|TX/Tier 1 – unrestricted|OF/Article 68 [2] deduction|IO/Participations [deducted from own funds]|CT/Financial and credit institutionsMetric: Monetary|BC/Assets|TX/Tier 2|OF/Article 68 [2] deduction|IO/Participations [deducted from own funds]|CT/Financial and credit institutionsMetric: Monetary|BC/Assets|OF/Article 68 [1] [2] deduction|IO/Participations [deducted from own funds]|CT/Financial and credit institutionsMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Article 68 [1] deductionMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Article 68 [2] deductionMetric: Monetary|BC/Assets|CM/Method 1|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Financial and credit institutionMetric: Monetary|BC/Assets|CM/Method 1|ET/Type 1 Equity|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Financial and Metric: Monetary|BC/Assets|CM/Method 1|ET/Type 2 Equity|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Financial and Metric: Monetary|BC/Assets|CM/Method 1|ET/Subordinated liabilities|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/FinanMetric: Monetary|BC/Assets|CM/Other than method 1|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Financial and credit Metric: Monetary|BC/Assets|CM/Other than method 1|ET/Type 1 Equity|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/FinaMetric: Monetary|BC/Assets|CM/Other than method 1|ET/Type 2 Equity|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/FinaMetric: Monetary|BC/Assets|CM/Other than method 1|ET/Subordinated liabilities|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own fundMetric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/Non-strategic participation [not deducted from own funds]|CT/Financial and credit institutionsMetric: Monetary|BC/Assets|ET/Type 1 Equity|AS/Participations and related undertakings|IO/Non-strategic participation [not deducted from own funds]|CT/Financial and credit insMetric: Monetary|BC/Assets|ET/Type 2 Equity|AS/Participations and related undertakings|IO/Non-strategic participation [not deducted from own funds]|CT/Financial and credit insMetric: Monetary|BC/Assets|ET/Subordinated liabilities|AS/Participations and related undertakings|IO/Non-strategic participation [not deducted from own funds]|CT/Financial and cMetric: Monetary|BC/Assets|ET/Type 1 Equity|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Other than financial and credMetric: Monetary|BC/Assets|ET/Type 2 Equity|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Other than financial and credMetric: Monetary|BC/Assets|ET/Subordinated liabilities|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Other than financialMetric: Monetary|BC/Assets|ET/Type 1 Equity|AS/Participations and related undertakings|IO/Non-strategic participation [not deducted from own funds]|CT/Other than financial and Metric: Monetary|BC/Assets|ET/Type 2 Equity|AS/Participations and related undertakings|IO/Non-strategic participation [not deducted from own funds]|CT/Other than financial and Metric: Monetary|BC/Assets|ET/Subordinated liabilities|AS/Participations and related undertakings|IO/Non-strategic participation [not deducted from own funds]|CT/Other than finaMetric: Monetary|BC/Assets|AS/Participations and related undertakings|IO/Participations|CT/Financial and credit institutionsMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Deductions|IO/Participations [deducted from own funds]|CT/Financial and credit institutionsMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Article 228 (paragraphs 2) deductionMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|IO/Non-strategic participation and investments other than participations|OU/Not to be deducted|UG/BefoMetric: Monetary|II/Standard formula|BC/Exposure|IO/Non-strategic participation and investments other than participations|OU/Not to be deducted|IT/After risk mitigation effect Metric: Entities in the scope of the group (Full scope)Metric: (Re)insurance Solo requirements (Full scope)Metric: Life and Health SLT Technical Provisions (Full scope Ring-fenced fund/matching portfolio/remaining part)Metric: Non-Life Technical Provisions (Full scope Ring-fenced fund/matching portfolio/remaining part)Metric: Issuer country (Full scope)Metric: Issuer country/country of residence (Full scope)Metric: Inclusion in the scope of Group supervision (Full scope)Metric: Monetary|VG/Solvency II|BC/Adjustment for restricted own fund items in respect of matching adjustment portfolios and ring fenced fundsMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IO/Non-strategic participation and investments other than participations|OU/NMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|AL/Equity instruments, loans and bonds|IO/Non-strategic participation and investments other than parMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|IO/Non-strategic participation and investments other than participations|OU/Not to be deducted|IT/AfteMetric: Group - contribution of TP (Full scope)Metric: List of assets (Financial stability)Metric: List of items on own funds (Individual)Metric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Ordinary shares|SY/Called up but not yet paid inMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Subordinated mutual member accounts|DU/Undated with a call optionMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Subordinated mutual member accounts|DU/DatedMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Subordinated mutual member accounts|DU/Undated with no contractual opportunity to redeemMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Preference shares|DU/Dated

Page 100: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Preference shares|DU/Undated with a call optionMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Preference shares|DU/Undated with no contractual opportunity to redeemMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Subordinated debt instruments|DU/DatedMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Subordinated debt instruments|DU/Undated with a call optionMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Subordinated debt instruments|DU/Undated with no contractual opportunity to redeemMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Initial funds [members' contributions or the equivalent basic own fund item for mutual and mutual-Metric: Monetary|BC/Assets|LL/Controlling interestsMetric: Monetary|BC/Liability|LL/Controlling interests|LB/Technical provisionsMetric: Monetary|BC/Liability|LL/Controlling interests|LB/Other than technical provisionsMetric: Monetary|BC/Liability|LL/Controlling interests|LB/Reserves and retained earningsMetric: Monetary|BC/Liability|LL/Controlling interests|LB/Other than reserves and retained earnings,Metric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Own funds [before deductions] other than reconciliation reserve|IO/Other than own instruments helMetric: Monetary|BC/Liability|LL/Controlling interests|LB/Other than reserves and retained earningsMetric: Monetary|VG/Solvency II|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IT/After risk mitigation effect other than from finite reinsuraMetric: Monetary|VG/Solvency II|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|IT/After risk mitigation effect other than from finite reinsuranMetric: Monetary|VG/Solvency II|II/Partial internal model|BC/Solvency capital requirement [SCR]|IT/After risk mitigation effect other than from finite reinsurance|EA/Including the lMetric: Monetary|VG/Solvency II|II/Full internal model|BC/Solvency capital requirement [SCR]|IT/After risk mitigation effect other than from finite reinsurance|EA/Including the losMetric: Monetary|TA/Notional amount|VG/Solvency II|BC/Off-balance sheet|OB/Collateral heldMetric: Monetary|VG/Solvency II|BC/Economical result|DI/Year to Date|BL/Variable annuities|TB/Direct Business|SH/Not assuming hedgingMetric: Monetary|VG/Solvency II|BC/Economical result|DI/Year to Date|BL/Variable annuities|TB/Direct Business|SH/Assuming hedgingMetric: Monetary|VG/Solvency II|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|UG/Diversification effect|IT/After risk mitigation effect other Metric: Monetary|TA/Value net of encumbrance|BC/AssetsMetric: Monetary|BC/Assets|AS/Shares|IO/Own instruments held directly or indirectlyMetric: Monetary|BC/Own funds|BE/Basic own funds|OF/Ordinary shares|IO/Other than own instruments held directlyMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|OF/Ordinary shares|IO/Other than own instruments held directlyMetric: Monetary|VG/Prudential|BC/Local capital requirementMetric: Monetary|VG/Prudential|BC/Local minimum capital requirementMetric: Monetary|VG/Prudential|BC/Eligible own funds in accordance with local rulesMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Available to meet SCR criteria|OF/Ordinary shares|IO/Other than own instruments held directlyMetric: Monetary|VG/Solvency II|BC/Assets|AS/Recoverables recognised for TP calculation|IO/Other than investment, own use, own instruments held directly and cash and cash eqMetric: Monetary|BC/Own funds|BE/Basic own funds|MS/Available to meet SCR criteriaMetric: Simplifications - spread risk - bonds and loansMetric: Captives simplifications - interest rate riskMetric: Captives simplifications - spread risk on bonds and loansMetric: Captives simplifications - market concentration riskMetric: Simplifications - Counterparty default riskMetric: Simplifications - mortality riskMetric: Simplifications - longevity riskMetric: Simplifications - disability-morbidity riskMetric: Simplifications - lapse riskMetric: Simplifications - life expense riskMetric: Simplifications - life catastrophe riskMetric: Simplifications - health mortality riskMetric: Simplifications - health longevity riskMetric: Simplifications - health disability-morbidity risk-medical expensesMetric: Simplifications - health disability-morbidity risk-income protectionMetric: Simplifications - SLT lapse riskMetric: Simplifications - health expense riskMetric: Captives simplifications - premium and reserve riskMetric: String|TS/Name of collateral/guarantee providerMetric: Monetary|BC/Liability|LB/Contingent [for which maximum value is identified]

Page 101: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: List of assets (Third country branches)Metric: Collective investment undertakings - look-through approach (Third country branches)Metric: Structured products (Third country branches)Metric: Open derivatives (Third country branches)Metric: Derivatives Transactions (Third country branches)Metric: Securities lending and repos (Third country branches)Metric: Assets held as collateral (Third country branches)Metric: Life and Health SLT Technical Provisions (Third country branches)Metric: Non-Life Technical Provisions (Third country branches)Metric: Own funds (Third country branches)Metric: Balance Sheet (Third country branches)Metric: Premiums, claims and expenses by line of business (Third country branches)Metric: Infrastructure investment [210]Metric: Monetary|II/Standard formula|BC/LiabilityMetric: Pure|II/Standard formula|PP/Inflation rateMetric: Product classification [210]Metric: Portfolio (investment, securities lending and repo)[210]Metric: Sub RFF, MAP [210]Metric: Monetary|VG/Solvency II|BC/Counterparty assets ring-fenced to settle cedant-specific obligationsMetric: Monetary|VG/Solvency II|BC/Non ring-fenced, non cedant-specific counterparty assets for which recourse may existMetric: Monetary|II/Standard formula|BC/Solvency capital requirement [SCR]|UG/Before diversification effect|UH/Before diversification effectMetric: Monetary|II/Standard formula or partial internal model|BC/Solvency capital requirement [SCR]|UG/Before diversification effect|UH/Before diversification effectMetric: Monetary|II/Full internal model|BC/Solvency capital requirement [SCR]|UG/Before diversification effect|UH/Before diversification effectMetric: RFF, MAP or Remaining of a fund [210]Metric: Solvency Capital Requirement - Only SF (Full scope individual)[210]Metric: Solvency Capital Requirement - SF (Full scope group)[210]Metric: Assets and liabilities by currency (Full scope group)[210]Metric: Line of Business (Full scope)[210]Metric: Type of structured product (Full scope)[210]Metric: Deposits to cedants - line-by-line reporting (Full scope individual)[210]Metric: Decimal|DC/Macaulay duration [years]Metric: Decimal|DC/Macaulay duration [months]Metric: Decimal|DC/Macaulay duration of the insurance and reinsurance obligations [years]Metric: Best estimate subject to volatility adjustment by country and currency [210]Metric: Premiums, claims and expenses by line of business (Individual)[210]Metric: Own funds (Full scope individual)[210]Metric: Balance Sheet (Finacial stability)[210]Metric: Premiums, claims and expenses by line of business (Financial stability)[210]Metric: Own funds (Financial stability)[210]Metric: Own funds (Third country branches)[210]Metric: Premiums, claims and expenses by line of business (Third country branches)[210]Metric: Premiums, claims and expenses by country [210]Metric: String|TS/Name of related partyMetric: Country of authorisation [210]Metric: Reporting country [210]Metric: Monetary|II/Standard formula|BC/Exposure|IT/After risk mitigation [risk mitigation cost for reinstalment premium and other than from finite reinsurance]Metric: Collective investment undertakings - look-through approach (Individual)[210]Metric: Collective investment undertakings - look-through approach (Group)[210]Metric: Collective investment undertakings - look-through approach (Third country branches)[210]Metric: Structured products (Individual)[210]Metric: Structured products (Third country branches)[210]

Page 102: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Metric: Securities lending and repos (Individual)[210]Metric: Integer|NT/Largest accident risk concentration of an insurance or reinsurance undertakingMetric: Deposits to cedants - line-by-line reporting (Third country branches)[210]Metric: Country of third country undertaking [210]Metric: Country of third country branch [210]Metric: String|TS/USP - Life underwriting riskMetric: String|TS/USP - Health underwriting riskMetric: String|TS/USP - Non life underwriting riskMetric: String|TS/USPMetric: String|OF/Article 68 [1] deduction|IO/Participations [deducted from own funds]|CT/Financial and credit institutions|TS/Name of related partyMetric: String|OF/Article 68 [2] deduction|IO/Participations [deducted from own funds]|CT/Financial and credit institutions|TS/Name of related partyMetric: String|CM/Method 1|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Financial and credit institutions|TS/Name of rMetric: String|CM/Other than method 1|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Financial and credit institutions|TMetric: String|AS/Participations and related undertakings|IO/Non-strategic participation [not deducted from own funds]|CT/Financial and credit institutions|TS/Name of related parMetric: String|AS/Participations and related undertakings|IO/Strategic participation [not deducted from own funds]|CT/Other than financial and credit institutions|TS/Name of relatMetric: String|AS/Participations and related undertakings|IO/Non-strategic participation [not deducted from own funds]|CT/Other than financial and credit institutions|TS/Name of Metric: Monetary|VG/Solvency II|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Other items approved by supervisory authorMetric: Monetary|VG/Solvency II|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Share premium related to preference shareMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Other items approved by supervisory authorityMetric: Monetary|BC/Own funds|LL/Controlling interests|BE/Basic own funds|MS/Not available to meet SCR criteria|OF/Share premium related to preference sharesMetric: Decimal|CB/Motor vehicle liability insurance [except carrier's liability]|NT/Frequency of claimsMetric: Development of the distribution of the claims incurred [220]Metric: Loss distribution risk profile [220]Metric: Non-life underwriting peak risks [220]Metric: Non-life underwriting mass risks [220]Metric: Solvency Capital Requirement - Market risk (Full scope individual)[220]Metric: Solvency Capital Requirement - Market risk (Full scope group)[220]Metric: Solvency Capital Requirement - Counterparty default risk (Full scope individual)[220]Metric: Solvency Capital Requirement - Counterparty default risk (Full scope group)[220]Metric: Solvency Capital Requirement - Life underwriting risk (Full scope individual)[220]Metric: Solvency Capital Requirement - Life underwriting risk (Full scope group)[220]Metric: Solvency Capital Requirement - Health underwriting risk (Full scope individual)[220]Metric: Solvency Capital Requirement - Health underwriting risk (Full scope group)[220]Metric: Solvency Capital Requirement - Non-Life underwriting risk (Full scope individual)[220]Metric: Solvency Capital Requirement - Non-Life underwriting risk (Full scope group)[220]Metric: Type of undertaking [220]Metric: Type of branch [220]Metric: Type of undertakings (Full scope)[220]Metric: Date|TD/Financial year endMetric: Regular/Ad-hoc submission (group)Metric: Nominated ECAIMetric: String|TS/Description of simplificationsMetric: Structured products (Group)[220]Metric: MonetaryMetric: StringMetric: DateMetric: IntegerMetric: DecimalMetric: String|TS/Comment to technical table

A2098
Michal Skopowski: Multiple enumeration
A2099
Michal Skopowski: Multiple enumeration
A2100
Michal Skopowski: Multiple enumeration
Page 103: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Owner Data type Domain Hierarchydi10 s2md xbrli:dateItemTypedi11 s2md xbrli:dateItemTypedi12 s2md xbrli:dateItemTypedi13 s2md xbrli:dateItemTypedi14 s2md xbrli:dateItemTypedi15 s2md xbrli:dateItemTypepi16 s2md xbrli:decimalItemTypepi17 s2md xbrli:decimalItemTypepi18 s2md xbrli:decimalItemTypeii19 s2md xbrli:integerItemTypeii20 s2md xbrli:integerItemTypeii21 s2md xbrli:integerItemTypeii22 s2md xbrli:integerItemTypeii23 s2md xbrli:integerItemTypeii24 s2md xbrli:integerItemTypeii25 s2md xbrli:integerItemTypeii26 s2md xbrli:integerItemTypeii27 s2md xbrli:integerItemTypeii28 s2md xbrli:integerItemTypeii29 s2md xbrli:integerItemTypeii30 s2md xbrli:integerItemTypeii31 s2md xbrli:integerItemTypeii32 s2md xbrli:integerItemTypeii33 s2md xbrli:integerItemTypeii34 s2md xbrli:integerItemTypeii35 s2md xbrli:integerItemTypeii36 s2md xbrli:integerItemTypeii37 s2md xbrli:integerItemTypeii38 s2md xbrli:integerItemTypeii39 s2md xbrli:integerItemTypeii40 s2md xbrli:integerItemTypeii41 s2md xbrli:integerItemTypeii42 s2md xbrli:integerItemTypemi43 s2md xbrli:monetaryItemTypemi44 s2md xbrli:monetaryItemTypemi45 s2md xbrli:monetaryItemTypemi46 s2md xbrli:monetaryItemTypemi47 s2md xbrli:monetaryItemTypemi48 s2md xbrli:monetaryItemTypemi49 s2md xbrli:monetaryItemTypemi50 s2md xbrli:monetaryItemTypemi51 s2md xbrli:monetaryItemTypemi52 s2md xbrli:monetaryItemTypemi53 s2md xbrli:monetaryItemTypemi54 s2md xbrli:monetaryItemTypemi55 s2md xbrli:monetaryItemTypemi56 s2md xbrli:monetaryItemTypemi57 s2md xbrli:monetaryItemTypemi58 s2md xbrli:monetaryItemTypemi59 s2md xbrli:monetaryItemType

Page 104: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi60 s2md xbrli:monetaryItemTypemi61 s2md xbrli:monetaryItemTypemi62 s2md xbrli:monetaryItemTypemi63 s2md xbrli:monetaryItemTypemi64 s2md xbrli:monetaryItemTypemi65 s2md xbrli:monetaryItemTypemi66 s2md xbrli:monetaryItemTypemi67 s2md xbrli:monetaryItemTypemi68 s2md xbrli:monetaryItemTypemi69 s2md xbrli:monetaryItemTypemi70 s2md xbrli:monetaryItemTypemi71 s2md xbrli:monetaryItemTypemi72 s2md xbrli:monetaryItemTypemi73 s2md xbrli:monetaryItemTypemi74 s2md xbrli:monetaryItemTypemi75 s2md xbrli:monetaryItemTypemi76 s2md xbrli:monetaryItemTypemi77 s2md xbrli:monetaryItemTypemi78 s2md xbrli:monetaryItemTypemi79 s2md xbrli:monetaryItemTypemi80 s2md xbrli:monetaryItemTypemi81 s2md xbrli:monetaryItemTypemi82 s2md xbrli:monetaryItemTypemi83 s2md xbrli:monetaryItemTypemi84 s2md xbrli:monetaryItemTypemi85 s2md xbrli:monetaryItemTypemi86 s2md xbrli:monetaryItemTypemi87 s2md xbrli:monetaryItemTypemi88 s2md xbrli:monetaryItemTypemi89 s2md xbrli:monetaryItemTypemi90 s2md xbrli:monetaryItemTypemi92 s2md xbrli:monetaryItemTypemi93 s2md xbrli:monetaryItemTypemi94 s2md xbrli:monetaryItemTypemi95 s2md xbrli:monetaryItemTypemi96 s2md xbrli:monetaryItemTypemi97 s2md xbrli:monetaryItemTypemi98 s2md xbrli:monetaryItemTypemi99 s2md xbrli:monetaryItemTypemi100 s2md xbrli:monetaryItemTypemi101 s2md xbrli:monetaryItemTypemi102 s2md xbrli:monetaryItemTypemi103 s2md xbrli:monetaryItemTypemi104 s2md xbrli:monetaryItemTypemi105 s2md xbrli:monetaryItemTypemi106 s2md xbrli:monetaryItemTypemi107 s2md xbrli:monetaryItemTypemi108 s2md xbrli:monetaryItemTypemi109 s2md xbrli:monetaryItemTypemi110 s2md xbrli:monetaryItemTypemi111 s2md xbrli:monetaryItemType

Page 105: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi112 s2md xbrli:monetaryItemTypemi113 s2md xbrli:monetaryItemTypemi114 s2md xbrli:monetaryItemTypemi115 s2md xbrli:monetaryItemTypemi116 s2md xbrli:monetaryItemTypemi117 s2md xbrli:monetaryItemTypemi118 s2md xbrli:monetaryItemTypemi119 s2md xbrli:monetaryItemTypemi120 s2md xbrli:monetaryItemTypemi121 s2md xbrli:monetaryItemTypemi122 s2md xbrli:monetaryItemTypemi123 s2md xbrli:monetaryItemTypemi124 s2md xbrli:monetaryItemTypemi125 s2md xbrli:monetaryItemTypemi126 s2md xbrli:monetaryItemTypemi127 s2md xbrli:monetaryItemTypemi128 s2md xbrli:monetaryItemTypemi129 s2md xbrli:monetaryItemTypemi130 s2md xbrli:monetaryItemTypemi131 s2md xbrli:monetaryItemTypemi132 s2md xbrli:monetaryItemTypemi133 s2md xbrli:monetaryItemTypemi134 s2md xbrli:monetaryItemTypemi135 s2md xbrli:monetaryItemTypemi136 s2md xbrli:monetaryItemTypemi137 s2md xbrli:monetaryItemTypemi138 s2md xbrli:monetaryItemTypemi139 s2md xbrli:monetaryItemTypemi140 s2md xbrli:monetaryItemTypemi141 s2md xbrli:monetaryItemTypemi142 s2md xbrli:monetaryItemTypemi143 s2md xbrli:monetaryItemTypemi144 s2md xbrli:monetaryItemTypemi145 s2md xbrli:monetaryItemTypemi146 s2md xbrli:monetaryItemTypemi147 s2md xbrli:monetaryItemTypemi148 s2md xbrli:monetaryItemTypemi149 s2md xbrli:monetaryItemTypemi150 s2md xbrli:monetaryItemTypemi151 s2md xbrli:monetaryItemTypemi152 s2md xbrli:monetaryItemTypemi153 s2md xbrli:monetaryItemTypemi154 s2md xbrli:monetaryItemTypemi155 s2md xbrli:monetaryItemTypemi156 s2md xbrli:monetaryItemTypemi157 s2md xbrli:monetaryItemTypemi158 s2md xbrli:monetaryItemTypemi159 s2md xbrli:monetaryItemTypemi160 s2md xbrli:monetaryItemTypemi161 s2md xbrli:monetaryItemTypemi162 s2md xbrli:monetaryItemType

Page 106: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi163 s2md xbrli:monetaryItemTypemi164 s2md xbrli:monetaryItemTypemi165 s2md xbrli:monetaryItemTypemi166 s2md xbrli:monetaryItemTypemi168 s2md xbrli:monetaryItemTypemi169 s2md xbrli:monetaryItemTypemi170 s2md xbrli:monetaryItemTypemi171 s2md xbrli:monetaryItemTypemi172 s2md xbrli:monetaryItemTypemi173 s2md xbrli:monetaryItemTypemi174 s2md xbrli:monetaryItemTypemi175 s2md xbrli:monetaryItemTypemi176 s2md xbrli:monetaryItemTypemi177 s2md xbrli:monetaryItemTypemi178 s2md xbrli:monetaryItemTypemi179 s2md xbrli:monetaryItemTypemi180 s2md xbrli:monetaryItemTypemi181 s2md xbrli:monetaryItemTypemi182 s2md xbrli:monetaryItemTypemi183 s2md xbrli:monetaryItemTypemi184 s2md xbrli:monetaryItemTypemi185 s2md xbrli:monetaryItemTypemi186 s2md xbrli:monetaryItemTypemi187 s2md xbrli:monetaryItemTypemi189 s2md xbrli:monetaryItemTypemi190 s2md xbrli:monetaryItemTypemi191 s2md xbrli:monetaryItemTypemi192 s2md xbrli:monetaryItemTypemi193 s2md xbrli:monetaryItemTypemi195 s2md xbrli:monetaryItemTypemi196 s2md xbrli:monetaryItemTypemi198 s2md xbrli:monetaryItemTypemi199 s2md xbrli:monetaryItemTypemi200 s2md xbrli:monetaryItemTypemi201 s2md xbrli:monetaryItemTypemi202 s2md xbrli:monetaryItemTypemi203 s2md xbrli:monetaryItemTypemi204 s2md xbrli:monetaryItemTypemi205 s2md xbrli:monetaryItemTypemi206 s2md xbrli:monetaryItemTypemi207 s2md xbrli:monetaryItemTypemi208 s2md xbrli:monetaryItemTypemi209 s2md xbrli:monetaryItemTypemi210 s2md xbrli:monetaryItemTypemi211 s2md xbrli:monetaryItemTypemi212 s2md xbrli:monetaryItemTypemi213 s2md xbrli:monetaryItemTypemi214 s2md xbrli:monetaryItemTypemi215 s2md xbrli:monetaryItemTypemi216 s2md xbrli:monetaryItemTypemi217 s2md xbrli:monetaryItemType

Page 107: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi218 s2md xbrli:monetaryItemTypemi219 s2md xbrli:monetaryItemTypemi220 s2md xbrli:monetaryItemTypemi221 s2md xbrli:monetaryItemTypemi222 s2md xbrli:monetaryItemTypemi223 s2md xbrli:monetaryItemTypemi224 s2md xbrli:monetaryItemTypemi225 s2md xbrli:monetaryItemTypemi226 s2md xbrli:monetaryItemTypemi227 s2md xbrli:monetaryItemTypemi228 s2md xbrli:monetaryItemTypemi229 s2md xbrli:monetaryItemTypemi230 s2md xbrli:monetaryItemTypemi231 s2md xbrli:monetaryItemTypemi232 s2md xbrli:monetaryItemTypemi233 s2md xbrli:monetaryItemTypemi234 s2md xbrli:monetaryItemTypemi235 s2md xbrli:monetaryItemTypemi236 s2md xbrli:monetaryItemTypemi237 s2md xbrli:monetaryItemTypemi238 s2md xbrli:monetaryItemTypemi239 s2md xbrli:monetaryItemTypemi240 s2md xbrli:monetaryItemTypemi241 s2md xbrli:monetaryItemTypemi242 s2md xbrli:monetaryItemTypemi243 s2md xbrli:monetaryItemTypemi244 s2md xbrli:monetaryItemTypemi245 s2md xbrli:monetaryItemTypemi246 s2md xbrli:monetaryItemTypemi247 s2md xbrli:monetaryItemTypemi248 s2md xbrli:monetaryItemTypemi249 s2md xbrli:monetaryItemTypemi250 s2md xbrli:monetaryItemTypemi251 s2md xbrli:monetaryItemTypemi252 s2md xbrli:monetaryItemTypemi253 s2md xbrli:monetaryItemTypemi254 s2md xbrli:monetaryItemTypemi255 s2md xbrli:monetaryItemTypemi256 s2md xbrli:monetaryItemTypemi257 s2md xbrli:monetaryItemTypemi258 s2md xbrli:monetaryItemTypemi259 s2md xbrli:monetaryItemTypemi260 s2md xbrli:monetaryItemTypemi261 s2md xbrli:monetaryItemTypemi262 s2md xbrli:monetaryItemTypemi263 s2md xbrli:monetaryItemTypemi264 s2md xbrli:monetaryItemTypemi265 s2md xbrli:monetaryItemTypemi266 s2md xbrli:monetaryItemTypemi267 s2md xbrli:monetaryItemTypemi268 s2md xbrli:monetaryItemType

Page 108: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi269 s2md xbrli:monetaryItemTypemi270 s2md xbrli:monetaryItemTypemi271 s2md xbrli:monetaryItemTypemi272 s2md xbrli:monetaryItemTypemi273 s2md xbrli:monetaryItemTypemi274 s2md xbrli:monetaryItemTypemi275 s2md xbrli:monetaryItemTypemi276 s2md xbrli:monetaryItemTypemi277 s2md xbrli:monetaryItemTypemi278 s2md xbrli:monetaryItemTypemi279 s2md xbrli:monetaryItemTypemi280 s2md xbrli:monetaryItemTypemi281 s2md xbrli:monetaryItemTypemi283 s2md xbrli:monetaryItemTypemi284 s2md xbrli:monetaryItemTypemi285 s2md xbrli:monetaryItemTypemi286 s2md xbrli:monetaryItemTypemi287 s2md xbrli:monetaryItemTypemi288 s2md xbrli:monetaryItemTypemi289 s2md xbrli:monetaryItemTypemi290 s2md xbrli:monetaryItemTypemi291 s2md xbrli:monetaryItemTypemi292 s2md xbrli:monetaryItemTypemi293 s2md xbrli:monetaryItemTypemi294 s2md xbrli:monetaryItemTypemi295 s2md xbrli:monetaryItemTypemi296 s2md xbrli:monetaryItemTypemi297 s2md xbrli:monetaryItemTypemi298 s2md xbrli:monetaryItemTypemi299 s2md xbrli:monetaryItemTypemi300 s2md xbrli:monetaryItemTypemi301 s2md xbrli:monetaryItemTypemi302 s2md xbrli:monetaryItemTypemi303 s2md xbrli:monetaryItemTypemi304 s2md xbrli:monetaryItemTypemi305 s2md xbrli:monetaryItemTypemi306 s2md xbrli:monetaryItemTypemi307 s2md xbrli:monetaryItemTypemi308 s2md xbrli:monetaryItemTypemi309 s2md xbrli:monetaryItemTypemi310 s2md xbrli:monetaryItemTypemi311 s2md xbrli:monetaryItemTypemi312 s2md xbrli:monetaryItemTypemi313 s2md xbrli:monetaryItemTypemi317 s2md xbrli:monetaryItemTypemi318 s2md xbrli:monetaryItemTypemi319 s2md xbrli:monetaryItemTypemi320 s2md xbrli:monetaryItemTypemi321 s2md xbrli:monetaryItemTypemi322 s2md xbrli:monetaryItemTypemi323 s2md xbrli:monetaryItemType

Page 109: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi324 s2md xbrli:monetaryItemTypemi325 s2md xbrli:monetaryItemTypemi326 s2md xbrli:monetaryItemTypemi327 s2md xbrli:monetaryItemTypemi328 s2md xbrli:monetaryItemTypemi329 s2md xbrli:monetaryItemTypemi330 s2md xbrli:monetaryItemTypemi331 s2md xbrli:monetaryItemTypemi332 s2md xbrli:monetaryItemTypemi333 s2md xbrli:monetaryItemTypemi334 s2md xbrli:monetaryItemTypemi335 s2md xbrli:monetaryItemTypemi336 s2md xbrli:monetaryItemTypemi339 s2md xbrli:monetaryItemTypemi340 s2md xbrli:monetaryItemTypemi341 s2md xbrli:monetaryItemTypemi342 s2md xbrli:monetaryItemTypemi343 s2md xbrli:monetaryItemTypemi344 s2md xbrli:monetaryItemTypemi345 s2md xbrli:monetaryItemTypemi346 s2md xbrli:monetaryItemTypemi347 s2md xbrli:monetaryItemTypemi348 s2md xbrli:monetaryItemTypemi349 s2md xbrli:monetaryItemTypemi350 s2md xbrli:monetaryItemTypemi351 s2md xbrli:monetaryItemTypemi352 s2md xbrli:monetaryItemTypemi353 s2md xbrli:monetaryItemTypemi354 s2md xbrli:monetaryItemTypemi355 s2md xbrli:monetaryItemTypemi356 s2md xbrli:monetaryItemTypemi357 s2md xbrli:monetaryItemTypemi358 s2md xbrli:monetaryItemTypemi359 s2md xbrli:monetaryItemTypemi360 s2md xbrli:monetaryItemTypemi362 s2md xbrli:monetaryItemTypemi363 s2md xbrli:monetaryItemTypemi364 s2md xbrli:monetaryItemTypemi365 s2md xbrli:monetaryItemTypemi366 s2md xbrli:monetaryItemTypemi367 s2md xbrli:monetaryItemTypemi368 s2md xbrli:monetaryItemTypemi369 s2md xbrli:monetaryItemTypemi370 s2md xbrli:monetaryItemTypemi371 s2md xbrli:monetaryItemTypemi372 s2md xbrli:monetaryItemTypemi373 s2md xbrli:monetaryItemTypemi374 s2md xbrli:monetaryItemTypemi375 s2md xbrli:monetaryItemTypemi376 s2md xbrli:monetaryItemTypemi377 s2md xbrli:monetaryItemType

Page 110: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi378 s2md xbrli:monetaryItemTypemi379 s2md xbrli:monetaryItemTypemi380 s2md xbrli:monetaryItemTypemi381 s2md xbrli:monetaryItemTypemi382 s2md xbrli:monetaryItemTypemi383 s2md xbrli:monetaryItemTypemi384 s2md xbrli:monetaryItemTypemi385 s2md xbrli:monetaryItemTypemi386 s2md xbrli:monetaryItemTypemi387 s2md xbrli:monetaryItemTypemi388 s2md xbrli:monetaryItemTypemi389 s2md xbrli:monetaryItemTypemi390 s2md xbrli:monetaryItemTypemi391 s2md xbrli:monetaryItemTypemi392 s2md xbrli:monetaryItemTypemi393 s2md xbrli:monetaryItemTypemi394 s2md xbrli:monetaryItemTypemi395 s2md xbrli:monetaryItemTypemi396 s2md xbrli:monetaryItemTypemi397 s2md xbrli:monetaryItemTypemi398 s2md xbrli:monetaryItemTypemi399 s2md xbrli:monetaryItemTypemi400 s2md xbrli:monetaryItemTypemi401 s2md xbrli:monetaryItemTypemi402 s2md xbrli:monetaryItemTypemi403 s2md xbrli:monetaryItemTypemi404 s2md xbrli:monetaryItemTypemi405 s2md xbrli:monetaryItemTypemi406 s2md xbrli:monetaryItemTypemi407 s2md xbrli:monetaryItemTypemi408 s2md xbrli:monetaryItemTypemi409 s2md xbrli:monetaryItemTypemi410 s2md xbrli:monetaryItemTypemi411 s2md xbrli:monetaryItemTypemi412 s2md xbrli:monetaryItemTypemi413 s2md xbrli:monetaryItemTypemi414 s2md xbrli:monetaryItemTypemi415 s2md xbrli:monetaryItemTypemi416 s2md xbrli:monetaryItemTypemi417 s2md xbrli:monetaryItemTypemi418 s2md xbrli:monetaryItemTypemi419 s2md xbrli:monetaryItemTypemi420 s2md xbrli:monetaryItemTypemi421 s2md xbrli:monetaryItemTypemi422 s2md xbrli:monetaryItemTypemi423 s2md xbrli:monetaryItemTypemi424 s2md xbrli:monetaryItemTypemi425 s2md xbrli:monetaryItemTypemi426 s2md xbrli:monetaryItemTypemi427 s2md xbrli:monetaryItemTypemi428 s2md xbrli:monetaryItemType

Page 111: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi429 s2md xbrli:monetaryItemTypemi430 s2md xbrli:monetaryItemTypemi431 s2md xbrli:monetaryItemTypemi432 s2md xbrli:monetaryItemTypemi433 s2md xbrli:monetaryItemTypemi434 s2md xbrli:monetaryItemTypemi435 s2md xbrli:monetaryItemTypemi436 s2md xbrli:monetaryItemTypemi437 s2md xbrli:monetaryItemTypemi438 s2md xbrli:monetaryItemTypemi439 s2md xbrli:monetaryItemTypemi440 s2md xbrli:monetaryItemTypemi441 s2md xbrli:monetaryItemTypemi442 s2md xbrli:monetaryItemTypemi443 s2md xbrli:monetaryItemTypemi444 s2md xbrli:monetaryItemTypemi445 s2md xbrli:monetaryItemTypemi446 s2md xbrli:monetaryItemTypemi447 s2md xbrli:monetaryItemTypemi448 s2md xbrli:monetaryItemTypemi449 s2md xbrli:monetaryItemTypemi450 s2md xbrli:monetaryItemTypemi451 s2md xbrli:monetaryItemTypemi452 s2md xbrli:monetaryItemTypemi453 s2md xbrli:monetaryItemTypemi454 s2md xbrli:monetaryItemTypemi455 s2md xbrli:monetaryItemTypemi456 s2md xbrli:monetaryItemTypemi457 s2md xbrli:monetaryItemTypemi458 s2md xbrli:monetaryItemTypemi459 s2md xbrli:monetaryItemTypemi460 s2md xbrli:monetaryItemTypemi461 s2md xbrli:monetaryItemTypemi462 s2md xbrli:monetaryItemTypemi463 s2md xbrli:monetaryItemTypemi464 s2md xbrli:monetaryItemTypemi465 s2md xbrli:monetaryItemTypemi467 s2md xbrli:monetaryItemTypemi472 s2md xbrli:monetaryItemTypemi473 s2md xbrli:monetaryItemTypemi475 s2md xbrli:monetaryItemTypemi476 s2md xbrli:monetaryItemTypemi477 s2md xbrli:monetaryItemTypemi478 s2md xbrli:monetaryItemTypemi479 s2md xbrli:monetaryItemTypemi481 s2md xbrli:monetaryItemTypemi482 s2md xbrli:monetaryItemTypemi483 s2md xbrli:monetaryItemTypemi484 s2md xbrli:monetaryItemTypemi485 s2md xbrli:monetaryItemTypemi486 s2md xbrli:monetaryItemType

Page 112: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi489 s2md xbrli:monetaryItemTypemi490 s2md xbrli:monetaryItemTypemi491 s2md xbrli:monetaryItemTypemi492 s2md xbrli:monetaryItemTypemi493 s2md xbrli:monetaryItemTypemi494 s2md xbrli:monetaryItemTypemi495 s2md xbrli:monetaryItemTypemi496 s2md xbrli:monetaryItemTypemi497 s2md xbrli:monetaryItemTypemi498 s2md xbrli:monetaryItemTypemi499 s2md xbrli:monetaryItemTypemi500 s2md xbrli:monetaryItemTypemi501 s2md xbrli:monetaryItemTypemi502 s2md xbrli:monetaryItemTypemi503 s2md xbrli:monetaryItemTypemi504 s2md xbrli:monetaryItemTypemi505 s2md xbrli:monetaryItemTypemi506 s2md xbrli:monetaryItemTypemi507 s2md xbrli:monetaryItemTypemi508 s2md xbrli:monetaryItemTypemi509 s2md xbrli:monetaryItemTypemi510 s2md xbrli:monetaryItemTypemi511 s2md xbrli:monetaryItemTypemi512 s2md xbrli:monetaryItemTypemi513 s2md xbrli:monetaryItemTypemi518 s2md xbrli:monetaryItemTypemi519 s2md xbrli:monetaryItemTypemi520 s2md xbrli:monetaryItemTypemi521 s2md xbrli:monetaryItemTypemi522 s2md xbrli:monetaryItemTypemi523 s2md xbrli:monetaryItemTypepi524 s2md num:percentItemTypepi525 s2md num:percentItemTypepi526 s2md num:percentItemTypepi527 s2md num:percentItemTypepi528 s2md num:percentItemTypepi529 s2md num:percentItemTypepi530 s2md num:percentItemTypepi531 s2md num:percentItemTypepi532 s2md num:percentItemTypepi533 s2md num:percentItemTypepi534 s2md num:percentItemTypepi535 s2md num:percentItemTypepi536 s2md num:percentItemTypepi537 s2md num:percentItemTypepi538 s2md num:percentItemTypepi539 s2md num:percentItemTypepi540 s2md num:percentItemTypepi541 s2md num:percentItemTypepi542 s2md num:percentItemTypepi543 s2md num:percentItemType

Page 113: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

pi544 s2md num:percentItemTypepi545 s2md num:percentItemTypepi546 s2md num:percentItemTypepi547 s2md num:percentItemTypepi548 s2md num:percentItemTypesi549 s2md xbrli:stringItemTypesi550 s2md xbrli:stringItemTypesi551 s2md xbrli:stringItemTypesi552 s2md xbrli:stringItemTypesi553 s2md xbrli:stringItemTypesi554 s2md xbrli:stringItemTypesi555 s2md xbrli:stringItemTypemi558 s2md xbrli:monetaryItemTypemi559 s2md xbrli:monetaryItemTypemi560 s2md xbrli:monetaryItemTypemi561 s2md xbrli:monetaryItemTypemi562 s2md xbrli:monetaryItemTypemi563 s2md xbrli:monetaryItemTypemi564 s2md xbrli:monetaryItemTypemi565 s2md xbrli:monetaryItemTypemi566 s2md xbrli:monetaryItemTypemi567 s2md xbrli:monetaryItemTypemi568 s2md xbrli:monetaryItemTypemi569 s2md xbrli:monetaryItemTypemi572 s2md xbrli:monetaryItemTypemi573 s2md xbrli:monetaryItemTypemi574 s2md xbrli:monetaryItemTypemi575 s2md xbrli:monetaryItemTypemi576 s2md xbrli:monetaryItemTypemi577 s2md xbrli:monetaryItemTypemi578 s2md xbrli:monetaryItemTypemi579 s2md xbrli:monetaryItemTypemi580 s2md xbrli:monetaryItemTypemi581 s2md xbrli:monetaryItemTypemi582 s2md xbrli:monetaryItemTypemi583 s2md xbrli:monetaryItemTypemi584 s2md xbrli:monetaryItemTypemi585 s2md xbrli:monetaryItemTypemi586 s2md xbrli:monetaryItemTypemi587 s2md xbrli:monetaryItemTypemi588 s2md xbrli:monetaryItemTypemi589 s2md xbrli:monetaryItemTypemi590 s2md xbrli:monetaryItemTypemi592 s2md xbrli:monetaryItemTypemi593 s2md xbrli:monetaryItemTypemi594 s2md xbrli:monetaryItemTypemi596 s2md xbrli:monetaryItemTypemi597 s2md xbrli:monetaryItemTypemi598 s2md xbrli:monetaryItemTypemi599 s2md xbrli:monetaryItemTypemi600 s2md xbrli:monetaryItemType

Page 114: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi601 s2md xbrli:monetaryItemTypemi602 s2md xbrli:monetaryItemTypemi603 s2md xbrli:monetaryItemTypemi604 s2md xbrli:monetaryItemTypemi605 s2md xbrli:monetaryItemTypemi606 s2md xbrli:monetaryItemTypemi607 s2md xbrli:monetaryItemTypemi608 s2md xbrli:monetaryItemTypemi609 s2md xbrli:monetaryItemTypemi610 s2md xbrli:monetaryItemTypemi611 s2md xbrli:monetaryItemTypemi612 s2md xbrli:monetaryItemTypemi614 s2md xbrli:monetaryItemTypemi615 s2md xbrli:monetaryItemTypemi616 s2md xbrli:monetaryItemTypemi617 s2md xbrli:monetaryItemTypemi618 s2md xbrli:monetaryItemTypemi619 s2md xbrli:monetaryItemTypepi620 s2md num:percentItemTypebi621 s2md xbrli:booleanItemTypebi622 s2md xbrli:booleanItemTypebi623 s2md xbrli:booleanItemTypebi624 s2md xbrli:booleanItemTypebi625 s2md xbrli:booleanItemTypebi626 s2md xbrli:booleanItemTypebi627 s2md xbrli:booleanItemTypebi628 s2md xbrli:booleanItemTypebi629 s2md xbrli:booleanItemTypebi630 s2md xbrli:booleanItemTypebi631 s2md xbrli:booleanItemTypebi632 s2md xbrli:booleanItemTypebi633 s2md xbrli:booleanItemTypebi634 s2md xbrli:booleanItemTypebi635 s2md xbrli:booleanItemTypebi636 s2md xbrli:booleanItemTypebi637 s2md xbrli:booleanItemTypebi638 s2md xbrli:booleanItemTypebi639 s2md xbrli:booleanItemTypebi640 s2md xbrli:booleanItemTypeii641 s2md xbrli:integerItemTypeii642 s2md xbrli:integerItemTypeii643 s2md xbrli:integerItemTypeii644 s2md xbrli:integerItemTypeii645 s2md xbrli:integerItemTypemi646 s2md xbrli:monetaryItemTypemi647 s2md xbrli:monetaryItemTypemi648 s2md xbrli:monetaryItemTypemi649 s2md xbrli:monetaryItemTypemi650 s2md xbrli:monetaryItemTypemi651 s2md xbrli:monetaryItemTypemi652 s2md xbrli:monetaryItemType

Page 115: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi653 s2md xbrli:monetaryItemTypemi654 s2md xbrli:monetaryItemTypemi655 s2md xbrli:monetaryItemTypemi656 s2md xbrli:monetaryItemTypemi657 s2md xbrli:monetaryItemTypemi658 s2md xbrli:monetaryItemTypemi659 s2md xbrli:monetaryItemTypemi660 s2md xbrli:monetaryItemTypemi662 s2md xbrli:monetaryItemTypemi663 s2md xbrli:monetaryItemTypemi664 s2md xbrli:monetaryItemTypemi665 s2md xbrli:monetaryItemTypemi666 s2md xbrli:monetaryItemTypemi667 s2md xbrli:monetaryItemTypemi668 s2md xbrli:monetaryItemTypemi669 s2md xbrli:monetaryItemTypemi670 s2md xbrli:monetaryItemTypemi671 s2md xbrli:monetaryItemTypemi672 s2md xbrli:monetaryItemTypemi673 s2md xbrli:monetaryItemTypemi674 s2md xbrli:monetaryItemTypemi675 s2md xbrli:monetaryItemTypemi676 s2md xbrli:monetaryItemTypemi677 s2md xbrli:monetaryItemTypemi678 s2md xbrli:monetaryItemTypemi679 s2md xbrli:monetaryItemTypemi680 s2md xbrli:monetaryItemTypemi681 s2md xbrli:monetaryItemTypemi682 s2md xbrli:monetaryItemTypemi683 s2md xbrli:monetaryItemTypemi684 s2md xbrli:monetaryItemTypemi685 s2md xbrli:monetaryItemTypemi686 s2md xbrli:monetaryItemTypemi688 s2md xbrli:monetaryItemTypemi689 s2md xbrli:monetaryItemTypemi690 s2md xbrli:monetaryItemTypemi691 s2md xbrli:monetaryItemTypepi695 s2md num:percentItemTypepi696 s2md num:percentItemTypepi697 s2md num:percentItemTypepi698 s2md num:percentItemTypepi699 s2md num:percentItemTypepi700 s2md num:percentItemTypepi701 s2md num:percentItemTypepi702 s2md num:percentItemTypesi703 s2md xbrli:stringItemTypebi704 s2md xbrli:booleanItemTypebi705 s2md xbrli:booleanItemTypebi706 s2md xbrli:booleanItemTypebi707 s2md xbrli:booleanItemTypebi708 s2md xbrli:booleanItemType

Page 116: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

bi709 s2md xbrli:booleanItemTypebi710 s2md xbrli:booleanItemTypemi711 s2md xbrli:monetaryItemTypemi712 s2md xbrli:monetaryItemTypemi713 s2md xbrli:monetaryItemTypemi714 s2md xbrli:monetaryItemTypemi715 s2md xbrli:monetaryItemTypemi716 s2md xbrli:monetaryItemTypemi717 s2md xbrli:monetaryItemTypemi718 s2md xbrli:monetaryItemTypemi719 s2md xbrli:monetaryItemTypemi721 s2md xbrli:monetaryItemTypemi722 s2md xbrli:monetaryItemTypemi723 s2md xbrli:monetaryItemTypemi724 s2md xbrli:monetaryItemTypemi725 s2md xbrli:monetaryItemTypemi726 s2md xbrli:monetaryItemTypemi728 s2md xbrli:monetaryItemTypemi729 s2md xbrli:monetaryItemTypebi730 s2md xbrli:booleanItemTypebi731 s2md xbrli:booleanItemTypebi732 s2md xbrli:booleanItemTypebi733 s2md xbrli:booleanItemTypebi734 s2md xbrli:booleanItemTypebi735 s2md xbrli:booleanItemTypebi736 s2md xbrli:booleanItemTypebi737 s2md xbrli:booleanItemTypebi738 s2md xbrli:booleanItemTypebi739 s2md xbrli:booleanItemTypebi740 s2md xbrli:booleanItemTypebi741 s2md xbrli:booleanItemTypebi742 s2md xbrli:booleanItemTypebi743 s2md xbrli:booleanItemTypebi744 s2md xbrli:booleanItemTypebi745 s2md xbrli:booleanItemTypebi746 s2md xbrli:booleanItemTypebi747 s2md xbrli:booleanItemTypebi748 s2md xbrli:booleanItemTypebi749 s2md xbrli:booleanItemTypebi750 s2md xbrli:booleanItemTypebi751 s2md xbrli:booleanItemTypebi752 s2md xbrli:booleanItemTypebi753 s2md xbrli:booleanItemTypebi754 s2md xbrli:booleanItemTypebi755 s2md xbrli:booleanItemTypebi756 s2md xbrli:booleanItemTypebi757 s2md xbrli:booleanItemTypebi758 s2md xbrli:booleanItemTypebi759 s2md xbrli:booleanItemTypebi760 s2md xbrli:booleanItemTypebi761 s2md xbrli:booleanItemType

Page 117: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

bi762 s2md xbrli:booleanItemTypebi763 s2md xbrli:booleanItemTypebi764 s2md xbrli:booleanItemTypebi765 s2md xbrli:booleanItemTypebi766 s2md xbrli:booleanItemTypebi767 s2md xbrli:booleanItemTypebi768 s2md xbrli:booleanItemTypebi769 s2md xbrli:booleanItemTypeei1001 s2md enum:enumerationItemType AM 6ei1002 s2md enum:enumerationItemType AM 9ei1003 s2md enum:enumerationItemType AM 7ei1004 s2md enum:enumerationItemType AP 2ei1006 s2md enum:enumerationItemType CG 4ei1007 s2md enum:enumerationItemType CG 2ei1008 s2md enum:enumerationItemType CG 5ei1009 s2md enum:enumerationItemType CG 6si1010 s2md xbrli:stringItemTypesi1011 s2md xbrli:stringItemTypesi1012 s2md xbrli:stringItemTypesi1013 s2md xbrli:stringItemTypesi1014 s2md xbrli:stringItemTypesi1015 s2md xbrli:stringItemTypesi1016 s2md xbrli:stringItemTypeei1017 s2md enum:enumerationItemType CS 5ei1018 s2md enum:enumerationItemType CS 3ei1019 s2md enum:enumerationItemType CS 4ei1020 s2md enum:enumerationItemType CS 2ei1021 s2md enum:enumerationItemType CS 2ei1022 s2md enum:enumerationItemType CU 1ei1023 s2md enum:enumerationItemType CU 1ei1024 s2md enum:enumerationItemType CU 1ei1025 s2md enum:enumerationItemType CU 1ei1026 s2md enum:enumerationItemType CU 1ei1027 s2md enum:enumerationItemType CU 2di1028 s2md xbrli:dateItemTypedi1029 s2md xbrli:dateItemTypedi1030 s2md xbrli:dateItemTypedi1031 s2md xbrli:dateItemTypedi1032 s2md xbrli:dateItemTypedi1033 s2md xbrli:dateItemTypedi1034 s2md xbrli:dateItemTypedi1035 s2md xbrli:dateItemTypedi1036 s2md xbrli:dateItemTypedi1037 s2md xbrli:dateItemTypedi1038 s2md xbrli:dateItemTypedi1039 s2md xbrli:dateItemTypedi1040 s2md xbrli:dateItemTypedi1041 s2md xbrli:dateItemTypedi1042 s2md xbrli:dateItemTypedi1043 s2md xbrli:dateItemTypedi1044 s2md xbrli:dateItemType

Page 118: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

di1045 s2md xbrli:dateItemTypedi1046 s2md xbrli:dateItemTypedi1047 s2md xbrli:dateItemTypedi1048 s2md xbrli:dateItemTypedi1049 s2md xbrli:dateItemTypepi1050 s2md xbrli:decimalItemTypepi1051 s2md xbrli:decimalItemTypepi1052 s2md xbrli:decimalItemTypepi1054 s2md xbrli:decimalItemTypeei1055 s2md enum:enumerationItemType EL 7si1058 s2md xbrli:stringItemTypesi1059 s2md xbrli:stringItemTypeei1060 s2md enum:enumerationItemType GA 5ei1061 s2md enum:enumerationItemType GA 1ei1062 s2md enum:enumerationItemType GA 4si1063 s2md xbrli:stringItemTypesi1064 s2md xbrli:stringItemTypesi1065 s2md xbrli:stringItemTypeii1066 s2md xbrli:integerItemTypeii1067 s2md xbrli:integerItemTypeii1068 s2md xbrli:integerItemTypeii1069 s2md xbrli:integerItemTypeei1070 s2md enum:enumerationItemType LB 4ei1071 s2md enum:enumerationItemType LB 20ei1072 s2md enum:enumerationItemType LB 19ei1073 s2md enum:enumerationItemType LB 21ei1074 s2md enum:enumerationItemType LB 22ei1075 s2md enum:enumerationItemType TB 9ei1076 s2md enum:enumerationItemType LB 24si1077 s2md xbrli:stringItemTypeei1078 s2md enum:enumerationItemType LT 1ei1079 s2md enum:enumerationItemType MC 5ei1080 s2md enum:enumerationItemType MC 12ei1081 s2md enum:enumerationItemType MC 12ei1082 s2md enum:enumerationItemType MC 2ei1083 s2md enum:enumerationItemType MC 2ei1084 s2md enum:enumerationItemType MC 2mi1085 s2md xbrli:monetaryItemTypemi1086 s2md xbrli:monetaryItemTypemi1087 s2md xbrli:monetaryItemTypemi1088 s2md xbrli:monetaryItemTypemi1089 s2md xbrli:monetaryItemTypemi1090 s2md xbrli:monetaryItemTypemi1091 s2md xbrli:monetaryItemTypemi1092 s2md xbrli:monetaryItemTypemi1093 s2md xbrli:monetaryItemTypemi1094 s2md xbrli:monetaryItemTypemi1095 s2md xbrli:monetaryItemTypemi1096 s2md xbrli:monetaryItemTypemi1097 s2md xbrli:monetaryItemTypemi1098 s2md xbrli:monetaryItemType

Page 119: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi1099 s2md xbrli:monetaryItemTypemi1100 s2md xbrli:monetaryItemTypemi1101 s2md xbrli:monetaryItemTypemi1102 s2md xbrli:monetaryItemTypemi1103 s2md xbrli:monetaryItemTypemi1104 s2md xbrli:monetaryItemTypemi1105 s2md xbrli:monetaryItemTypemi1106 s2md xbrli:monetaryItemTypemi1107 s2md xbrli:monetaryItemTypemi1108 s2md xbrli:monetaryItemTypemi1109 s2md xbrli:monetaryItemTypemi1110 s2md xbrli:monetaryItemTypemi1111 s2md xbrli:monetaryItemTypemi1112 s2md xbrli:monetaryItemTypemi1113 s2md xbrli:monetaryItemTypemi1114 s2md xbrli:monetaryItemTypemi1115 s2md xbrli:monetaryItemTypemi1116 s2md xbrli:monetaryItemTypemi1117 s2md xbrli:monetaryItemTypemi1118 s2md xbrli:monetaryItemTypemi1119 s2md xbrli:monetaryItemTypemi1120 s2md xbrli:monetaryItemTypemi1121 s2md xbrli:monetaryItemTypemi1122 s2md xbrli:monetaryItemTypemi1123 s2md xbrli:monetaryItemTypemi1124 s2md xbrli:monetaryItemTypemi1125 s2md xbrli:monetaryItemTypemi1126 s2md xbrli:monetaryItemTypemi1127 s2md xbrli:monetaryItemTypemi1128 s2md xbrli:monetaryItemTypemi1129 s2md xbrli:monetaryItemTypemi1130 s2md xbrli:monetaryItemTypemi1131 s2md xbrli:monetaryItemTypemi1132 s2md xbrli:monetaryItemTypemi1135 s2md xbrli:monetaryItemTypemi1136 s2md xbrli:monetaryItemTypemi1137 s2md xbrli:monetaryItemTypemi1138 s2md xbrli:monetaryItemTypemi1139 s2md xbrli:monetaryItemTypemi1140 s2md xbrli:monetaryItemTypemi1141 s2md xbrli:monetaryItemTypemi1142 s2md xbrli:monetaryItemTypemi1143 s2md xbrli:monetaryItemTypemi1144 s2md xbrli:monetaryItemTypemi1145 s2md xbrli:monetaryItemTypemi1146 s2md xbrli:monetaryItemTypemi1147 s2md xbrli:monetaryItemTypemi1148 s2md xbrli:monetaryItemTypemi1149 s2md xbrli:monetaryItemTypemi1150 s2md xbrli:monetaryItemTypemi1151 s2md xbrli:monetaryItemType

Page 120: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi1152 s2md xbrli:monetaryItemTypemi1153 s2md xbrli:monetaryItemTypemi1154 s2md xbrli:monetaryItemTypemi1155 s2md xbrli:monetaryItemTypemi1156 s2md xbrli:monetaryItemTypemi1157 s2md xbrli:monetaryItemTypemi1158 s2md xbrli:monetaryItemTypemi1159 s2md xbrli:monetaryItemTypemi1160 s2md xbrli:monetaryItemTypemi1161 s2md xbrli:monetaryItemTypemi1162 s2md xbrli:monetaryItemTypemi1163 s2md xbrli:monetaryItemTypemi1164 s2md xbrli:monetaryItemTypemi1165 s2md xbrli:monetaryItemTypemi1166 s2md xbrli:monetaryItemTypemi1167 s2md xbrli:monetaryItemTypemi1168 s2md xbrli:monetaryItemTypemi1169 s2md xbrli:monetaryItemTypemi1170 s2md xbrli:monetaryItemTypemi1171 s2md xbrli:monetaryItemTypemi1172 s2md xbrli:monetaryItemTypemi1174 s2md xbrli:monetaryItemTypemi1175 s2md xbrli:monetaryItemTypemi1176 s2md xbrli:monetaryItemTypemi1177 s2md xbrli:monetaryItemTypemi1178 s2md xbrli:monetaryItemTypemi1179 s2md xbrli:monetaryItemTypemi1180 s2md xbrli:monetaryItemTypemi1181 s2md xbrli:monetaryItemTypemi1182 s2md xbrli:monetaryItemTypemi1183 s2md xbrli:monetaryItemTypemi1184 s2md xbrli:monetaryItemTypemi1185 s2md xbrli:monetaryItemTypemi1186 s2md xbrli:monetaryItemTypemi1203 s2md xbrli:monetaryItemTypemi1204 s2md xbrli:monetaryItemTypemi1205 s2md xbrli:monetaryItemTypemi1206 s2md xbrli:monetaryItemTypemi1207 s2md xbrli:monetaryItemTypemi1208 s2md xbrli:monetaryItemTypemi1209 s2md xbrli:monetaryItemTypemi1210 s2md xbrli:monetaryItemTypemi1211 s2md xbrli:monetaryItemTypemi1212 s2md xbrli:monetaryItemTypemi1213 s2md xbrli:monetaryItemTypemi1214 s2md xbrli:monetaryItemTypemi1215 s2md xbrli:monetaryItemTypemi1216 s2md xbrli:monetaryItemTypemi1218 s2md xbrli:monetaryItemTypemi1219 s2md xbrli:monetaryItemTypemi1220 s2md xbrli:monetaryItemType

Page 121: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi1221 s2md xbrli:monetaryItemTypemi1222 s2md xbrli:monetaryItemTypemi1223 s2md xbrli:monetaryItemTypemi1224 s2md xbrli:monetaryItemTypemi1225 s2md xbrli:monetaryItemTypemi1226 s2md xbrli:monetaryItemTypemi1227 s2md xbrli:monetaryItemTypemi1229 s2md xbrli:monetaryItemTypemi1230 s2md xbrli:monetaryItemTypemi1231 s2md xbrli:monetaryItemTypemi1232 s2md xbrli:monetaryItemTypemi1233 s2md xbrli:monetaryItemTypemi1234 s2md xbrli:monetaryItemTypemi1235 s2md xbrli:monetaryItemTypemi1236 s2md xbrli:monetaryItemTypemi1237 s2md xbrli:monetaryItemTypemi1238 s2md xbrli:monetaryItemTypemi1239 s2md xbrli:monetaryItemTypemi1240 s2md xbrli:monetaryItemTypemi1241 s2md xbrli:monetaryItemTypemi1244 s2md xbrli:monetaryItemTypemi1245 s2md xbrli:monetaryItemTypemi1246 s2md xbrli:monetaryItemTypemi1247 s2md xbrli:monetaryItemTypemi1248 s2md xbrli:monetaryItemTypemi1249 s2md xbrli:monetaryItemTypemi1250 s2md xbrli:monetaryItemTypemi1253 s2md xbrli:monetaryItemTypemi1254 s2md xbrli:monetaryItemTypemi1257 s2md xbrli:monetaryItemTypemi1258 s2md xbrli:monetaryItemTypemi1259 s2md xbrli:monetaryItemTypemi1260 s2md xbrli:monetaryItemTypemi1261 s2md xbrli:monetaryItemTypemi1263 s2md xbrli:monetaryItemTypemi1264 s2md xbrli:monetaryItemTypemi1265 s2md xbrli:monetaryItemTypemi1266 s2md xbrli:monetaryItemTypemi1267 s2md xbrli:monetaryItemTypemi1268 s2md xbrli:monetaryItemTypemi1269 s2md xbrli:monetaryItemTypemi1271 s2md xbrli:monetaryItemTypemi1272 s2md xbrli:monetaryItemTypemi1273 s2md xbrli:monetaryItemTypemi1274 s2md xbrli:monetaryItemTypemi1275 s2md xbrli:monetaryItemTypemi1276 s2md xbrli:monetaryItemTypesi1277 s2md xbrli:stringItemTypesi1278 s2md xbrli:stringItemTypesi1279 s2md xbrli:stringItemTypeei1280 s2md enum:enumerationItemType PC 1

Page 122: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ei1281 s2md enum:enumerationItemType PC 2ei1282 s2md enum:enumerationItemType PC 3pi1283 s2md num:percentItemTypepi1284 s2md num:percentItemTypepi1285 s2md num:percentItemTypepi1286 s2md num:percentItemTypepi1287 s2md num:percentItemTypepi1288 s2md num:percentItemTypepi1289 s2md num:percentItemTypepi1290 s2md num:percentItemTypepi1291 s2md num:percentItemTypepi1292 s2md num:percentItemTypepi1293 s2md num:percentItemTypepi1295 s2md num:percentItemTypepi1296 s2md num:percentItemTypepi1297 s2md num:percentItemTypepi1298 s2md num:percentItemTypepi1299 s2md num:percentItemTypepi1300 s2md num:percentItemTypepi1301 s2md num:percentItemTypepi1302 s2md num:percentItemTypepi1303 s2md num:percentItemTypepi1304 s2md num:percentItemTypepi1305 s2md num:percentItemTypesi1306 s2md xbrli:stringItemTypesi1307 s2md xbrli:integerItemTypeei1308 s2md enum:enumerationItemType PU 11ei1309 s2md enum:enumerationItemType PU 3ei1310 s2md enum:enumerationItemType PU 7ei1311 s2md enum:enumerationItemType PU 10si1312 s2md xbrli:stringItemTypesi1313 s2md xbrli:stringItemTypesi1314 s2md xbrli:stringItemTypeei1315 s2md enum:enumerationItemType SE 10ei1316 s2md enum:enumerationItemType SE 6ei1318 s2md enum:enumerationItemType SE 11si1319 s2md xbrli:stringItemTypesi1320 s2md xbrli:stringItemTypesi1321 s2md xbrli:stringItemTypesi1322 s2md xbrli:stringItemTypesi1323 s2md xbrli:stringItemTypesi1324 s2md xbrli:stringItemTypesi1325 s2md xbrli:stringItemTypesi1326 s2md xbrli:stringItemTypesi1327 s2md xbrli:stringItemTypesi1328 s2md xbrli:stringItemTypesi1329 s2md xbrli:stringItemTypesi1330 s2md xbrli:stringItemTypesi1331 s2md xbrli:stringItemTypesi1332 s2md xbrli:stringItemTypesi1333 s2md xbrli:stringItemType

Page 123: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

si1334 s2md xbrli:stringItemTypesi1336 s2md xbrli:stringItemTypesi1337 s2md xbrli:stringItemTypesi1338 s2md xbrli:stringItemTypesi1339 s2md xbrli:stringItemTypesi1340 s2md xbrli:stringItemTypesi1341 s2md xbrli:stringItemTypesi1342 s2md xbrli:stringItemTypesi1343 s2md xbrli:stringItemTypesi1344 s2md xbrli:stringItemTypesi1345 s2md xbrli:stringItemTypesi1346 s2md xbrli:stringItemTypesi1347 s2md xbrli:stringItemTypesi1348 s2md xbrli:stringItemTypesi1349 s2md xbrli:stringItemTypesi1350 s2md xbrli:stringItemTypesi1351 s2md xbrli:stringItemTypesi1352 s2md xbrli:stringItemTypesi1353 s2md xbrli:stringItemTypesi1354 s2md xbrli:stringItemTypesi1355 s2md xbrli:stringItemTypesi1356 s2md xbrli:stringItemTypesi1357 s2md xbrli:stringItemTypesi1358 s2md xbrli:stringItemTypesi1360 s2md xbrli:stringItemTypesi1361 s2md xbrli:stringItemTypesi1362 s2md xbrli:stringItemTypesi1363 s2md xbrli:stringItemTypesi1364 s2md xbrli:stringItemTypesi1365 s2md xbrli:stringItemTypesi1366 s2md xbrli:stringItemTypesi1367 s2md xbrli:stringItemTypesi1368 s2md xbrli:stringItemTypesi1369 s2md xbrli:stringItemTypesi1370 s2md xbrli:stringItemTypesi1371 s2md xbrli:stringItemTypesi1372 s2md xbrli:stringItemTypesi1373 s2md xbrli:stringItemTypesi1374 s2md xbrli:stringItemTypesi1375 s2md xbrli:stringItemTypesi1376 s2md xbrli:stringItemTypesi1377 s2md xbrli:stringItemTypesi1378 s2md xbrli:stringItemTypesi1379 s2md xbrli:stringItemTypesi1380 s2md xbrli:stringItemTypesi1381 s2md xbrli:stringItemTypesi1382 s2md xbrli:stringItemTypesi1383 s2md xbrli:stringItemTypesi1384 s2md xbrli:stringItemTypesi1385 s2md xbrli:stringItemTypesi1386 s2md xbrli:stringItemType

Page 124: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

si1387 s2md xbrli:stringItemTypesi1389 s2md xbrli:stringItemTypesi1392 s2md xbrli:stringItemTypesi1393 s2md xbrli:stringItemTypeei1394 s2md enum:enumerationItemType TB 7ei1395 s2md enum:enumerationItemType TB 6ei1396 s2md enum:enumerationItemType TB 8ei1397 s2md enum:enumerationItemType TB 2ei1398 s2md enum:enumerationItemType TB 5ei1399 s2md enum:enumerationItemType TB 4ei1400 s2md enum:enumerationItemType TB 3si1401 s2md xbrli:stringItemTypesi1402 s2md xbrli:stringItemTypeei1403 s2md enum:enumerationItemType VM 15ei1404 s2md enum:enumerationItemType VM 14ei1405 s2md enum:enumerationItemType VM 1ei1407 s2md enum:enumerationItemType SE 4mi1408 s2md xbrli:monetaryItemTypemi1409 s2md xbrli:monetaryItemTypemi1410 s2md xbrli:monetaryItemTypemi1411 s2md xbrli:monetaryItemTypemi1412 s2md xbrli:monetaryItemTypemi1413 s2md xbrli:monetaryItemTypemi1414 s2md xbrli:monetaryItemTypemi1415 s2md xbrli:monetaryItemTypemi1416 s2md xbrli:monetaryItemTypemi1417 s2md xbrli:monetaryItemTypemi1418 s2md xbrli:monetaryItemTypemi1419 s2md xbrli:monetaryItemTypemi1420 s2md xbrli:monetaryItemTypemi1421 s2md xbrli:monetaryItemTypemi1422 s2md xbrli:monetaryItemTypemi1423 s2md xbrli:monetaryItemTypemi1424 s2md xbrli:monetaryItemTypemi1425 s2md xbrli:monetaryItemTypemi1426 s2md xbrli:monetaryItemTypemi1427 s2md xbrli:monetaryItemTypemi1428 s2md xbrli:monetaryItemTypemi1429 s2md xbrli:monetaryItemTypemi1430 s2md xbrli:monetaryItemTypemi1431 s2md xbrli:monetaryItemTypemi1432 s2md xbrli:monetaryItemTypemi1433 s2md xbrli:monetaryItemTypemi1434 s2md xbrli:monetaryItemTypemi1435 s2md xbrli:monetaryItemTypemi1436 s2md xbrli:monetaryItemTypemi1437 s2md xbrli:monetaryItemTypemi1438 s2md xbrli:monetaryItemTypemi1439 s2md xbrli:monetaryItemTypemi1440 s2md xbrli:monetaryItemTypemi1441 s2md xbrli:monetaryItemType

Page 125: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi1442 s2md xbrli:monetaryItemTypemi1443 s2md xbrli:monetaryItemTypemi1444 s2md xbrli:monetaryItemTypemi1445 s2md xbrli:monetaryItemTypemi1446 s2md xbrli:monetaryItemTypemi1447 s2md xbrli:monetaryItemTypemi1448 s2md xbrli:monetaryItemTypemi1449 s2md xbrli:monetaryItemTypemi1450 s2md xbrli:monetaryItemTypemi1451 s2md xbrli:monetaryItemTypemi1452 s2md xbrli:monetaryItemTypemi1453 s2md xbrli:monetaryItemTypemi1454 s2md xbrli:monetaryItemTypemi1455 s2md xbrli:monetaryItemTypesi1456 s2md xbrli:stringItemTypemi1457 s2md xbrli:monetaryItemTypemi1458 s2md xbrli:monetaryItemTypesi1459 s2md xbrli:stringItemTypemi1460 s2md xbrli:monetaryItemTypemi1461 s2md xbrli:monetaryItemTypebi7 s2md xbrli:booleanItemTypesi1462 s2md xbrli:stringItemTypesi1463 s2md xbrli:stringItemTypesi1464 s2md xbrli:stringItemTypesi1465 s2md xbrli:stringItemTypesi1466 s2md xbrli:stringItemTypesi1467 s2md xbrli:stringItemTypesi1468 s2md xbrli:stringItemTypesi1469 s2md xbrli:stringItemTypesi1470 s2md xbrli:stringItemTypesi1471 s2md xbrli:stringItemTypesi1472 s2md xbrli:stringItemTypesi1473 s2md xbrli:stringItemTypesi1474 s2md xbrli:stringItemTypesi1475 s2md xbrli:stringItemTypesi1476 s2md xbrli:stringItemTypesi1477 s2md xbrli:stringItemTypesi1478 s2md xbrli:stringItemTypesi1479 s2md xbrli:stringItemTypesi1480 s2md xbrli:stringItemTypesi1481 s2md xbrli:stringItemTypesi1482 s2md xbrli:stringItemTypesi1483 s2md xbrli:stringItemTypesi1484 s2md xbrli:stringItemTypesi1485 s2md xbrli:stringItemTypesi1487 s2md xbrli:stringItemTypesi1488 s2md xbrli:stringItemTypesi1489 s2md xbrli:stringItemTypesi1490 s2md xbrli:stringItemTypesi1491 s2md xbrli:stringItemTypesi1493 s2md xbrli:stringItemType

Page 126: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

si1495 s2md xbrli:stringItemTypemi1496 s2md xbrli:monetaryItemTypemi1497 s2md xbrli:monetaryItemTypemi1498 s2md xbrli:monetaryItemTypemi1499 s2md xbrli:monetaryItemTypemi1500 s2md xbrli:monetaryItemTypemi1501 s2md xbrli:monetaryItemTypemi1502 s2md xbrli:monetaryItemTypeei1503 s2md enum:enumerationItemType GA 13si1504 s2md xbrli:stringItemTypeei1505 s2md enum:enumerationItemType CS 6ei1506 s2md enum:enumerationItemType CS 10ei1507 s2md enum:enumerationItemType GA 1ei1508 s2md enum:enumerationItemType GA 4ei1509 s2md enum:enumerationItemType GA 6ei1510 s2md enum:enumerationItemType LB 6ei1511 s2md enum:enumerationItemType LB 8ei1512 s2md enum:enumerationItemType LT 2ei1513 s2md enum:enumerationItemType LT 4ei1514 s2md enum:enumerationItemType PU 14ei1515 s2md enum:enumerationItemType PU 9ei1516 s2md enum:enumerationItemType PU 12ei1517 s2md enum:enumerationItemType SE 7ei1518 s2md enum:enumerationItemType SE 8ei1519 s2md enum:enumerationItemType VM 4mi1520 s2md xbrli:monetaryItemTypeei1521 s2md enum:enumerationItemType GA 13ti1522 s2md trueei1523 s2md enum:enumerationItemType CN 1ei1524 s2md enum:enumerationItemType CN 1ei1525 s2md enum:enumerationItemType CN 1ei1526 s2md enum:enumerationItemType CN 1ei1527 s2md enum:enumerationItemType CN 1ei1528 s2md enum:enumerationItemType CN 1ei1529 s2md enum:enumerationItemType CN 10ei1530 s2md enum:enumerationItemType CN 10ei1531 s2md enum:enumerationItemType CN 10ei1532 s2md enum:enumerationItemType CN 10ei1533 s2md enum:enumerationItemType CN 10ei1534 s2md enum:enumerationItemType CN 10ei1535 s2md enum:enumerationItemType CN 10ei1536 s2md enum:enumerationItemType CN 11ei1537 s2md enum:enumerationItemType CN 12ei1538 s2md enum:enumerationItemType CN 13ei1539 s2md enum:enumerationItemType CN 2ei1540 s2md enum:enumerationItemType CN 3ei1541 s2md enum:enumerationItemType CN 4ei1542 s2md enum:enumerationItemType CN 5ei1543 s2md enum:enumerationItemType CN 6ei1544 s2md enum:enumerationItemType CN 7ei1545 s2md enum:enumerationItemType CN 8

Page 127: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ei1546 s2md enum:enumerationItemType CN 9ui1547 s2md xbrli:anyURIItemTypeui1548 s2md xbrli:anyURIItemTypeei1549 s2md enum:enumerationItemType RT 10pi1550 s2md num:percentItemTypesi1551 s2md xbrli:stringItemTypesi1552 s2md xbrli:stringItemTypesi1553 s2md xbrli:stringItemTypesi1554 s2md xbrli:stringItemTypesi1555 s2md xbrli:stringItemTypesi1556 s2md xbrli:stringItemTypesi1557 s2md xbrli:stringItemTypesi1558 s2md xbrli:stringItemTypesi1559 s2md xbrli:stringItemTypesi1560 s2md xbrli:stringItemTypeei1561 s2md enum:enumerationItemType CU 2ei1562 s2md enum:enumerationItemType LB 24ei1563 s2md enum:enumerationItemType MC 5ei1564 s2md enum:enumerationItemType CU 1ei1565 s2md enum:enumerationItemType AM 1ei1566 s2md enum:enumerationItemType TB 5ei1567 s2md enum:enumerationItemType GA 1ei1568 s2md enum:enumerationItemType MC 3ei1569 s2md enum:enumerationItemType MC 3ei1570 s2md enum:enumerationItemType MC 3si1571 s2md xbrli:stringItemTypesi1572 s2md xbrli:stringItemTypesi1573 s2md xbrli:stringItemTypesi1574 s2md xbrli:stringItemTypesi1575 s2md xbrli:stringItemTypesi1576 s2md xbrli:stringItemTypesi1577 s2md xbrli:stringItemTypesi1578 s2md xbrli:stringItemTypesi1579 s2md xbrli:stringItemTypesi1580 s2md xbrli:stringItemTypesi1581 s2md xbrli:stringItemTypesi1582 s2md xbrli:stringItemTypesi1583 s2md xbrli:stringItemTypesi1584 s2md xbrli:stringItemTypesi1588 s2md xbrli:stringItemTypesi1589 s2md xbrli:stringItemTypesi1590 s2md xbrli:stringItemTypeii1591 s2md xbrli:integerItemTypeei1592 s2md enum:enumerationItemType MC 18pi1593 s2md num:percentItemTypesi1594 s2md xbrli:stringItemTypepi1596 s2md num:percentItemTypepi1597 s2md num:percentItemTypepi1598 s2md num:percentItemTypepi1599 s2md num:percentItemTypepi1600 s2md num:percentItemType

Page 128: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

pi1601 s2md num:percentItemTypepi1602 s2md num:percentItemTypepi1603 s2md num:percentItemTypepi1604 s2md num:percentItemTypemi1605 s2md xbrli:monetaryItemTypeei1606 s2md enum:enumerationItemType CG 8ui1607 s2md xbrli:anyURIItemTypeui1608 s2md xbrli:anyURIItemTypeui1609 s2md xbrli:anyURIItemTypesi1610 s2md xbrli:stringItemTypesi1611 s2md xbrli:stringItemTypesi1612 s2md xbrli:stringItemTypemi1613 s2md xbrli:monetaryItemTypemi1614 s2md xbrli:monetaryItemTypemi1615 s2md xbrli:monetaryItemTypemi1616 s2md xbrli:monetaryItemTypemi1617 s2md xbrli:monetaryItemTypemi1618 s2md xbrli:monetaryItemTypemi1619 s2md xbrli:monetaryItemTypemi1620 s2md xbrli:monetaryItemTypeei1621 s2md enum:enumerationItemType LT 1si1622 s2md xbrli:stringItemTypeei1623 s2md enum:enumerationItemType EL 7ei1624 s2md enum:enumerationItemType CS 2ei1625 s2md enum:enumerationItemType MC 20mi1626 s2md xbrli:monetaryItemTypemi1627 s2md xbrli:monetaryItemTypeei1628 s2md enum:enumerationItemType BR 2ei1629 s2md enum:enumerationItemType CS 2ei1630 s2md enum:enumerationItemType CS 2ei1631 s2md enum:enumerationItemType LT 1ei1632 s2md enum:enumerationItemType LT 1ei1633 s2md enum:enumerationItemType CN 2ei1634 s2md enum:enumerationItemType CN 1ei1635 s2md enum:enumerationItemType CN 3ei1636 s2md enum:enumerationItemType CN 1ei1637 s2md enum:enumerationItemType CN 4ei1638 s2md enum:enumerationItemType CN 5ei1639 s2md enum:enumerationItemType CN 6ei1640 s2md enum:enumerationItemType CN 1ei1641 s2md enum:enumerationItemType CN 7ei1642 s2md enum:enumerationItemType CN 8ei1643 s2md enum:enumerationItemType CN 9ei1644 s2md enum:enumerationItemType CN 10ei1645 s2md enum:enumerationItemType CN 10ei1646 s2md enum:enumerationItemType CN 10ei1647 s2md enum:enumerationItemType CN 10ei1648 s2md enum:enumerationItemType CN 10ei1649 s2md enum:enumerationItemType CN 10ei1650 s2md enum:enumerationItemType CN 10ei1651 s2md enum:enumerationItemType CN 11

Page 129: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ei1652 s2md enum:enumerationItemType CN 12ei1653 s2md enum:enumerationItemType CN 1ei1654 s2md enum:enumerationItemType CN 1ei1655 s2md enum:enumerationItemType CN 13ei1656 s2md enum:enumerationItemType CN 1ei1657 s2md enum:enumerationItemType AM 1ei1658 s2md enum:enumerationItemType NC 1mi1659 s2md xbrli:monetaryItemTypemi1660 s2md xbrli:monetaryItemTypemi1661 s2md xbrli:monetaryItemTypemi1662 s2md xbrli:monetaryItemTypemi1663 s2md xbrli:monetaryItemTypemi1664 s2md xbrli:monetaryItemTypemi1665 s2md xbrli:monetaryItemTypemi1666 s2md xbrli:monetaryItemTypemi1667 s2md xbrli:monetaryItemTypeei1668 s2md enum:enumerationItemType CN 14ei1669 s2md enum:enumerationItemType CN 81ei1670 s2md enum:enumerationItemType CN 16ei1671 s2md enum:enumerationItemType CN 17ei1672 s2md enum:enumerationItemType CN 18ei1673 s2md enum:enumerationItemType CN 19ei1674 s2md enum:enumerationItemType CN 20ei1675 s2md enum:enumerationItemType SE 13ei1676 s2md enum:enumerationItemType AP 3ei1677 s2md enum:enumerationItemType CS 12ei1678 s2md enum:enumerationItemType AP 4ei1679 s2md enum:enumerationItemType PU 15ei1680 s2md enum:enumerationItemType AP 5ei1681 s2md enum:enumerationItemType AP 6ei1682 s2md enum:enumerationItemType AP 7ei1683 s2md enum:enumerationItemType LA 1ei1684 s2md enum:enumerationItemType CS 13ei1685 s2md enum:enumerationItemType CS 14ei1686 s2md enum:enumerationItemType AM 10ei1687 s2md enum:enumerationItemType AM 11ei1688 s2md enum:enumerationItemType AP 8ei1689 s2md enum:enumerationItemType CS 15ei1690 s2md enum:enumerationItemType PU 16ei1691 s2md enum:enumerationItemType PU 17ei1692 s2md enum:enumerationItemType AP 11ei1693 s2md enum:enumerationItemType AP 9mi1694 s2md xbrli:monetaryItemTypeei1695 s2md enum:enumerationItemType CN 82ei1696 s2md enum:enumerationItemType CN 107ei1697 s2md enum:enumerationItemType CN 23ei1698 s2md enum:enumerationItemType CN 24ei1699 s2md enum:enumerationItemType CN 25ei1700 s2md enum:enumerationItemType CN 26ei1701 s2md enum:enumerationItemType CN 27ei1702 s2md enum:enumerationItemType CN 28

Page 130: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ei1703 s2md enum:enumerationItemType CN 29ei1704 s2md enum:enumerationItemType CN 28ei1705 s2md enum:enumerationItemType CN 29ei1706 s2md enum:enumerationItemType CN 83ei1707 s2md enum:enumerationItemType CN 31ei1708 s2md enum:enumerationItemType CN 84ei1709 s2md enum:enumerationItemType CN 33ei1710 s2md enum:enumerationItemType CN 34ei1711 s2md enum:enumerationItemType CN 35ei1712 s2md enum:enumerationItemType CN 36ei1713 s2md enum:enumerationItemType CN 37ei1714 s2md enum:enumerationItemType CN 38ei1715 s2md enum:enumerationItemType CN 15ei1716 s2md enum:enumerationItemType CN 39ei1717 s2md enum:enumerationItemType CN 40ei1718 s2md enum:enumerationItemType CN 30ei1719 s2md enum:enumerationItemType CN 30ei1720 s2md enum:enumerationItemType CN 30ei1721 s2md enum:enumerationItemType CN 41ei1722 s2md enum:enumerationItemType CN 41ei1723 s2md enum:enumerationItemType CN 42ei1724 s2md enum:enumerationItemType CN 32ei1725 s2md enum:enumerationItemType CN 32ei1726 s2md enum:enumerationItemType CN 32ei1727 s2md enum:enumerationItemType CN 32ei1728 s2md enum:enumerationItemType CN 32ei1729 s2md enum:enumerationItemType CN 32ei1730 s2md enum:enumerationItemType CN 32ei1731 s2md enum:enumerationItemType CN 43ei1732 s2md enum:enumerationItemType CN 44ei1733 s2md enum:enumerationItemType CN 44ei1734 s2md enum:enumerationItemType CN 45ei1735 s2md enum:enumerationItemType CN 45ei1736 s2md enum:enumerationItemType CN 1ei1737 s2md enum:enumerationItemType CN 1ei1738 s2md enum:enumerationItemType CN 15ei1739 s2md enum:enumerationItemType CN 46ei1740 s2md enum:enumerationItemType CN 47ei1741 s2md enum:enumerationItemType CN 48ei1742 s2md enum:enumerationItemType CN 49ei1743 s2md enum:enumerationItemType CN 50ei1744 s2md enum:enumerationItemType CN 51ei1745 s2md enum:enumerationItemType CN 52ei1746 s2md enum:enumerationItemType CN 51ei1747 s2md enum:enumerationItemType CN 52ei1748 s2md enum:enumerationItemType CN 51ei1749 s2md enum:enumerationItemType CN 52ei1750 s2md enum:enumerationItemType CN 51ei1751 s2md enum:enumerationItemType CN 52ei1752 s2md enum:enumerationItemType CN 51ei1753 s2md enum:enumerationItemType CN 52

Page 131: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ei1754 s2md enum:enumerationItemType CN 53ei1755 s2md enum:enumerationItemType CN 54ei1756 s2md enum:enumerationItemType CN 55ei1757 s2md enum:enumerationItemType CN 56ei1758 s2md enum:enumerationItemType CN 51ei1759 s2md enum:enumerationItemType CN 52ei1760 s2md enum:enumerationItemType CN 15ei1761 s2md enum:enumerationItemType CN 15ei1762 s2md enum:enumerationItemType CN 15ei1763 s2md enum:enumerationItemType CN 15ei1764 s2md enum:enumerationItemType CN 57ei1765 s2md enum:enumerationItemType CN 57ei1766 s2md enum:enumerationItemType CN 58ei1767 s2md enum:enumerationItemType CN 58ei1768 s2md enum:enumerationItemType CN 58ei1769 s2md enum:enumerationItemType CN 59ei1770 s2md enum:enumerationItemType CN 60ei1771 s2md enum:enumerationItemType CN 61ei1772 s2md enum:enumerationItemType CN 62ei1773 s2md enum:enumerationItemType CN 63ei1774 s2md enum:enumerationItemType CN 64ei1775 s2md enum:enumerationItemType CN 65ei1776 s2md enum:enumerationItemType CN 66ei1777 s2md enum:enumerationItemType CN 67ei1778 s2md enum:enumerationItemType CN 68ei1779 s2md enum:enumerationItemType PU 18si1780 s2md xbrli:stringItemTypeei1781 s2md enum:enumerationItemType MC 27si1782 s2md xbrli:stringItemTypemi1783 s2md xbrli:monetaryItemTypemi1784 s2md xbrli:monetaryItemTypemi1785 s2md xbrli:monetaryItemTypeei1786 s2md enum:enumerationItemType MC 26ei1787 s2md enum:enumerationItemType CU 4mi1788 s2md xbrli:monetaryItemTypemi1789 s2md xbrli:monetaryItemTypemi1790 s2md xbrli:monetaryItemTypemi1791 s2md xbrli:monetaryItemTypemi1792 s2md xbrli:monetaryItemTypeei1793 s2md enum:enumerationItemType CS 11mi1794 s2md xbrli:monetaryItemTypeei1795 s2md enum:enumerationItemType CS 11mi1808 s2md xbrli:monetaryItemTypemi1809 s2md xbrli:monetaryItemTypemi1810 s2md xbrli:monetaryItemTypeei1811 s2md enum:enumerationItemType PU 19mi1812 s2md xbrli:monetaryItemTypemi1813 s2md xbrli:monetaryItemTypeei1814 s2md enum:enumerationItemType LT 5mi1815 s2md xbrli:monetaryItemTypemi1816 s2md xbrli:monetaryItemType

Page 132: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ei1817 s2md enum:enumerationItemType MC 28ei1818 s2md enum:enumerationItemType MC 29ii1819 s2md xbrli:integerItemTypemi1820 s2md xbrli:monetaryItemTypeei1821 s2md enum:enumerationItemType LB 26ei1822 s2md enum:enumerationItemType MC 30ei1823 s2md enum:enumerationItemType PU 28mi1824 s2md xbrli:monetaryItemTypemi1825 s2md xbrli:monetaryItemTypemi1826 s2md xbrli:monetaryItemTypemi1827 s2md xbrli:monetaryItemTypemi1828 s2md xbrli:monetaryItemTypemi1829 s2md xbrli:monetaryItemTypemi1830 s2md xbrli:monetaryItemTypemi1831 s2md xbrli:monetaryItemTypemi1832 s2md xbrli:monetaryItemTypemi1833 s2md xbrli:monetaryItemTypeei1834 s2md enum:enumerationItemType MC 31ei1835 s2md enum:enumerationItemType LB 27ei1836 s2md enum:enumerationItemType LB 28ei1837 s2md enum:enumerationItemType PU 20ei1838 s2md enum:enumerationItemType CG 9di1839 s2md xbrli:dateItemTypedi1840 s2md xbrli:dateItemTypeii1841 s2md xbrli:integerItemTypeei1842 s2md enum:enumerationItemType LB 29mi1843 s2md xbrli:monetaryItemTypeei1844 s2md enum:enumerationItemType CG 7ei1845 s2md enum:enumerationItemType CG 7ei1846 s2md enum:enumerationItemType CG 7ei1847 s2md enum:enumerationItemType CG 7ei1848 s2md enum:enumerationItemType CG 7ei1849 s2md enum:enumerationItemType LB 30ei1850 s2md enum:enumerationItemType LB 31ei1851 s2md enum:enumerationItemType MC 32ei1852 s2md enum:enumerationItemType MC 33mi1853 s2md xbrli:monetaryItemTypeei1854 s2md enum:enumerationItemType TB 10bi1855 s2md xbrli:booleanItemTypemi1856 s2md xbrli:monetaryItemTypeei1857 s2md enum:enumerationItemType AP 12si1858 s2md xbrli:stringItemTypeei1859 s2md enum:enumerationItemType SE 14ei1860 s2md enum:enumerationItemType TB 11si1861 s2md xbrli:stringItemTypeei1862 s2md enum:enumerationItemType SE 15ei1863 s2md enum:enumerationItemType CS 16di1864 s2md xbrli:dateItemTypeei1865 s2md enum:enumerationItemType EL 13ei1866 s2md enum:enumerationItemType BR 3ei1867 s2md enum:enumerationItemType RT 13

Page 133: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ei1868 s2md enum:enumerationItemType RT 14ei1869 s2md enum:enumerationItemType PU 21ei1870 s2md enum:enumerationItemType SE 16ei1871 s2md enum:enumerationItemType TB 12ei1872 s2md enum:enumerationItemType TB 13ei1873 s2md enum:enumerationItemType SE 17ei1874 s2md enum:enumerationItemType LB 35pi1875 s2md num:percentItemTypepi1876 s2md num:percentItemTypepi1877 s2md num:percentItemTypepi1878 s2md num:percentItemTypepi1879 s2md num:percentItemTypepi1880 s2md num:percentItemTypepi1881 s2md num:percentItemTypepi1882 s2md num:percentItemTypepi1883 s2md num:percentItemTypepi1884 s2md num:percentItemTypeei1885 s2md enum:enumerationItemType AP 13ei1886 s2md enum:enumerationItemType CS 10ei1887 s2md enum:enumerationItemType MC 35ei1888 s2md enum:enumerationItemType MC 36ei1889 s2md enum:enumerationItemType MC 37ei1890 s2md enum:enumerationItemType TB 14ei1891 s2md enum:enumerationItemType NC 1ei1892 s2md enum:enumerationItemType EX 5ei1893 s2md enum:enumerationItemType VM 22ei1894 s2md enum:enumerationItemType LT 3ei1895 s2md enum:enumerationItemType EL 14ei1896 s2md enum:enumerationItemType AP 18pi1897 s2md num:percentItemTyperi1898 s2md xbrli:decimalItemTypesi1899 s2md xbrli:stringItemTypesi1900 s2md xbrli:stringItemTypesi1901 s2md xbrli:stringItemTypeei1902 s2md enum:enumerationItemType AP 14pi1903 s2md num:percentItemTypeei1904 s2md enum:enumerationItemType CU 5ei1905 s2md enum:enumerationItemType CU 5pi1906 s2md num:percentItemTypepi1907 s2md num:percentItemTypepi1908 s2md num:percentItemTypepi1909 s2md num:percentItemTyperi1910 s2md xbrli:decimalItemTypepi1911 s2md num:percentItemTypemi1912 s2md xbrli:monetaryItemTypemi1913 s2md xbrli:monetaryItemTypemi1914 s2md xbrli:monetaryItemTypemi1915 s2md xbrli:monetaryItemTypemi1916 s2md xbrli:monetaryItemTypemi1917 s2md xbrli:monetaryItemTypemi1918 s2md xbrli:monetaryItemType

Page 134: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi1919 s2md xbrli:monetaryItemTypemi1920 s2md xbrli:monetaryItemTypemi1921 s2md xbrli:monetaryItemTypemi1922 s2md xbrli:monetaryItemTypepi1923 s2md num:percentItemTypemi1924 s2md xbrli:monetaryItemTypemi1925 s2md xbrli:monetaryItemTypemi1926 s2md xbrli:monetaryItemTypemi1927 s2md xbrli:monetaryItemTypemi1928 s2md xbrli:monetaryItemTypemi1929 s2md xbrli:monetaryItemTypeei1930 s2md enum:enumerationItemType CU 5ei1931 s2md enum:enumerationItemType PU 23mi1932 s2md xbrli:monetaryItemTypemi1933 s2md xbrli:monetaryItemTypemi1934 s2md xbrli:monetaryItemTypemi1935 s2md xbrli:monetaryItemTypemi1936 s2md xbrli:monetaryItemTypemi1937 s2md xbrli:monetaryItemTypemi1938 s2md xbrli:monetaryItemTypemi1939 s2md xbrli:monetaryItemTypemi1940 s2md xbrli:monetaryItemTypemi1941 s2md xbrli:monetaryItemTypemi1942 s2md xbrli:monetaryItemTypemi1943 s2md xbrli:monetaryItemTypemi1944 s2md xbrli:monetaryItemTypemi1945 s2md xbrli:monetaryItemTypemi1946 s2md xbrli:monetaryItemTypemi1947 s2md xbrli:monetaryItemTypemi1949 s2md xbrli:monetaryItemTypemi1950 s2md xbrli:monetaryItemTypemi1951 s2md xbrli:monetaryItemTypemi1952 s2md xbrli:monetaryItemTypemi1955 s2md xbrli:monetaryItemTypemi1956 s2md xbrli:monetaryItemTypemi1957 s2md xbrli:monetaryItemTypemi1958 s2md xbrli:monetaryItemTypemi1959 s2md xbrli:monetaryItemTypeei1960 s2md enum:enumerationItemType GA 5ei1961 s2md enum:enumerationItemType TB 7ei1962 s2md enum:enumerationItemType AM 14si1963 s2md xbrli:stringItemTypemi1964 s2md xbrli:monetaryItemTypemi1965 s2md xbrli:monetaryItemTypemi1966 s2md xbrli:monetaryItemTypemi1967 s2md xbrli:monetaryItemTypemi1968 s2md xbrli:monetaryItemTypemi1969 s2md xbrli:monetaryItemTypemi1971 s2md xbrli:monetaryItemTypemi1972 s2md xbrli:monetaryItemTypemi1973 s2md xbrli:monetaryItemType

Page 135: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi1974 s2md xbrli:monetaryItemTypemi1975 s2md xbrli:monetaryItemTypemi1976 s2md xbrli:monetaryItemTypemi1977 s2md xbrli:monetaryItemTypemi1978 s2md xbrli:monetaryItemTypemi1979 s2md xbrli:monetaryItemTypemi1980 s2md xbrli:monetaryItemTypemi1981 s2md xbrli:monetaryItemTypemi1982 s2md xbrli:monetaryItemTypemi1983 s2md xbrli:monetaryItemTypemi1984 s2md xbrli:monetaryItemTypemi1985 s2md xbrli:monetaryItemTypemi1986 s2md xbrli:monetaryItemTypemi1987 s2md xbrli:monetaryItemTypemi1988 s2md xbrli:monetaryItemTypemi1989 s2md xbrli:monetaryItemTypemi1990 s2md xbrli:monetaryItemTypemi1991 s2md xbrli:monetaryItemTypemi1992 s2md xbrli:monetaryItemTypemi1993 s2md xbrli:monetaryItemTypemi1994 s2md xbrli:monetaryItemTypemi1995 s2md xbrli:monetaryItemTypesi1996 s2md xbrli:stringItemTypemi1997 s2md xbrli:monetaryItemTypemi1998 s2md xbrli:monetaryItemTypemi1999 s2md xbrli:monetaryItemTypemi2000 s2md xbrli:monetaryItemTypemi2001 s2md xbrli:monetaryItemTypemi2002 s2md xbrli:monetaryItemTypemi2003 s2md xbrli:monetaryItemTypemi2004 s2md xbrli:monetaryItemTypemi2005 s2md xbrli:monetaryItemTypemi2006 s2md xbrli:monetaryItemTypemi2007 s2md xbrli:monetaryItemTypemi2009 s2md xbrli:monetaryItemTypemi2010 s2md xbrli:monetaryItemTypemi2013 s2md xbrli:monetaryItemTypemi2014 s2md xbrli:monetaryItemTypemi2015 s2md xbrli:monetaryItemTypemi2016 s2md xbrli:monetaryItemTypemi2017 s2md xbrli:monetaryItemTypemi2018 s2md xbrli:monetaryItemTypemi2019 s2md xbrli:monetaryItemTypemi2020 s2md xbrli:monetaryItemTypemi2021 s2md xbrli:monetaryItemTypemi2022 s2md xbrli:monetaryItemTypemi2023 s2md xbrli:monetaryItemTypemi2024 s2md xbrli:monetaryItemTypemi2025 s2md xbrli:monetaryItemTypemi2026 s2md xbrli:monetaryItemTypemi2027 s2md xbrli:monetaryItemType

Page 136: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi2028 s2md xbrli:monetaryItemTypemi2029 s2md xbrli:monetaryItemTypemi2030 s2md xbrli:monetaryItemTypemi2031 s2md xbrli:monetaryItemTypemi2032 s2md xbrli:monetaryItemTypemi2033 s2md xbrli:monetaryItemTypemi2034 s2md xbrli:monetaryItemTypemi2035 s2md xbrli:monetaryItemTypemi2036 s2md xbrli:monetaryItemTypemi2037 s2md xbrli:monetaryItemTypemi2038 s2md xbrli:monetaryItemTypemi2039 s2md xbrli:monetaryItemTypemi2040 s2md xbrli:monetaryItemTypemi2041 s2md xbrli:monetaryItemTypemi2042 s2md xbrli:monetaryItemTypemi2043 s2md xbrli:monetaryItemTypemi2044 s2md xbrli:monetaryItemTypemi2045 s2md xbrli:monetaryItemTypemi2046 s2md xbrli:monetaryItemTypemi2047 s2md xbrli:monetaryItemTypemi2048 s2md xbrli:monetaryItemTypemi2049 s2md xbrli:monetaryItemTypemi2050 s2md xbrli:monetaryItemTypemi2051 s2md xbrli:monetaryItemTypemi2056 s2md xbrli:monetaryItemTypemi2057 s2md xbrli:monetaryItemTypesi2058 s2md xbrli:stringItemTypemi2060 s2md xbrli:monetaryItemTypemi2061 s2md xbrli:monetaryItemTypemi2062 s2md xbrli:monetaryItemTypesi2063 s2md xbrli:stringItemTypemi2064 s2md xbrli:monetaryItemTypemi2071 s2md xbrli:monetaryItemTypemi2073 s2md xbrli:monetaryItemTyperi2074 s2md xbrli:decimalItemTypemi2075 s2md xbrli:monetaryItemTypepi2076 s2md num:percentItemTypemi2077 s2md xbrli:monetaryItemTypemi2079 s2md xbrli:monetaryItemTypemi2082 s2md xbrli:monetaryItemTypemi2083 s2md xbrli:monetaryItemTypepi2084 s2md num:percentItemTypemi2085 s2md xbrli:monetaryItemTypemi2086 s2md xbrli:monetaryItemTypemi2087 s2md xbrli:monetaryItemTypemi2088 s2md xbrli:monetaryItemTypemi2089 s2md xbrli:monetaryItemTypemi2090 s2md xbrli:monetaryItemTypemi2091 s2md xbrli:monetaryItemTypemi2092 s2md xbrli:monetaryItemTypesi2093 s2md xbrli:stringItemType

Page 137: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi2095 s2md xbrli:monetaryItemTypemi2096 s2md xbrli:monetaryItemTypemi2099 s2md xbrli:monetaryItemTypemi2100 s2md xbrli:monetaryItemTypemi2101 s2md xbrli:monetaryItemTypemi2102 s2md xbrli:monetaryItemTypemi2103 s2md xbrli:monetaryItemTypeei2104 s2md enum:enumerationItemType CS 11mi2105 s2md xbrli:monetaryItemTypemi2106 s2md xbrli:monetaryItemTypesi2107 s2md xbrli:stringItemTypemi2108 s2md xbrli:monetaryItemTypemi2109 s2md xbrli:monetaryItemTypemi2110 s2md xbrli:monetaryItemTypemi2111 s2md xbrli:monetaryItemTypemi2112 s2md xbrli:monetaryItemTypemi2113 s2md xbrli:monetaryItemTypemi2114 s2md xbrli:monetaryItemTypemi2115 s2md xbrli:monetaryItemTypemi2116 s2md xbrli:monetaryItemTypemi2117 s2md xbrli:monetaryItemTypemi2118 s2md xbrli:monetaryItemTypemi2119 s2md xbrli:monetaryItemTypemi2120 s2md xbrli:monetaryItemTypemi2121 s2md xbrli:monetaryItemTypemi2122 s2md xbrli:monetaryItemTypemi2123 s2md xbrli:monetaryItemTypemi2124 s2md xbrli:monetaryItemTypemi2125 s2md xbrli:monetaryItemTypemi2126 s2md xbrli:monetaryItemTypemi2127 s2md xbrli:monetaryItemTypepi2128 s2md num:percentItemTypepi2129 s2md num:percentItemTypeei2130 s2md enum:enumerationItemType CN 15si2131 s2md xbrli:stringItemTypesi2132 s2md xbrli:stringItemTypesi2133 s2md xbrli:stringItemTypesi2134 s2md xbrli:stringItemTypeei2135 s2md enum:enumerationItemType GA 18ei2136 s2md enum:enumerationItemType GA 18ei2137 s2md enum:enumerationItemType SE 13ei2138 s2md enum:enumerationItemType AO 2ei2139 s2md enum:enumerationItemType PU 24ei2140 s2md enum:enumerationItemType PU 25si2141 s2md xbrli:stringItemTypesi2142 s2md xbrli:stringItemTypesi2143 s2md xbrli:stringItemTypemi2144 s2md xbrli:monetaryItemTypemi2145 s2md xbrli:monetaryItemTypemi2146 s2md xbrli:monetaryItemTypemi2147 s2md xbrli:monetaryItemType

Page 138: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi2148 s2md xbrli:monetaryItemTypemi2149 s2md xbrli:monetaryItemTypemi2150 s2md xbrli:monetaryItemTypemi2151 s2md xbrli:monetaryItemTypemi2153 s2md xbrli:monetaryItemTypemi2154 s2md xbrli:monetaryItemTypemi2155 s2md xbrli:monetaryItemTypemi2156 s2md xbrli:monetaryItemTypeei2157 s2md enum:enumerationItemType SE 18ei2158 s2md enum:enumerationItemType GA 18ei2159 s2md enum:enumerationItemType MC 39mi2160 s2md xbrli:monetaryItemTypemi2161 s2md xbrli:monetaryItemTypemi2162 s2md xbrli:monetaryItemTypemi2163 s2md xbrli:monetaryItemTypemi2164 s2md xbrli:monetaryItemTypeei2166 s2md enum:enumerationItemType CN 23ei2167 s2md enum:enumerationItemType CN 94ei2168 s2md enum:enumerationItemType CN 95ei2169 s2md enum:enumerationItemType CN 73ei2170 s2md enum:enumerationItemType CN 74ei2171 s2md enum:enumerationItemType CN 15ei2172 s2md enum:enumerationItemType CN 15ei2173 s2md enum:enumerationItemType CN 15ei2174 s2md enum:enumerationItemType CN 75ei2175 s2md enum:enumerationItemType CN 15pi2176 s2md num:percentItemTypeei2177 s2md enum:enumerationItemType CN 1ei2178 s2md enum:enumerationItemType CN 1si2179 s2md xbrli:stringItemTypeii2180 s2md xbrli:integerItemTypeei2181 s2md enum:enumerationItemType AP 15mi2182 s2md xbrli:monetaryItemTypemi2183 s2md xbrli:monetaryItemTypemi2184 s2md xbrli:monetaryItemTypemi2185 s2md xbrli:monetaryItemTypemi2186 s2md xbrli:monetaryItemTypemi2187 s2md xbrli:monetaryItemTypemi2188 s2md xbrli:monetaryItemTypemi2189 s2md xbrli:monetaryItemTypemi2190 s2md xbrli:monetaryItemTypemi2191 s2md xbrli:monetaryItemTypemi2192 s2md xbrli:monetaryItemTypemi2193 s2md xbrli:monetaryItemTypemi2194 s2md xbrli:monetaryItemTypemi2195 s2md xbrli:monetaryItemTypemi2196 s2md xbrli:monetaryItemTypemi2197 s2md xbrli:monetaryItemTypemi2198 s2md xbrli:monetaryItemTypemi2199 s2md xbrli:monetaryItemTypemi2200 s2md xbrli:monetaryItemType

Page 139: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi2201 s2md xbrli:monetaryItemTypedi2202 s2md xbrli:dateItemTypeei2203 s2md enum:enumerationItemType AP 16si2204 s2md xbrli:stringItemTypesi2205 s2md xbrli:stringItemTypemi2206 s2md xbrli:monetaryItemTypemi2208 s2md xbrli:monetaryItemTypesi2209 s2md xbrli:stringItemTypeei2210 s2md enum:enumerationItemType CN 96ei2211 s2md enum:enumerationItemType CN 96ei2212 s2md enum:enumerationItemType CN 77ei2213 s2md enum:enumerationItemType CN 78ei2214 s2md enum:enumerationItemType CN 79ei2215 s2md enum:enumerationItemType CN 79mi2216 s2md xbrli:monetaryItemTypemi2217 s2md xbrli:monetaryItemTypeei2218 s2md enum:enumerationItemType VM 23ei2219 s2md enum:enumerationItemType MC 48mi2220 s2md xbrli:monetaryItemTypeei2221 s2md enum:enumerationItemType PU 26ei2222 s2md enum:enumerationItemType PU 27mi2223 s2md xbrli:monetaryItemTypeei2224 s2md enum:enumerationItemType TB 16ei2225 s2md enum:enumerationItemType GA 5mi2228 s2md xbrli:monetaryItemTypemi2229 s2md xbrli:monetaryItemTypemi2230 s2md xbrli:monetaryItemTypemi2232 s2md xbrli:monetaryItemTypemi2233 s2md xbrli:monetaryItemTypemi2234 s2md xbrli:monetaryItemTypemi2235 s2md xbrli:monetaryItemTypemi2236 s2md xbrli:monetaryItemTypemi2237 s2md xbrli:monetaryItemTypemi2238 s2md xbrli:monetaryItemTypemi2239 s2md xbrli:monetaryItemTypemi2240 s2md xbrli:monetaryItemTypepi2241 s2md num:percentItemTypepi2242 s2md num:percentItemTypepi2243 s2md num:percentItemTypepi2244 s2md num:percentItemTypepi2245 s2md num:percentItemTypepi2246 s2md num:percentItemTypemi2247 s2md xbrli:monetaryItemTypemi2248 s2md xbrli:monetaryItemTypepi2249 s2md num:percentItemTypemi2250 s2md xbrli:monetaryItemTypeii2251 s2md xbrli:integerItemTypemi2252 s2md xbrli:monetaryItemTyperi2254 s2md xbrli:decimalItemTypemi2255 s2md xbrli:monetaryItemTypemi2256 s2md xbrli:monetaryItemType

Page 140: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi2257 s2md xbrli:monetaryItemTypemi2258 s2md xbrli:monetaryItemTypemi2259 s2md xbrli:monetaryItemTypemi2260 s2md xbrli:monetaryItemTypemi2261 s2md xbrli:monetaryItemTypemi2262 s2md xbrli:monetaryItemTypemi2263 s2md xbrli:monetaryItemTypemi2264 s2md xbrli:monetaryItemTyperi2265 s2md xbrli:decimalItemTyperi2266 s2md xbrli:decimalItemTyperi2267 s2md xbrli:decimalItemTyperi2268 s2md xbrli:decimalItemTyperi2269 s2md xbrli:decimalItemTyperi2270 s2md xbrli:decimalItemTypesi2271 s2md xbrli:stringItemTypesi2272 s2md xbrli:stringItemTypemi2273 s2md xbrli:monetaryItemTypemi2274 s2md xbrli:monetaryItemTypemi2275 s2md xbrli:monetaryItemTypemi2276 s2md xbrli:monetaryItemTypemi2277 s2md xbrli:monetaryItemTypemi2278 s2md xbrli:monetaryItemTypemi2279 s2md xbrli:monetaryItemTypemi2280 s2md xbrli:monetaryItemTypemi2281 s2md xbrli:monetaryItemTypemi2282 s2md xbrli:monetaryItemTypemi2283 s2md xbrli:monetaryItemTypemi2284 s2md xbrli:monetaryItemTypemi2285 s2md xbrli:monetaryItemTypemi2286 s2md xbrli:monetaryItemTypemi2287 s2md xbrli:monetaryItemTypemi2288 s2md xbrli:monetaryItemTypeei2289 s2md enum:enumerationItemType CN 80ei2290 s2md enum:enumerationItemType CN 82ei2291 s2md enum:enumerationItemType CN 85ei2292 s2md enum:enumerationItemType CN 86ei2293 s2md enum:enumerationItemType CG 11ei2294 s2md enum:enumerationItemType VM 24mi2295 s2md xbrli:monetaryItemTypeei2296 s2md enum:enumerationItemType CN 87ei2297 s2md enum:enumerationItemType CN 88ei2298 s2md enum:enumerationItemType CN 89ei2299 s2md enum:enumerationItemType CN 90ei2300 s2md enum:enumerationItemType CN 87mi2301 s2md xbrli:monetaryItemTypemi2302 s2md xbrli:monetaryItemTypeei2303 s2md enum:enumerationItemType CN 91ei2304 s2md enum:enumerationItemType CN 91ei2305 s2md enum:enumerationItemType CN 91mi2306 s2md xbrli:monetaryItemTypemi2307 s2md xbrli:monetaryItemType

Page 141: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi2308 s2md xbrli:monetaryItemTypemi2309 s2md xbrli:monetaryItemTypemi2310 s2md xbrli:monetaryItemTypemi2311 s2md xbrli:monetaryItemTypemi2312 s2md xbrli:monetaryItemTypemi2313 s2md xbrli:monetaryItemTypemi2314 s2md xbrli:monetaryItemTypemi2315 s2md xbrli:monetaryItemTypemi2316 s2md xbrli:monetaryItemTypemi2317 s2md xbrli:monetaryItemTypemi2318 s2md xbrli:monetaryItemTypemi2319 s2md xbrli:monetaryItemTypemi2320 s2md xbrli:monetaryItemTypemi2321 s2md xbrli:monetaryItemTypemi2322 s2md xbrli:monetaryItemTypemi2323 s2md xbrli:monetaryItemTypemi2324 s2md xbrli:monetaryItemTypemi2325 s2md xbrli:monetaryItemTypemi2326 s2md xbrli:monetaryItemTypemi2327 s2md xbrli:monetaryItemTypemi2328 s2md xbrli:monetaryItemTypemi2329 s2md xbrli:monetaryItemTypemi2330 s2md xbrli:monetaryItemTypemi2331 s2md xbrli:monetaryItemTypemi2332 s2md xbrli:monetaryItemTypemi2333 s2md xbrli:monetaryItemTypemi2334 s2md xbrli:monetaryItemTypemi2335 s2md xbrli:monetaryItemTypemi2336 s2md xbrli:monetaryItemTypemi2337 s2md xbrli:monetaryItemTypemi2338 s2md xbrli:monetaryItemTypemi2339 s2md xbrli:monetaryItemTypeei2340 s2md enum:enumerationItemType CN 15ei2341 s2md enum:enumerationItemType CN 15ei2342 s2md enum:enumerationItemType CN 92ei2343 s2md enum:enumerationItemType CN 93ei2344 s2md enum:enumerationItemType GA 26ei2345 s2md enum:enumerationItemType GA 18ei2346 s2md enum:enumerationItemType CS 20mi2347 s2md xbrli:monetaryItemTypemi2348 s2md xbrli:monetaryItemTypemi2349 s2md xbrli:monetaryItemTypemi2350 s2md xbrli:monetaryItemTypeei2351 s2md enum:enumerationItemType CN 15ei2352 s2md enum:enumerationItemType CN 15ei2353 s2md enum:enumerationItemType CN 1mi2354 s2md xbrli:monetaryItemTypemi2355 s2md xbrli:monetaryItemTypemi2356 s2md xbrli:monetaryItemTypemi2357 s2md xbrli:monetaryItemTypemi2358 s2md xbrli:monetaryItemType

Page 142: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

mi2359 s2md xbrli:monetaryItemTypemi2360 s2md xbrli:monetaryItemTypemi2361 s2md xbrli:monetaryItemTypemi2362 s2md xbrli:monetaryItemTypemi2363 s2md xbrli:monetaryItemTypemi2364 s2md xbrli:monetaryItemTypemi2365 s2md xbrli:monetaryItemTypemi2366 s2md xbrli:monetaryItemTypemi2367 s2md xbrli:monetaryItemTypemi2368 s2md xbrli:monetaryItemTypemi2369 s2md xbrli:monetaryItemTypemi2370 s2md xbrli:monetaryItemTypemi2371 s2md xbrli:monetaryItemTypemi2372 s2md xbrli:monetaryItemTypemi2373 s2md xbrli:monetaryItemTypemi2374 s2md xbrli:monetaryItemTypemi2375 s2md xbrli:monetaryItemTypemi2376 s2md xbrli:monetaryItemTypemi2377 s2md xbrli:monetaryItemTypemi2378 s2md xbrli:monetaryItemTypemi2379 s2md xbrli:monetaryItemTypemi2380 s2md xbrli:monetaryItemTypemi2381 s2md xbrli:monetaryItemTypemi2382 s2md xbrli:monetaryItemTypemi2383 s2md xbrli:monetaryItemTypemi2384 s2md xbrli:monetaryItemTypemi2385 s2md xbrli:monetaryItemTypemi2386 s2md xbrli:monetaryItemTypemi2387 s2md xbrli:monetaryItemTypemi2388 s2md xbrli:monetaryItemTypemi2389 s2md xbrli:monetaryItemTypeei2390 s2md enum:enumerationItemType AP 17ei2391 s2md enum:enumerationItemType AP 17ei2392 s2md enum:enumerationItemType AP 17ei2393 s2md enum:enumerationItemType AP 17ei2394 s2md enum:enumerationItemType AP 17ei2395 s2md enum:enumerationItemType AP 17ei2396 s2md enum:enumerationItemType AP 17ei2397 s2md enum:enumerationItemType AP 17ei2398 s2md enum:enumerationItemType AP 17ei2399 s2md enum:enumerationItemType AP 17ei2400 s2md enum:enumerationItemType AP 17ei2401 s2md enum:enumerationItemType AP 17ei2402 s2md enum:enumerationItemType AP 17ei2403 s2md enum:enumerationItemType AP 17ei2404 s2md enum:enumerationItemType AP 17ei2405 s2md enum:enumerationItemType AP 17ei2406 s2md enum:enumerationItemType AP 17ei2407 s2md enum:enumerationItemType AP 17si2408 s2md xbrli:stringItemTypemi2409 s2md xbrli:monetaryItemType

Page 143: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ei2410 s2md enum:enumerationItemType CN 97ei2411 s2md enum:enumerationItemType CN 98ei2412 s2md enum:enumerationItemType CN 99ei2413 s2md enum:enumerationItemType CN 100ei2414 s2md enum:enumerationItemType CN 100ei2415 s2md enum:enumerationItemType CN 101ei2416 s2md enum:enumerationItemType CN 102ei2417 s2md enum:enumerationItemType CN 103ei2418 s2md enum:enumerationItemType CN 104ei2419 s2md enum:enumerationItemType CN 105ei2420 s2md enum:enumerationItemType CN 106ei2421 s2md enum:enumerationItemType CN 105ei2422 s2md enum:enumerationItemType MC 50mi2423 s2md xbrli:monetaryItemTypepi2424 s2md num:percentItemTypeei2425 s2md enum:enumerationItemType LB 48ei2426 s2md enum:enumerationItemType PU 33ei2427 s2md enum:enumerationItemType PU 34mi2428 s2md xbrli:monetaryItemTypemi2429 s2md xbrli:monetaryItemTypemi2430 s2md xbrli:monetaryItemTypemi2431 s2md xbrli:monetaryItemTypemi2432 s2md xbrli:monetaryItemTypeei2433 s2md enum:enumerationItemType PU 37ei2434 s2md enum:enumerationItemType CN 108ei2435 s2md enum:enumerationItemType CN 109ei2436 s2md enum:enumerationItemType CN 110ei2437 s2md enum:enumerationItemType LB 50ei2438 s2md enum:enumerationItemType LB 51ei2439 s2md enum:enumerationItemType CN 111ri2440 s2md xbrli:decimalItemTyperi2441 s2md xbrli:decimalItemTyperi2442 s2md xbrli:decimalItemTypeei2443 s2md enum:enumerationItemType CN 112ei2444 s2md enum:enumerationItemType CN 113ei2445 s2md enum:enumerationItemType CN 113ei2446 s2md enum:enumerationItemType CN 114ei2447 s2md enum:enumerationItemType CN 114ei2448 s2md enum:enumerationItemType CN 114ei2449 s2md enum:enumerationItemType CN 115ei2450 s2md enum:enumerationItemType CN 115ei2451 s2md enum:enumerationItemType CN 116si2452 s2md xbrli:stringItemTypeei2453 s2md enum:enumerationItemType GA 1ei2454 s2md enum:enumerationItemType GA 1mi2455 s2md xbrli:monetaryItemTypeei2456 s2md enum:enumerationItemType CN 117ei2457 s2md enum:enumerationItemType CN 118ei2458 s2md enum:enumerationItemType CN 119ei2459 s2md enum:enumerationItemType CN 120ei2460 s2md enum:enumerationItemType CN 121

Page 144: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ei2461 s2md enum:enumerationItemType CN 39ii2462 s2md xbrli:integerItemTypeei2463 s2md enum:enumerationItemType CN 122ei2466 s2md enum:enumerationItemType GA 1ei2467 s2md enum:enumerationItemType GA 1si2468 s2md xbrli:stringItemTypesi2469 s2md xbrli:stringItemTypesi2470 s2md xbrli:stringItemTypesi2471 s2md xbrli:stringItemTypesi2472 s2md xbrli:stringItemTypesi2473 s2md xbrli:stringItemTypesi2474 s2md xbrli:stringItemTypesi2475 s2md xbrli:stringItemTypesi2476 s2md xbrli:stringItemTypesi2477 s2md xbrli:stringItemTypesi2478 s2md xbrli:stringItemTypemi2479 s2md xbrli:monetaryItemTypemi2480 s2md xbrli:monetaryItemTypemi2481 s2md xbrli:monetaryItemTypemi2482 s2md xbrli:monetaryItemTypeii2483 s2md xbrli:integerItemTypeei2484 s2md enum:enumerationItemType CN 123ei2485 s2md enum:enumerationItemType CN 123ei2486 s2md enum:enumerationItemType CN 123ei2487 s2md enum:enumerationItemType CN 123ei2489 s2md enum:enumerationItemType CN 124ei2490 s2md enum:enumerationItemType CN 125ei2491 s2md enum:enumerationItemType CN 124ei2492 s2md enum:enumerationItemType CN 125ei2493 s2md enum:enumerationItemType CN 124ei2494 s2md enum:enumerationItemType CN 125ei2495 s2md enum:enumerationItemType CN 124ei2496 s2md enum:enumerationItemType CN 125ei2497 s2md enum:enumerationItemType CN 124ei2498 s2md enum:enumerationItemType CN 125ei2499 s2md enum:enumerationItemType SE 21ei2500 s2md enum:enumerationItemType SE 22ei2501 s2md enum:enumerationItemType SE 23di2502 s2md xbrli:dateItemTypeei2503 s2md enum:enumerationItemType CS 21ei2504 s2md enum:enumerationItemType SE 24si2505 s2md xbrli:stringItemTypeei2506 s2md enum:enumerationItemType CN 126mi2507 s2md xbrli:monetaryItemTypesi2508 s2md xbrli:stringItemTypedi2509 s2md xbrli:dateItemTypeii2510 s2md xbrli:integerItemTypepi2511 s2md xbrli:decimalItemTypesi2512 s2md xbrli:stringItemType

Page 145: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Member Period type Creation date Validity dateinstant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014

Page 146: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Page 147: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Page 148: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015

Page 149: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014

Page 150: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014

Page 151: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014

Page 152: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014

Page 153: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014

Page 154: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014

Page 155: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Page 156: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 7/15/2016instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 7/15/2016

Page 157: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 7/15/2016instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 7/15/2016instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 7/15/2016instant 7/7/2014 7/15/2016instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015

Page 158: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Page 159: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Group instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013

Belonging to the same group instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014

Total/NA instant 7/7/2014Total/NA instant 7/7/2014 9/30/2015Total/NA instant 7/7/2014Total/NA instant 7/7/2014 12/31/2013

instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014

Page 160: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Total/NA instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Not applicable/All geographical areas instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014

Total/NA instant 7/7/2014Life and Health SLT instant 7/7/2014 12/31/2013Total/NA instant 7/7/2014Total/NA instant 7/7/2014 12/31/2013Total/NA instant 7/7/2014

instant 7/7/2014Total/NA instant 7/7/2014 12/31/2013

instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Structured notes and collateralised securities instant 7/7/2014 12/31/2013Closed instant 7/7/2014 12/31/2013Open instant 7/7/2014 9/30/2015Cost sharing, contingent liabilities [other than derivatives] and instant 7/7/2014 12/31/2013Derivatives instant 7/7/2014 12/31/2013Equity-type, debt and asset transfer instant 7/7/2014 12/31/2013

instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014

Page 161: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014

Page 162: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 7/15/2016instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Page 163: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014

Page 164: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Total/NA instant 7/7/2014 9/30/2015Total/NA instant 7/7/2014 9/30/2015Total/NA instant 7/7/2014 9/30/2015

instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Other than financial and credit institutions instant 7/7/2014 12/31/2013Total/NA instant 7/7/2014 12/31/2013Total/NA instant 7/7/2014 9/30/2015

instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014

Page 165: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014

Page 166: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014

Total/NA instant 7/7/2014 12/31/2013Total/NA instant 7/7/2014

instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Total/NA instant 7/7/2014 9/30/2015Total/NA instant 7/7/2014 9/30/2015Total/NA instant 7/7/2014 9/30/2015Reinsurance counterparties instant 7/7/2014 12/31/2013

instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015

Page 167: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Page 168: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014 7/15/2016instant 7/7/2014

Group instant 7/7/2014 9/30/2015Group instant 7/7/2014 9/30/2015Not applicable/All geographical areas instant 7/7/2014Not applicable/All geographical areas instant 7/7/2014Not applicable/All geographical areas instant 7/7/2014 12/31/2013

instant 7/7/2014 12/31/2013Total/NA instant 7/7/2014 12/31/2013

instant 7/7/2014 9/30/2015instant 7/7/2014

Total/NA instant 7/7/2014 9/30/2015Total/NA instant 7/7/2014 9/30/2015Total/NA instant 7/7/2014 9/30/2015Total/NA instant 7/7/2014 9/30/2015

instant 7/7/2014Total/NA instant 7/7/2014 9/30/2015

instant 7/7/2014instant 7/7/2014 7/15/2016instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Page 169: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Total/NA instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 7/15/2017instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Not applicable/All geographical areas instant 7/7/2014 12/31/2013Equity-type, debt and asset transfer instant 7/7/2014 12/31/2013Cost sharing, contingent liabilities [other than derivatives] and instant 7/7/2014 12/31/2013Derivatives instant 7/7/2014 12/31/2013

instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013

Page 170: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014 12/31/2013instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014 12/31/2013

Page 171: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/7/2014 12/31/2013instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 7/7/2014 9/30/2015instant 7/7/2014instant 7/7/2014instant 7/7/2014instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015 7/15/2017instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015

Page 172: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017instant 9/30/2015 7/15/2017

Page 173: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013

Page 174: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2017instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2017instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015

Page 175: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013

Page 176: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015

Page 177: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013

Page 178: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015

Page 179: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2017instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013

Page 180: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015

Page 181: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015

Page 182: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015

Page 183: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015

Page 184: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015 12/31/2013instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015

Page 185: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015instant 9/30/2015 7/15/2016instant 9/30/2015instant 9/30/2015 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016

Not applicable/All geographical areas instant 7/15/2016Not applicable/All geographical areas instant 7/15/2016

instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016instant 7/15/2016

Page 186: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

instant 7/15/2016instant 7/15/2016instant 7/15/2016

Not applicable/All geographical areas instant 7/15/2016Not applicable/All geographical areas instant 7/15/2016

instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017instant 7/15/2017

Page 187: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modified Count Hierarchy Name Sign Weight Owner

9/30/2015

9/30/2015

Page 188: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

Page 189: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

Page 190: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9/30/20159/30/20159/30/2015

9/30/20159/30/20159/30/20159/30/2015

Page 191: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9/30/20159/30/2015

9/30/2015

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9/30/20159/30/2015

Page 192: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9/30/2015

9/30/2015

7/15/2016

9/30/2015

Page 193: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/20159/30/20159/30/20157/15/2016

9/30/20159/30/2015

Page 194: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9/30/2015

9/30/20159/30/2015

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 195: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/2015

9/30/20159/30/2015

9/30/2015

9/30/20159/30/20159/30/2015

9/30/20159/30/20159/30/2015

9/30/20159/30/20159/30/2015

9/30/20159/30/2015

9/30/20159/30/20159/30/2015

9/30/20159/30/20159/30/2015

Page 196: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

Page 197: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 198: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

7/15/2016

Page 199: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2016

Page 200: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 201: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

9/30/2015

9/30/2015

Page 202: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

9/30/2015

9/30/2015

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

7/15/20167/15/20169/30/20159/30/20159/30/20159/30/2015

Page 203: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9/30/20157/15/2016

9/30/2015

9/30/2015

9/30/2015

9/30/20159/30/20159/30/2015

7/15/2016

7/15/20167/15/20169/30/20159/30/20159/30/20159/30/2015

Page 204: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/2015

9/30/2015

7/15/20169/30/2015

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20157/15/20167/15/20167/15/2016

9/30/2015

Page 205: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2016

9/30/20159/30/20157/15/20167/15/20167/15/20167/15/20167/15/20169/30/20157/15/20167/15/20167/15/20167/15/20169/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9/30/20159/30/20157/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/2016

Page 206: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/2015

9/30/20159/30/2015

9/30/20159/30/20159/30/2015

Page 207: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

9/30/2015

Page 208: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

9/30/2015

Page 209: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 210: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

9/30/2015

9/30/20159/30/2015

Page 211: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

Page 212: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/20159/30/20159/30/2015

9/30/2015

9/30/2015

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 213: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

7/15/2017

9/30/2015

9/30/2015

9/30/2015

Page 214: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2016

9/30/2015

Page 215: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 216: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2017

7/15/2017

7/15/2017

9/30/2015

Page 217: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/20167/15/2016

Page 218: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/20167/15/2016

9/30/2015

9/30/2015

7/15/20167/15/2016

9/30/2015

Page 219: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2016

9/30/20159/30/2015

9/30/2015

9/30/2015

9/30/2015

9/30/20157/15/20167/15/2016

7/15/20177/15/2017

7/15/20177/15/20177/15/20177/15/2017

9/30/20159/30/20159/30/20159/30/2015

Page 220: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/2015

7/15/20167/15/20167/15/2016

9/30/20159/30/20157/15/2016

7/15/2016

7/15/2016

7/15/2016

Page 221: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/20159/30/20159/30/20159/30/2015

7/15/2016

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 222: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/2015

9/30/2015

7/15/2017

Page 223: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/2015

9/30/20157/15/2017

9/30/20159/30/20159/30/2015

9/30/2015

Page 224: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/2015

9/30/20159/30/2015

7/15/20177/15/2016

9/30/2015

Page 225: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/20167/15/20167/15/2016

7/15/20167/15/20167/15/2016

7/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/2016

7/15/20167/15/2016

7/15/2016

7/15/2016

9/30/20159/30/20159/30/20159/30/20159/30/2015

Page 226: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9/30/2015

7/15/20179/30/2015

7/15/2016

Page 227: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/20177/15/2016

7/15/2017

Page 228: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2017

Page 229: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

LabelNAAbsolute floorAbsolute value after shockAbsolute value before shockAccident year [AY]Accrued interestsAccumulatedAcquisition price [per unit]Adjustment of valuation of assets held for unit-linked fundsAggregate deductiblesAverageAverage [arithmetic]Average [weighted]Balance of contractual amountBased on flat premium [Y]Before cappingCapCash in-flowsCash in-flows other than future premiumsCash out-flowsCollateralized valueCombinedContribution to the groupCurrent amountDifference between Solvency II and statutory accountDiscountedEnd amount of the intervalEstimated subjectEstimated treatyEstimationExcess/(shortage)ExpectedExpected [endogenous]Expected [external]Far legFloorFuture discretionary benefitsFuture expenses and cash out-flows other than guaranteed and discretionary benefitsFuture guaranteed and discretionary benefitsFuture guaranteed benefitsFuture premiumsFuture premiums other than profits included in future premiumsHistoricalHistorical [endogenous]Historical [external]IFRSInflow amountInitial amount approvedLimitLinear

Page 230: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Local GAAPMaximum coverMaximum loss under unwinding eventMaximum valueNear legNo capital requirementNon-cumulativeNot based on a flat premium [N]Not realizedNotionalNotional amountNotional amount [at transaction date]Original contractual amountOutflow amountPar amountPercentage [30%]Possible negativePremium paid/received to dateProfit and loss to dateProfits included in future premiumsProspectivePrudential other than Solvency IIRealizedRedemptions/prepayments/paybacksResult of transactionRetainedRetention or priorityRetrospectiveSectoralSolvency IISolvency II without accrued interestsSpecifiedStart amount of the intervalStatutory accountsStatutory accounts values adjusted for Solvency II valuation differencesSurrender valueTop-upsUnderwriting year [UWY]UndiscountedUnit priceRealized and not realizedMaximum cover per treatyAfter cappingOther than Solvency IIPrudentialReinsurance CommissionReinsurance Commission [Maximum]Reinsurance Commission [Minimum]Reinsurance Commission [Expected]Overriding CommissionOverriding Commission [Maximum]

Page 231: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Overriding Commission [Minimum]Overriding Commission [Expected]Profit CommissionProfit Commission [Maximum]Profit Commission [Minimum]Profit Commission [Expected]The undertaking is using IFRSThe undertaking is using local GAAP (other than IFRS)The group is using IFRSThe group is using local GAAP (other than IFRS)Collateralized assets valueCollateralized liabilities valueAcquisition valueLongevity,mortality and revision obligations cash outflowsExpenses cash outflowsDe-risked assets cash-flowsPositive undiscounted mismatchNegative undiscounted mismatchMarket valueSolvency IAmount of the adjustment to the technical provisions after any limitation applied in accordance to Article 308d (4) of the Directive 2009/138/ECTechnical provision after transitional on technical provisionsPremium paid to datePremium received to dateAmount subject to prior security interestsValue net of encumbrancePreferential claimValue net of preferential claimReclassification adjustmentsWrite-offs/write-downsAggregate maximum value per arrangementAmount where national supervisor could require standard formula reference even when undertakings is using internal models or partial internal model to calculAbsolute floor before considering article 253 of the Delegated Regulation (EU) 2015/35Amount after allocation from adjustments due to RFF and Matching adjustments portfoliosAmount calculated based on obligations

Page 232: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Default Owner Creation date Validity date Last modified datCount Commentx0 yes s2c 7/7/2014 1x1 s2c 7/7/2014 1x2 s2c 7/7/2014 1x3 s2c 7/7/2014 1x4 s2c 7/7/2014 1x5 s2c 7/7/2014 1x6 s2c 7/7/2014 1x7 s2c 7/7/2014 9/30/2015 9/30/2015 1x8 s2c 7/7/2014 1x9 s2c 7/7/2014 1x10 s2c 7/7/2014 1x11 s2c 7/7/2014 12/31/2013 1x12 s2c 7/7/2014 1x13 s2c 7/7/2014 1x14 s2c 7/7/2014 1x15 s2c 7/7/2014 1x16 s2c 7/7/2014 1x17 s2c 7/7/2014 12/31/2013 1x18 s2c 7/7/2014 1x19 s2c 7/7/2014 12/31/2013 1x20 s2c 7/7/2014 12/31/2013 1x21 s2c 7/7/2014 1x22 s2c 7/7/2014 1x23 s2c 7/7/2014 1x24 s2c 7/7/2014 1x25 s2c 7/7/2014 1x26 s2c 7/7/2014 1x27 s2c 7/7/2014 1x28 s2c 7/7/2014 1x29 s2c 7/7/2014 1x30 s2c 7/7/2014 1x31 s2c 7/7/2014 1x32 s2c 7/7/2014 1x33 s2c 7/7/2014 1x34 s2c 7/7/2014 1x35 s2c 7/7/2014 1x36 s2c 7/7/2014 1x37 s2c 7/7/2014 1x38 s2c 7/7/2014 1x39 s2c 7/7/2014 1x40 s2c 7/7/2014 1x41 s2c 7/7/2014 12/31/2013 1x42 s2c 7/7/2014 1x43 s2c 7/7/2014 1x44 s2c 7/7/2014 1x45 s2c 7/7/2014 2x46 s2c 7/7/2014 1x47 s2c 7/7/2014 1x48 s2c 7/7/2014 1x49 s2c 7/7/2014 1

Page 233: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x50 s2c 7/7/2014 2x51 s2c 7/7/2014 1x53 s2c 7/7/2014 1x54 s2c 7/7/2014 1x55 s2c 7/7/2014 1x56 s2c 7/7/2014 9/30/2015 1x57 s2c 7/7/2014 1x58 s2c 7/7/2014 1x59 s2c 7/7/2014 1x60 s2c 7/7/2014 1x61 s2c 7/7/2014 1x62 s2c 7/7/2014 1x63 s2c 7/7/2014 1x64 s2c 7/7/2014 1x65 s2c 7/7/2014 12/31/2013 1x66 s2c 7/7/2014 1x67 s2c 7/7/2014 1x68 s2c 7/7/2014 9/30/2015 1x69 s2c 7/7/2014 12/31/2013 1x70 s2c 7/7/2014 12/31/2013 1x71 s2c 7/7/2014 7/15/2016 1x72 s2c 7/7/2014 1x73 s2c 7/7/2014 1x74 s2c 7/7/2014 1x75 s2c 7/7/2014 1x76 s2c 7/7/2014 12/31/2013 1x77 s2c 7/7/2014 1x78 s2c 7/7/2014 7/15/2016 1x79 s2c 7/7/2014 1x80 s2c 7/7/2014 3x81 s2c 7/7/2014 1x82 s2c 7/7/2014 1x83 s2c 7/7/2014 1x84 s2c 7/7/2014 1x85 s2c 7/7/2014 1x86 s2c 7/7/2014 1x87 s2c 7/7/2014 1x88 s2c 7/7/2014 1x89 s2c 7/7/2014 1x90 s2c 7/7/2014 1x91 s2c 7/7/2014 1x92 s2c 7/7/2014 1x93 s2c 7/7/2014 1x94 s2c 7/7/2014 1x95 s2c 7/7/2014 1x96 s2c 7/7/2014 12/31/2013 1x97 s2c 7/7/2014 12/31/2013 1x98 s2c 7/7/2014 12/31/2013 1x99 s2c 7/7/2014 12/31/2013 1x100 s2c 7/7/2014 12/31/2013 1x101 s2c 7/7/2014 12/31/2013 1

Page 234: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x102 s2c 7/7/2014 12/31/2013 1x103 s2c 7/7/2014 12/31/2013 1x104 s2c 7/7/2014 12/31/2013 1x105 s2c 7/7/2014 12/31/2013 1x106 s2c 7/7/2014 12/31/2013 1x107 s2c 7/7/2014 12/31/2013 1x108 s2c 9/30/2015 12/31/2013 1x109 s2c 9/30/2015 12/31/2013 1x110 s2c 9/30/2015 12/31/2013 0x111 s2c 9/30/2015 12/31/2013 0x112 s2c 9/30/2015 1x113 s2c 9/30/2015 1x114 s2c 9/30/2015 7/15/2016 1x115 s2c 9/30/2015 1x116 s2c 9/30/2015 1x117 s2c 9/30/2015 1x118 s2c 9/30/2015 1x119 s2c 9/30/2015 1x120 s2c 9/30/2015 1x121 s2c 9/30/2015 2x122 s2c 9/30/2015 7/15/2017 1x123 s2c 9/30/2015 1x124 s2c 9/30/2015 1x125 s2c 9/30/2015 1x126 s2c 9/30/2015 1x127 s2c 9/30/2015 1x128 s2c 9/30/2015 1x129 s2c 9/30/2015 1x130 s2c 9/30/2015 1x131 s2c 9/30/2015 1x132 s2c 9/30/2015 1x133 s2c 7/15/2017 1x134 s2c 7/15/2017 1x135 s2c 7/15/2017 1x136 s2c 7/15/2017 1

Page 235: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name1: Valuation general

Statutory accounts x84IFRS x45Local GAAP x50

Prudential x95Solvency II x80

Accrued interests x5Solvency II without accrued interests x81

Prudential other than Solvency II x72Solvency I x121

Difference between Solvency II and statutory account x24Statutory accounts values adjusted for Solvency II valuation diffe x85Reclassification adjustments x130

2: Types of amountAverage x10

Average [weighted] x12Average [arithmetic] x11

Maximum value x54Unit price x90Acquisition value x114Acquisition price [per unit] x7Notional amount x61Maximum loss under unwinding event x53Outflow amount x64Inflow amount x46Collateralized value x20

Collateralized assets value x112Collateralized liabilities value x113

Excess/(shortage) x30Surrender value x86Non-cumulative x57Historical x42

Historical [external] x44Historical [endogenous] x43

Expected x31Expected [external] x33Expected [endogenous] x32

End amount of the interval x26Start amount of the interval x83Accumulated x6Retained x76Profit and loss to date x69Premium paid/received to date x68

Premium paid to date x124Premium received to date x125

Estimation x29Estimated subject x27Estimated treaty x28Aggregate deductibles x9Retention or priority x77

Page 236: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Limit x48Maximum cover per treaty x92Maximum cover x51Realized and not realized x91

Realized x73Not realized x59

Near leg x55Far leg x34Initial amount approved x47Current amount x23Possible negative x67Before capping x15Percentage [30%] x66After capping x93Specified x82Floor x35Linear x49Cap x16Combined x21Absolute floor x1Par amount x65Adjustment of valuation of assets held for unit-linked funds x8Balance of contractual amount x13

Original contractual amount x63Redemptions/prepayments/paybacks x74Top-ups x87

Result of transaction x75Notional amount [at transaction date] x62Contribution to the group x22Absolute value after shock x2Absolute value before shock x3Reinsurance Commission x96

Reinsurance Commission [Maximum] x97Reinsurance Commission [Minimum] x98Reinsurance Commission [Expected] x99

Overriding Commission x100Overriding Commission [Maximum] x101Overriding Commission [Minimum] x102Overriding Commission [Expected] x103

Profit Commission x104Profit Commission [Maximum] x105Profit Commission [Minimum] x106Profit Commission [Expected] x107

Market value x120Amount of the adjustment to the technical provisions after any li x122Technical provision after transitional on technical provisions x123Amount subject to prior security interests x126Value net of encumbrance x127Preferential claim x128Value net of preferential claim x129Write-offs/write-downs x131

Page 237: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Aggregate maximum value per arrangement x132Amount where national supervisor could require standard formula x133Absolute floor before considering article 253 of the Delegated Re x134Amount after allocation from adjustments due to RFF and Matchinx135Amount calculated based on obligations x136

3: Discounted or undiscountedDiscounted x25Undiscounted x89

4: Valuation of provisionsCash out-flows x19

Future guaranteed and discretionary benefits x38Future guaranteed benefits x39Future discretionary benefits x36

Future expenses and cash out-flows other than guaranteed and dx37Cash in-flows x17

Future premiums x40Profits included in future premiums x70Future premiums other than profits included in future premi x41

Cash in-flows other than future premiums x185: Prospective or retrospective

Prospective x71Retrospective x78

6: Type of capital requirementSectoral x79Notional x60No capital requirement x56

7: XL premiumsBased on flat premium [Y] x14Not based on a flat premium [N] x58

8: Applicable standardNA x0

Accident year [AY] x4Underwriting year [UWY] x88

9: Valuation generalSolvency II x80Other than Solvency II x94

10: Accounting standards (Individual)The undertaking is using IFRS x108The undertaking is using local GAAP (other than IFRS) x109

11: Accounting standardsIFRS x45Local GAAP x50

12: Projection of future cash flowLongevity,mortality and revision obligations cash outflows x115Expenses cash outflows x116De-risked assets cash-flows x117

13: Projection of future cash flowPositive undiscounted mismatch x118Negative undiscounted mismatch x119

14: Applicable standardSolvency I x121

Page 238: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Solvency II x80

Page 239: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy node label Sign Weight Owner Usable Applicable s2c VG

Statutory accountsIFRSLocal GAAPPrudentialSolvency II =Accrued interests +Solvency II without accrued interests +Prudential other than Solvency IISolvency IDifference between Solvency II and statutory accountStatutory accounts values adjusted for Solvency II valuation differencesReclassification adjustments

s2c TAAverageAverage [weighted]Average [arithmetic]Maximum valueUnit priceAcquisition valueAcquisition price [per unit]Notional amountMaximum loss under unwinding eventOutflow amountInflow amountCollateralized valueCollateralized assets valueCollateralized liabilities valueExcess/(shortage)Surrender valueNon-cumulativeHistoricalHistorical [external]Historical [endogenous]ExpectedExpected [external]Expected [endogenous]End amount of the intervalStart amount of the intervalAccumulatedRetainedProfit and loss to datePremium paid/received to datePremium paid to datePremium received to dateEstimationEstimated subjectEstimated treatyAggregate deductiblesRetention or priority

Page 240: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

LimitMaximum cover per treatyMaximum coverRealized and not realizedRealizedNot realizedNear legFar legInitial amount approvedCurrent amountPossible negativeBefore cappingPercentage [30%]After cappingSpecifiedFloorLinearCapCombinedAbsolute floorPar amountAdjustment of valuation of assets held for unit-linked fundsBalance of contractual amountOriginal contractual amountRedemptions/prepayments/paybacksTop-upsResult of transactionNotional amount [at transaction date]Contribution to the groupAbsolute value after shockAbsolute value before shockReinsurance Commission noReinsurance Commission [Maximum]Reinsurance Commission [Minimum]Reinsurance Commission [Expected]Overriding Commission noOverriding Commission [Maximum]Overriding Commission [Minimum]Overriding Commission [Expected]Profit Commission noProfit Commission [Maximum]Profit Commission [Minimum]Profit Commission [Expected]Market valueAmount of the adjustment to the technical provisions after any limitation applied in accordance to Article 308d (4) of Technical provision after transitional on technical provisionsAmount subject to prior security interestsValue net of encumbrancePreferential claimValue net of preferential claimWrite-offs/write-downs

Page 241: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Aggregate maximum value per arrangementAmount where national supervisor could require standard formula reference even when undertakings is using internal mAbsolute floor before considering article 253 of the Delegated Regulation (EU) 2015/35Amount after allocation from adjustments due to RFF and Matching adjustments portfoliosAmount calculated based on obligations

s2c DDDiscountedUndiscounted

s2c VPCash out-flowsFuture guaranteed and discretionary benefitsFuture guaranteed benefitsFuture discretionary benefitsFuture expenses and cash out-flows other than guaranteed and discretionary benefitsCash in-flowsFuture premiumsProfits included in future premiumsFuture premiums other than profits included in future premiumsCash in-flows other than future premiums

s2c ADProspectiveRetrospective

s2c N/A1 - Sectoral (for credit institutions, investment firms, financial institutions, alternative investment fund managers, U2 - Notional (for non-regulated undertakings)3 - No capital requirement

s2c N/A1 - XL premium based on a flat premium2 - XL premium not based on a flat premium

s2c AXno

1 – Accident year2 – Underwriting year

s2c VGSolvency IIOther than Solvency II

s2c AX1 - The undertaking is using IFRS2 - The undertaking is using local GAAP (other than IFRS)

s2c AX1 - IFRS2 - Local GAAP

s2c VPLongevity,mortality and revision obligations cash outflowsExpenses cash outflowsDe-risked assets cash-flows

s2c VPPositive undiscounted mismatchNegative undiscounted mismatch

s2c AXSolvency I

Page 242: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Solvency II

Page 243: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable s Creation date Validity date Last modified date Comment7/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/2014

9/30/20157/7/2014 7/15/20177/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/2014

9/30/2015 7/15/20167/7/2014 9/30/2015 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/2013

9/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 9/30/2015

9/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/2014

Page 244: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

9/30/2015Amount of the adjustment to the technical provisions after any limitation applied in accordance to Article 308d (4) of 9/30/2015 7/15/2017

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 245: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015Amount where national supervisor could require standard formula reference even when undertakings is using internal m 7/15/2017

7/15/20177/15/20177/15/2017

7/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/2014 7/15/20167/7/2014 7/15/20167/7/2014 7/15/2016

S.34.01 (201) 7/7/20141 - Sectoral (for credit institutions, investment firms, financial institutions, alternative investment fund managers, U 7/7/2014

7/7/20147/7/2014 9/30/2015

S.30.03 (201) 7/7/20147/7/20147/7/2014

S.16.01 (201), 7/7/2014 7/15/20177/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/2013

S.01.02 (201) 9/30/2015 9/30/20157/7/20147/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015 9/30/20159/30/2015

Page 246: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014

Page 247: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation dateNo x0 yes s2c 7/7/2014Yes x1 s2c 7/7/2014

Page 248: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity datLast modifi Count Comment Hierarchy Name Hierarchy nSign Weight2 1: Article 1122 No x0 2 – Regular reporting

Yes x1 1 – Article 112(7) reporting2: Article 167

Yes x1 1 – Article 167 is appliedNo x0 2 – Article 167 is not applied

Page 249: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Owner Usable Applicable Applicable sheets for drop Creation date Validity datLast modifieds2c AO S.25.01 (201), S.26.01 (201), 7/7/2014 7/15/2017

7/7/20147/7/2014

s2c N/A S.01.02 (201) 9/30/20157/7/20147/7/2014

Page 250: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Comment

Page 251: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

LabelTotal/NAFull internal modelPartial internal modelStandard formulaStandard formula or partial internal modelUse of undertaking specific parametersDon’t use undertaking specific parametersUse of volatility adjustmentNo use of volatility adjustmentUse of transitional measure on the risk-free interest rateNo use of transitional measure on the risk-free interest rateUse of transitional measure on technical provisionsNo use of transitional measure on technical provisionsUse of group specific parametersDon’t use group specific parametersRFF under article 304 – with the option for the equity risk sub-moduleRFF under article 304 – without the option for the equity risk sub-moduleRFF not under article 304Use of matching adjustmentUSP grossUSP netMaterialNot materialIndividual Internal ModelGroup Internal ModelFuture management actions regarding the loss-absorbing capacity of technical provisions embedded within the componentFuture management actions regarding the loss-absorbing capacity of deferred taxes embedded within the componentFuture management actions regarding the loss-absorbing capacity of technical provisions and deferred taxes embedded within the compoNo embedded consideration of future management actionsCompliance with fully-fundedNon-compliance with fully-fundedPrior to 31 December 2015After 31 December 2015Simplifications usedSimplifications not usedFull recalculationSimplification at risk sub-module levelSimplification at risk module levelNo adjustmentIncrease in the amount of annuity benefitsNoneStandard deviation for NSLT health premium riskStandard deviation for NSLT health gross premium riskAdjustment factor for non-proportional reinsuranceStandard deviation for NSLT health reserve riskStandard deviation for non-life premium riskStandard deviation for non-life gross premium riskStandard deviation for non-life reserve risk

Page 252: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Default Owner Creation date Validity datLast modifi Count Commentx0 yes s2c 7/7/2014 3x1 s2c 7/7/2014 3x2 s2c 7/7/2014 2x3 s2c 7/7/2014 2x4 s2c 7/7/2014 2x5 s2c 9/30/2015 1x6 s2c 9/30/2015 1x7 s2c 9/30/2015 2x8 s2c 9/30/2015 1x9 s2c 9/30/2015 2x10 s2c 9/30/2015 1x11 s2c 9/30/2015 2x12 s2c 9/30/2015 2x13 s2c 9/30/2015 1x14 s2c 9/30/2015 1x15 s2c 9/30/2015 1x16 s2c 9/30/2015 1x17 s2c 9/30/2015 1x18 s2c 9/30/2015 1x19 s2c 9/30/2015 1x20 s2c 9/30/2015 1x21 s2c 9/30/2015 1x22 s2c 9/30/2015 1x23 s2c 9/30/2015 1x24 s2c 9/30/2015 1x25 s2c 9/30/2015 1x26 s2c 9/30/2015 1x27 s2c 9/30/2015 1x28 s2c 9/30/2015 1x29 s2c 9/30/2015 1x30 s2c 9/30/2015 1x31 s2c 9/30/2015 1x32 s2c 9/30/2015 1x33 s2c 9/30/2015 1x34 s2c 9/30/2015 1x35 s2c 9/30/2015 1x36 s2c 9/30/2015 1x37 s2c 9/30/2015 1x38 s2c 9/30/2015 1x39 s2c 7/15/2017 3x40 s2c 7/15/2017 4x41 s2c 7/15/2017 2x42 s2c 7/15/2017 2x43 s2c 7/15/2017 3x44 s2c 7/15/2017 2x45 s2c 7/15/2017 2x46 s2c 7/15/2017 2x47 s2c 7/15/2017 2

Page 253: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name1: Standard or internal model

Total/NA x0Standard formula or partial internal model x4

Standard formula x3Partial internal model x2

Full internal model x12: Standard or internal model

Total/NA x0Standard formula or partial internal model x4Full internal model x1

3: Method of Calculation of the SCRStandard formula x3Partial internal model x2Full internal model x1

4: Use of undertaking specific parameters (Individual)Use of undertaking specific parameters x5Don’t use undertaking specific parameters x6

5: Volatility adjustmentUse of volatility adjustment x7No use of volatility adjustment x8

6: Transitional measure on the risk-free interest rateUse of transitional measure on the risk-free interest rate x9No use of transitional measure on the risk-free interest rate x10

7: Transitional measure on technical provisionsUse of transitional measure on technical provisions x11No use of transitional measure on technical provisions x12

8: Use of undertaking specific parameters (Group)Use of group specific parameters x13Don’t use group specific parameters x14

9: Article 304RFF under article 304 – with the option for the equity risk sub-modul x15RFF under article 304 – without the option for the equity risk sub-mo x16RFF not under article 304 x17

10: Transitional measure on technical provisionsTotal/NA x0

Use of transitional measure on technical provisions x11Use of transitional measure on the risk-free interest rate x9Use of volatility adjustment x7Use of matching adjustment x18

No use of transitional measure on technical provisions x1211: Material

Material x21Not material x22

12: USP Standard Deviation gross/netUSP gross x19USP net x20

13: Standard or internal modelIndividual Internal Model x23Group Internal Model x24

14: Future management actions regarding technical provisions and/or deferred taxes

Page 254: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Future management actions regarding the loss-absorbing capacity of x25Future management actions regarding the loss-absorbing capacity o x26Future management actions regarding the loss-absorbing capacity of x27No embedded consideration of future management actions x28

15: Compliance with fully funded requirement throughout the periodCompliance with fully-funded x29Non-compliance with fully-funded x30

16: Issues/ uses commenced prior to implementationPrior to 31 December 2015 x31After 31 December 2015 x32

17: Simplifications used/not usedSimplifications used x33Simplifications not used x34

18: Risk concentrationFull recalculation x35Simplification at risk sub-module level x36Simplification at risk module level x37No adjustment x38

19: USP - Life underwriting riskIncrease in the amount of annuity benefits x39None x40

20: USP - Health underwriting riskIncrease in the amount of annuity benefits x39Standard deviation for NSLT health premium risk x41Standard deviation for NSLT health gross premium risk x42Adjustment factor for non-proportional reinsurance x43Standard deviation for NSLT health reserve risk x44None x40

21: USP - Non life underwriting riskStandard deviation for non-life premium risk x45Standard deviation for non-life gross premium risk x46Adjustment factor for non-proportional reinsurance x43Standard deviation for non-life reserve risk x47None x40

22: USPIncrease in the amount of annuity benefits x39Standard deviation for NSLT health premium risk x41Standard deviation for NSLT health gross premium risk x42Adjustment factor for non-proportional reinsurance x43Standard deviation for NSLT health reserve risk x44Standard deviation for non-life premium risk x45Standard deviation for non-life gross premium risk x46Standard deviation for non-life reserve risk x47None x40

Page 255: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy node label Sign Weight Owners2c

Total/NA =Standard formula or partial internal model = +Standard formula +Partial internal model +Full internal model +

s2cTotal/NA =Standard formula or partial internal model +Full internal model +

s2c1 – Standard formula2 - Partial internal model3 - Full internal model

s2c1 - Use of undertaking specific parameters2 - Don’t use undertaking specific parameters

s2c1- Use of volatility adjustment2 - No use of volatility adjustment

s2c1 - Use of transitional measure on the risk-free interest rate2 - No use of transitional measure on the risk-free interest rate

s2c1 - Use of transitional measure on technical provisions2 - No use of transitional measure on technical provisions

s2c1 - Use of group specific parameters2 - Don’t use group specific parameters

s2c1 – RFF under article 304 – with the option for the equity risk sub-module2 – RFF under article 304 – without the option for the equity risk sub-module3 – RFF not under article 304

s2cTotal/NA =Use of transitional measure on technical provisions = +Use of transitional measure on the risk-free interest rate +Use of volatility adjustment +Use of matching adjustment +No use of transitional measure on technical provisions +

s2c1 – Material2 – Not material

s2c1 – USP gross2 – USP net

s2c1 – Individual Internal Model2 – Group Internal Model

14: Future management actions regarding technical provisions and/or deferred taxes s2c

Page 256: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1 – Future management actions regarding the loss-absorbing capacity of technical provisions embedded within the component2 – Future management actions regarding the loss-absorbing capacity of deferred taxes embedded within the component3 – Future management actions regarding the loss-absorbing capacity of technical provisions and deferred taxes embedded within the c4 – No embedded consideration of future management actions

s2c1 - Compliance with fully-funded2 – Non-compliance with fully-funded

s2c1 - Prior to 31 December 20152 - After 31 December 2015

s2c1 – Simplifications used2 – Simplifications not used

s2c1 - Full recalculation2 - Simplification at risk sub-module level3 - Simplification at risk module level4 - No adjustment

s2c1 - Increase in the amount of annuity benefits9 - None

s2c1 - Increase in the amount of annuity benefits2 - Standard deviation for NSLT health premium risk referred to in Title I Chapter V Section 12 of Delegated Regulation (EU) 2015/353 - Standard deviation for NSLT health gross premium risk referred to in Title I Chapter V Section 12 of Delegated Regulation (EU) 2015/354 - Adjustment factor for non-proportional reinsurance5 - Standard deviation for NSLT health reserve risk referred to in Title I Chapter V Section 12 of Delegated Regulation (EU) 2015/359 - None

s2c6 - Standard deviation for non-life premium risk7 - Standard deviation for non-life gross premium risk4 - Adjustment factor for non-proportional reinsurance8 - Standard deviation for non-life reserve risk9 - None

s2c1 - Increase in the amount of annuity benefits2 - Standard deviation for NSLT health premium risk3 - Standard deviation for NSLT health gross premium risk4 - Adjustment factor for non-proportional reinsurance5 - Standard deviation for NSLT health reserve risk6 - Standard deviation for non-life premium risk7 - Standard deviation for non-life gross premium risk8 - Standard deviation for non-life reserve risk9 - None

Page 257: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Usable Applicable Applicable Creation date Validity date Last modifi CommentII 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/2014

II 7/7/2014 9/30/20157/7/20147/7/20147/7/2014

II S.01.02 9/30/20157/7/20147/7/20147/7/2014

N/A S.01.02 9/30/20159/30/20159/30/2015

TF 9/30/20159/30/20159/30/2015

TF S.01.02 9/30/20159/30/20159/30/2015

TF S.01.02 (20 9/30/20159/30/20159/30/2015

N/A S.01.02 (20 9/30/20159/30/20159/30/2015

N/A S.01.03 (20 9/30/20159/30/20159/30/20159/30/2015

TF 9/30/20157/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/2015

MT S.01.03 (20 9/30/20159/30/20159/30/2015

N/A S.26.04 (201 9/30/20159/30/20159/30/2015

II S.33.01 (20 9/30/20159/30/20159/30/2015

N/A S.25.02 (201 9/30/2015

Page 258: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1 – Future management actions regarding the loss-absorbing capacity of technical provisions embedded within the component 9/30/20152 – Future management actions regarding the loss-absorbing capacity of deferred taxes embedded within the component 9/30/20153 – Future management actions regarding the loss-absorbing capacity of technical provisions and deferred taxes embedded within the c 9/30/2015

9/30/2015N/A 9/30/2015

9/30/20159/30/2015

N/A 9/30/20159/30/20159/30/2015

N/A S.26.01 (201 9/30/20159/30/20159/30/2015

N/A S.25.01 (201 9/30/20159/30/20159/30/20159/30/20159/30/2015

N/A S.25.01 (22 7/15/20177/15/20177/15/2017

N/A S.25.01 (22 7/15/20177/15/2017

2 - Standard deviation for NSLT health premium risk referred to in Title I Chapter V Section 12 of Delegated Regulation (EU) 2015/35 7/15/20173 - Standard deviation for NSLT health gross premium risk referred to in Title I Chapter V Section 12 of Delegated Regulation (EU) 2015/35 7/15/2017

7/15/20175 - Standard deviation for NSLT health reserve risk referred to in Title I Chapter V Section 12 of Delegated Regulation (EU) 2015/35 7/15/2017

7/15/2017N/A S.25.01 (22 7/15/2017

7/15/20177/15/20177/15/20177/15/20177/15/2017

N/A S.25.02 (22 7/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/2017

Page 259: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerNA x0 yes s2cAdditional item x1 s2cAnnual premium x2 s2cAssets x3 s2cAssets [of another entity] x4 s2cAssets and/or liabilities x5 s2cClaims incurred x6 s2cClaims paid x7 s2cClaims paid or due to be paid regarding surrender [full or partialx8 s2cCost of claims x9 s2cEconomical result x10 s2cEligible own funds in accordance with local rules x11 s2cExcess of assets over liabilities x12 s2cExcess of technical flow over technical provisions x13 s2cExpected profits included in future premiums x14 s2cExpenses x15 s2cExposure x16 s2cForeseeable dividends, distributions and charges x17 s2cGuarantees received [on- and off-balance] x18 s2cIncome x20 s2cLargest known accident risk concentration x21 s2cLargest liability limit provided x22 s2cLiability x23 s2cLocal capital requirement x24 s2cLocal minimum capital requirement x25 s2cLoss x26 s2cMinimum capital requirement [MCR] x27 s2cOff-balance sheet x28 s2cOff-balance sheet [of another entity] x29 s2cOwn funds x30 s2cPayments for reported but not settled claims [RBNS] x31 s2cPerformance x32 s2cPremium (paid)/received x33 s2cPremium income x34 s2cPremiums written x36 s2cProfit/(loss)[after tax] x37 s2cProjection of future cash flows x38 s2cReinsurance contract/treaty cover conditions x39 s2cReinsurance result x40 s2cRepo and securities lending x41 s2cReported but not settled claims [RBNS] x42 s2cRestricted own fund items due to ring fencing x43 s2cShareholder value x44 s2cSolvency capital requirement [SCR] x45 s2cSum insured x46 s2cTechnical flows x47 s2cTransaction x48 s2cUnderwriting performance x49 s2cValuation movements on financial liabilities and subordinated liax50 s2cValuation movements on investments x51 s2c

Page 260: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Valuation movements on own shares x52 s2cSum reinsured x53 s2cLiability and Off-balance sheet liabilities x54 s2cLoss given default x55 s2cPremium paid x56 s2cPremium received x57 s2cProfit/(loss) x58 s2cRepo x59 s2cSecurities lending x60 s2cRestricted own fund items due to ring fencing and matching portx61 s2cAssets applied to pay surrenders x62 s2cSurrended contracts x63 s2cPayments x64 s2cEquity x65 s2cAdjustment for restricted own fund items in respect of matchin x66 s2cMortality risk stress for the purpose of matching adjustment x67 s2cCounterparty assets ring-fenced to settle cedant-specific obligatx68 s2cNon ring-fenced, non cedant-specific counterparty assets for whx69 s2c

Page 261: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modified date Count Comment7/7/2014 07/7/2014 9/30/2015 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 9/30/2015 17/7/2014 17/7/2014 17/7/2014 9/30/2015 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 1

Page 262: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 1

9/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 12/31/2013 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 17/15/2016 17/15/2016 1

Page 263: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name Hierarchy n1: Basic concepts

Additional item x1 Additional itemAnnual premium x2 Annual premiumAssets x3 AssetsAssets and/or liabilities x5 Assets and/or liabilitiesClaims incurred x6 Claims incurredClaims paid x7 Claims paidClaims paid or due to be paid regarding surrender [full or partial] by policyhold x8 Claims paid or due to be paid regarding surrender [full or partial] by policyholdersCost of claims x9 Cost of claimsEconomical result x10 Economical resultEligible own funds in accordance with local rules x11 Eligible own funds in accordance with local rulesExcess of assets over liabilities x12 Excess of assets over liabilitiesExcess of technical flow over technical provisions x13 Excess of technical flow over technical provisionsExpected profits included in future premiums x14 Expected profits included in future premiumsExpenses x15 ExpensesExposure x16 ExposureForeseeable dividends, distributions and charges x17 Foreseeable dividends, distributions and chargesGuarantees received [on- and off-balance] x18 Guarantees received [on- and off-balance]Income x20 IncomeLargest known accident risk concentration x21 Largest known accident risk concentrationLargest liability limit provided x22 Largest liability limit providedLiability x23 LiabilityLocal capital requirement x24 Local capital requirementLocal minimum capital requirement x25 Local minimum capital requirementLoss x26 LossMinimum capital requirement [MCR] x27 Minimum capital requirement [MCR]Off-balance sheet x28 Off-balance sheetOwn funds x30 Own fundsPayments for reported but not settled claims [RBNS] x31 Payments for reported but not settled claims [RBNS]Performance x32 PerformancePremium (paid)/received x33 Premium (paid)/received

Premium paid x56 Premium paidPremium received x57 Premium received

Premium income x34 Premium incomePremiums written x36 Premiums writtenProfit/(loss)[after tax] x37 Profit/(loss)[after tax]Projection of future cash flows x38 Projection of future cash flowsReinsurance contract/treaty cover conditions x39 Reinsurance contract/treaty cover conditionsReinsurance result x40 Reinsurance resultRepo and securities lending x41 Repo and securities lending

Repo x59 RepoSecurities lending x60 Securities lending

Reported but not settled claims [RBNS] x42 Reported but not settled claims [RBNS]Restricted own fund items due to ring fencing x43 Restricted own fund items due to ring fencingShareholder value x44 Shareholder valueSolvency capital requirement [SCR] x45 Solvency capital requirement [SCR]Sum insured x46 Sum insuredSum reinsured x53 Sum reinsuredTechnical flows x47 Technical flowsTransaction x48 Transaction

Page 264: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Underwriting performance x49 Underwriting performanceValuation movements on financial liabilities and subordinated liabilities x50 Valuation movements on financial liabilities and subordinated liabilitiesValuation movements on investments x51 Valuation movements on investmentsValuation movements on own shares x52 Valuation movements on own sharesAssets [of another entity] x4 Assets [of another entity]Off-balance sheet [of another entity] x29 Off-balance sheet [of another entity]Liability and Off-balance sheet liabilities x54 Liability and Off-balance sheet liabilitiesLoss given default x55 Loss given defaultProfit/(loss) x58 Profit/(loss)Restricted own fund items due to ring fencing and matching portfolio x61 Restricted own fund items due to ring fencing and matching portfolioAssets applied to pay surrenders x62 Assets applied to pay surrendersSurrended contracts x63 Surrended contractsPayments x64 PaymentsEquity x65 EquityAdjustment for restricted own fund items in respect of matching adjustment porx66 Adjustment for restricted own fund items in respect of matching adjustment portfolios aMortality risk stress for the purpose of matching adjustment x67 Mortality risk stress for the purpose of matching adjustmentCounterparty assets ring-fenced to settle cedant-specific obligations x68 Counterparty assets ring-fenced to settle cedant-specific obligationsNon ring-fenced, non cedant-specific counterparty assets for which recourse max69 Non ring-fenced, non cedant-specific counterparty assets for which recourse may exist

Page 265: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Sign Weight Owner Usable Applicable dim Applicable sheet Creation dates2c BC 7/7/2014

Additional item 7/7/2014Annual premium 7/7/2014

7/7/2014Assets and/or liabilities 7/7/2014Claims incurred 7/7/2014Claims paid 7/7/2014Claims paid or due to be paid regarding surrender [full or partial] by policyholders 7/7/2014Cost of claims 7/7/2014Economical result 7/7/2014Eligible own funds in accordance with local rules 7/7/2014Excess of assets over liabilities 7/7/2014Excess of technical flow over technical provisions 7/7/2014Expected profits included in future premiums 7/7/2014

7/7/20147/7/2014

Foreseeable dividends, distributions and charges 7/7/2014Guarantees received [on- and off-balance] 7/7/2014

7/7/2014Largest known accident risk concentration 7/7/2014Largest liability limit provided 7/7/2014

7/7/2014Local capital requirement 7/7/2014Local minimum capital requirement 7/7/2014

7/7/2014Minimum capital requirement [MCR] 7/7/2014Off-balance sheet 7/7/2014Own funds 7/7/2014Payments for reported but not settled claims [RBNS] 7/7/2014Performance 7/7/2014Premium (paid)/received 7/7/2014Premium paid 9/30/2015Premium received 9/30/2015Premium income 7/7/2014Premiums written 7/7/2014Profit/(loss)[after tax] 7/7/2014Projection of future cash flows 7/7/2014Reinsurance contract/treaty cover conditions 7/7/2014Reinsurance result 7/7/2014Repo and securities lending 7/7/2014

9/30/2015Securities lending 9/30/2015Reported but not settled claims [RBNS] 7/7/2014Restricted own fund items due to ring fencing 7/7/2014Shareholder value 7/7/2014Solvency capital requirement [SCR] 7/7/2014Sum insured 7/7/2014Sum reinsured 7/7/2014Technical flows 7/7/2014Transaction 7/7/2014

Page 266: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Underwriting performance 7/7/2014Valuation movements on financial liabilities and subordinated liabilities 7/7/2014Valuation movements on investments 7/7/2014Valuation movements on own shares 7/7/2014Assets [of another entity] 7/7/2014Off-balance sheet [of another entity] 7/7/2014Liability and Off-balance sheet liabilities 7/7/2014Loss given default 7/7/2014Profit/(loss) 9/30/2015Restricted own fund items due to ring fencing and matching portfolio 9/30/2015Assets applied to pay surrenders 9/30/2015Surrended contracts 9/30/2015

9/30/20159/30/2015

Adjustment for restricted own fund items in respect of matching adjustment portfolios a 9/30/2015Mortality risk stress for the purpose of matching adjustment 9/30/2015Counterparty assets ring-fenced to settle cedant-specific obligations 7/15/2016Non ring-fenced, non cedant-specific counterparty assets for which recourse may exist 7/15/2016

Page 267: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modified datComment9/30/2015

9/30/2015

9/30/2015

9/30/2015

12/31/2013

12/31/2013

12/31/2013

12/31/2013

Page 268: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

12/31/2013

12/31/201312/31/2013

Page 269: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity datLast modifi Count CommentTotal/NA x0 yes s2c 7/7/2014 11 x1 s2c 7/7/2014 22 x2 s2c 7/7/2014 23 x3 s2c 7/7/2014 24 x4 s2c 7/7/2014 25 x5 s2c 7/7/2014 26 x6 s2c 7/7/2014 27 x7 s2c 7/7/2014 28 x8 s2c 7/7/2014 19 x9 s2c 7/7/2014 110 x10 s2c 7/7/2014 111 x11 s2c 7/7/2014 112 x12 s2c 7/7/2014 113 x13 s2c 7/7/2014 114 x14 s2c 7/7/2014 115 x15 s2c 7/7/2014 116 x16 s2c 7/7/2014 117 x17 s2c 7/7/2014 118 x18 s2c 7/7/2014 119 x19 s2c 7/7/2014 120 x20 s2c 7/7/2014 121 x21 s2c 7/7/2014 1Credit qualx22 s2c 9/30/2015 1Credit qualx23 s2c 9/30/2015 1Credit qualx24 s2c 9/30/2015 1Credit qualx25 s2c 9/30/2015 1Credit qualx26 s2c 9/30/2015 1Credit qualx27 s2c 9/30/2015 1Credit qualx28 s2c 9/30/2015 1No rating ax29 s2c 9/30/2015 1

Page 270: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name Hierarchy nSign Weight Owner Usable Applicable1: Number of bracket s2c NB, NZ

Total/NA x0 Total/NA =1 x1 1 +2 x2 2 +3 x3 3 +4 x4 4 +5 x5 5 +6 x6 6 +7 x7 7 +8 x8 8 +9 x9 9 +10 x10 10 +11 x11 11 +12 x12 12 +13 x13 13 +14 x14 14 +15 x15 15 +16 x16 16 +17 x17 17 +18 x18 18 +19 x19 19 +20 x20 20 +21 x21 21 +

2: Credit Quality Step (Preparatory scope) s2c QS1 x1 12 x2 23 x3 34 x4 45 x5 56 x6 67 x7 7

3: Credit Quality Step (Full scope) s2c QSCredit quality step 0 x22 0 - Credit quality step 0Credit quality step 1 x23 1 - Credit quality step 1Credit quality step 2 x24 2 - Credit quality step 2Credit quality step 3 x25 3 - Credit quality step 3Credit quality step 4 x26 4 - Credit quality step 4Credit quality step 5 x27 5 - Credit quality step 5Credit quality step 6 x28 6 - Credit quality step 6No rating available x29 9 - No rating available

Page 271: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable Creation date Validity date Last modified date Comment7/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

S.06.02 (201 9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 272: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation dateNA x0 yes s2c 7/7/2014Captives simplifications used, counterparty default risk x1 s2c 7/7/2014Captives simplifications used, health underwriting risk x2 s2c 7/7/2014Captives simplifications used, interest rate risk x3 s2c 7/7/2014Captives simplifications used, life underwriting risk x4 s2c 7/7/2014Captives simplifications used, market concentration risk x5 s2c 7/7/2014Captives simplifications used, premium and reserve risk x6 s2c 7/7/2014Captives simplifications used, spread risk x7 s2c 7/7/2014Simplifications for counterparty default risk used x8 s2c 7/7/2014Simplifications for disability-morbidity risk used x9 s2c 7/7/2014Simplifications for health disability-morbidity risk used x10 s2c 7/7/2014Simplifications for health expense risk used x11 s2c 7/7/2014Simplifications for health longevity risk used x12 s2c 7/7/2014Simplifications for health mortality risk used x13 s2c 7/7/2014Simplifications for lapse risk used x14 s2c 7/7/2014Simplifications for life catastrophe risk used x15 s2c 7/7/2014Simplifications for life expense risk used x16 s2c 7/7/2014Simplifications for longevity risk used x17 s2c 7/7/2014Simplifications for mortality risk used x18 s2c 7/7/2014Simplifications for SLT lapse risk used x19 s2c 7/7/2014Simplifications for spread risk used - bonds and loans x20 s2c 7/7/2014Elements of market risk covered by partial internal model x21 s2c 7/7/2014Elements of counterparty default risk covered by partial int x22 s2c 7/7/2014Elements of life underwriting risk covered by partial interna x23 s2c 7/7/2014Elements of health underwriting risk covered by partial inte x24 s2c 7/7/2014Elements of non-life underwriting risk covered by partial in x25 s2c 7/7/2014Elements of intangible asset risk covered by partial internal x26 s2c 7/7/2014Elements of operational risk covered by partial internal modx27 s2c 7/7/2014Simplifications for health disability-morbidity risk-income p x28 s2c 9/30/2015

Page 273: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modifi Count Comment Hierarchy0 1: Types of boolean

12/31/2013 1 Captives simplifications used, counterparty default r12/31/2013 1 Captives simplifications used, health underwriting ri12/31/2013 1 Captives simplifications used, interest rate risk12/31/2013 1 Captives simplifications used, life underwriting risk12/31/2013 1 Captives simplifications used, market concentration 12/31/2013 1 Captives simplifications used, premium and reserve 12/31/2013 1 Captives simplifications used, spread risk12/31/2013 1 Simplifications for counterparty default risk used12/31/2013 1 Simplifications for disability-morbidity risk used12/31/2013 1 Simplifications for health disability-morbidity risk u12/31/2013 1 Simplifications for health expense risk used12/31/2013 1 Simplifications for health longevity risk used12/31/2013 1 Simplifications for health mortality risk used12/31/2013 1 Simplifications for lapse risk used12/31/2013 1 Simplifications for life catastrophe risk used12/31/2013 1 Simplifications for life expense risk used12/31/2013 1 Simplifications for longevity risk used12/31/2013 1 Simplifications for mortality risk used12/31/2013 1 Simplifications for SLT lapse risk used12/31/2013 1 Simplifications for spread risk used - bonds and loan12/31/2013 1 Elements of market risk covered by partial internal12/31/2013 1 Elements of counterparty default risk covered by par12/31/2013 1 Elements of life underwriting risk covered by partial12/31/2013 1 Elements of health underwriting risk covered by part12/31/2013 1 Elements of non-life underwriting risk covered by pa12/31/2013 1 Elements of intangible asset risk covered by partial 12/31/2013 1 Elements of operational risk covered by partial inte12/31/2013 1 Simplifications for health disability-morbidity risk-

Page 274: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Hierarchy nSign Weight Owner Usable Applicable dimApplicable Creation dates2c BX 7/7/2014

x1 Captives simplifications used, counterparty default risk 7/7/2014x2 Captives simplifications used, health underwriting risk 7/7/2014x3 Captives simplifications used, interest rate risk 7/7/2014x4 Captives simplifications used, life underwriting risk 7/7/2014x5 Captives simplifications used, market concentration risk 7/7/2014x6 Captives simplifications used, premium and reserve risk 7/7/2014x7 Captives simplifications used, spread risk 7/7/2014x8 Simplifications for counterparty default risk used 7/7/2014x9 Simplifications for disability-morbidity risk used 7/7/2014x10 Simplifications for health disability-morbidity risk used 7/7/2014x11 Simplifications for health expense risk used 7/7/2014x12 Simplifications for health longevity risk used 7/7/2014x13 Simplifications for health mortality risk used 7/7/2014x14 Simplifications for lapse risk used 7/7/2014x15 Simplifications for life catastrophe risk used 7/7/2014x16 Simplifications for life expense risk used 7/7/2014x17 Simplifications for longevity risk used 7/7/2014x18 Simplifications for mortality risk used 7/7/2014x19 Simplifications for SLT lapse risk used 7/7/2014x20 Simplifications for spread risk used - bonds and loans 7/7/2014x21 Elements of market risk covered by partial internal model 7/7/2014x22 Elements of counterparty default risk covered by partial internal model 7/7/2014x23 Elements of life underwriting risk covered by partial internal model 7/7/2014x24 Elements of health underwriting risk covered by partial internal model 7/7/2014x25 Elements of non-life underwriting risk covered by partial internal model 7/7/2014x26 Elements of intangible asset risk covered by partial internal model 7/7/2014x27 Elements of operational risk covered by partial internal model 7/7/2014x28 Simplifications for health disability-morbidity risk-income protection used 9/30/2015

Page 275: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modifi Comment

12/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/201312/31/2013

Page 276: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerNot applicable / Expressed in (converted to) reporting currency x0 yes s2cExpressed in currency of denomination (not converted to reporting currency) x1 s2c

Page 277: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity datLast modifi Count Comment Hierarchy9/30/2015 1 1: Currency conversion approach9/30/2015 1 Not applicable / Expressed in (converted to) re

Expressed in currency of denomination (not co

Page 278: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Hierarchy nSign Weight Owner Usable Applicable Applicable Creation dates2c AF 9/30/2015

x0 2 - Reporting currency 9/30/2015x1 1 - Original currency 9/30/2015

Page 279: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity datLast modifiedComment7/15/20177/15/20167/15/2016

Page 280: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation dateTotal/NA x0 yes s2c 7/7/2014Acquisition x1 s2c 7/7/2014Administration x2 s2c 7/7/2014Administration, investments management, claims manx3 s2c 7/7/2014Claims management x4 s2c 7/7/2014Commissions x5 s2c 7/7/2014Dividends x6 s2c 7/7/2014Interests x7 s2c 7/7/2014Investment x8 s2c 7/7/2014Investment management x9 s2c 7/7/2014Investment other than dividends, rent and interests x10 s2c 7/7/2014Other than administration, investments management,x11 s2c 7/7/2014Other than commissions x12 s2c 7/7/2014Other than investment x13 s2c 7/7/2014Overhead x14 s2c 7/7/2014Rent x15 s2c 7/7/2014

Page 281: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modifi Count Comment Hierarchy Name Hierarchy n3 1: Types of income/expenses1 Total/NA x0 Total/NA1 Administration, investments ma x3 Administrat1 Administration x2 Administration1 Investment management x9 Investment managem1 Claims management x4 Claims management1 Acquisition x1 Acquisition1 Overhead x14 Overhead1 Other than administration, inv x11 Other than administra1 2: Types of income/expenses1 Total/NA x0 Total/NA1 Commissions x5 Commissions1 Other than commissions x12 Other than commissio1 3: Types of income/expenses1 Total/NA x0 Total/NA1 Investment x8 Investment

Dividends x6 DividendsRent x15 RentInterests x7 InterestsInvestment other than dividendsx10 Investment other than

Other than investment x13 Other than investmen

Page 282: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Sign Weight Owner Usable Applicable Applicable Creation date Validity dates2c TE 7/7/2014

= 7/7/2014= + 7/7/2014

Administration + 7/7/2014Investment managem+ 7/7/2014Claims management + 7/7/2014Acquisition + 7/7/2014

+ 7/7/2014Other than administra+ 7/7/2014

s2c TE 7/7/2014= 7/7/2014

Commissions + 7/7/2014Other than commissio+ 7/7/2014

s2c TE 7/7/2014= 7/7/2014= + 7/7/2014

+ 7/7/2014+ 7/7/2014+ 7/7/2014

Investment other than + 7/7/2014Other than investmen+ 7/7/2014

Page 283: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modified date Comment

Page 284: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation dateTotal/NA x0 yes s2c 7/7/2014Collateral x1 s2c 7/7/2014Collateral for reinsurance accepted [CR] x2 s2c 7/7/2014Collateral for securities borrowed [CB] x3 s2c 7/7/2014Collateral pledged [CP] x4 s2c 7/7/2014Collateralised x5 s2c 7/7/2014Collateralised/guaranteed x6 s2c 7/7/2014Full capital protection x7 s2c 7/7/2014Guaranteed x8 s2c 7/7/2014Guaranteed minimum accumulation benefit [GMAB] x9 s2c 7/7/2014Guaranteed minimum death benefit [GMDB] x10 s2c 7/7/2014Guaranteed minimum income benefit [GMIB] x11 s2c 7/7/2014Guaranteed minimum withdrawal benefits [GMWB] x12 s2c 7/7/2014No [N] x13 s2c 7/7/2014No capital protection x14 s2c 7/7/2014Not collateral x15 s2c 7/7/2014Not collateralised/guaranteed x16 s2c 7/7/2014Not sensitive [NS] x17 s2c 7/7/2014On policies x18 s2c 7/7/2014Other than on policies and not collateralised x19 s2c 7/7/2014Partial [P] x20 s2c 7/7/2014Partial capital protection x21 s2c 7/7/2014Repos [R] x22 s2c 7/7/2014SPV not sufficiently collateralised x23 s2c 7/7/2014SPV sufficiently collateralised x24 s2c 7/7/2014Yes [Y] x25 s2c 7/7/2014Collateralisation performed on a portfolio basis x26 s2c 7/7/2014Collateralisation performed on a single contract basis x27 s2c 7/7/2014Other x28 s2c 9/30/2015Encumbered x29 s2c 9/30/2015Unencumbered x30 s2c 9/30/2015No collateral x31 s2c 9/30/2015

Page 285: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modifi Count Comment Hierarchy3 1: Collateral/Guarantee

12/31/2013 0 Total/NA1 Collateralised/guaranteed1 Collateralised1 Guaranteed

12/31/2013 1 Not collateralised/guaranteed12/31/2013 1 2: Being collateral or not

1 Collateral pledged [CP]12/31/2013 1 Collateral for reinsurance accepted [CR]

2 Collateral for securities borrowed [CB]2 Repos [R]2 Not collateral2 3: Collateral1 Total/NA1 On policies1 Other than on policies and not collateralised

12/31/2013 1 4: SPV sufficiently collateralised or not1 SPV sufficiently collateralised

9/30/2015 1 SPV not sufficiently collateralised9/30/2015 1 5: Capital protection

1 Full capital protection1 Partial capital protection1 No capital protection1 6: Types of guarantee (Preparatory scope)1 Total/NA1 Guaranteed minimum death benefit [GMDB]2 Guaranteed minimum accumulation benefit [GMA2 Guaranteed minimum income benefit [GMIB]1 Guaranteed minimum withdrawal benefits [GMWB1 7: Hedge application1 Yes [Y]1 No [N]

Partial [P]Not sensitive [NS]

8: Collateral portfolioCollateralisation performed on a portfolio basisCollateralisation performed on a single contract basi

9: Types of guarantee (Full scope)Guaranteed minimum death benefit [GMDB]Guaranteed minimum accumulation benefit [GMAB]Guaranteed minimum income benefit [GMIB]Guaranteed minimum withdrawal benefits [GMWB]Other

10: EncumbranceEncumberedUnencumbered

11: Collateral portfolio (Full scope)Collateralisation performed on a portfolio basisCollateralisation performed on a single contract basiNo collateral

Page 286: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Hierarchy nSign Weight Owner Usable Applicables2c N/A

x0 Total/NA =x6 Collaterali = +x5 Collateralised +x8 Guaranteed +x16 Not collateralised/gu +

s2c N/Ax4 1 - Assets in the balance sheet that are collateral pledgedx2 2 - Collateral for reinsurance acceptedx3 3 - Collateral for securities borrowedx22 4 - Reposx15 9 - Not collateral

s2c N/Ax0 Total/NA =x18 On policies +x19 Other than on policies+

s2c N/Ax24 SPV sufficiently collateralisedx23 SPV not sufficiently collateralised

s2c N/Ax7 1 - Full capital protectionx21 2 - Partial capital protectionx14 3 - No capital protection

s2c N/Ax0 Total/NAx10 Guaranteed minimum death benefit [GMDB]x9 Guaranteed minimum accumulation benefit [GMAB]x11 Guaranteed minimum income benefit [GMIB]x12 Guaranteed minimum withdrawal benefits [GMWB]

s2c N/Ax25 1 – Hedgedx13 2 – Not hedgedx20 3 – Partially hedgedx17 4 – Guarantee not sensitive to

s2c N/Ax26 Collateralisation performed on a portfolio basisx27 Collateralisation performed on a single contract basis

s2c N/Ax10 1 - Guaranteed minimum death benefitx9 2 - Guaranteed minimum accumulation benefitx11 3 - Guaranteed minimum income benefitx12 4 - Guaranteed minimum withdrawal benefitsx28 9 - Other

s2c ENx29 Encumberedx30 Unencumbered

s2c N/Ax26 1 - Collateral calculated on the basis of net positions resulting from a set of contractsx27 2 - Collateral calculated on the basis of a single contractx31 10 – No collateral

Page 287: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable sheets for dropdowns Creation date Validity date Last modified date Comment7/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

S.06.02 (201), SE.06.02 (201) 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/2014 9/30/20157/7/20147/7/20147/7/2014

S.07.01 (201) 7/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014

S.15.02 (201) 7/7/20147/7/20147/7/20147/7/20147/7/2014

S.07.01 (201) 7/7/2014 9/30/20157/7/20147/7/2014

S.15.01 (201) 9/30/20157/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/20159/30/20159/30/2015

S.07.01 (201) 7/7/20141 - Collateral calculated on the basis of net positions resulting from a set of contracts 7/7/2014

7/7/2014

Page 288: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity datLast modifi CountTotal/NA x0 yes s2c 7/7/2014 1Minority interests x1 s2c 7/7/2014 1Controlling interests x2 s2c 7/7/2014 1

Page 289: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Comment Hierarchy1: Minority or controlling interests

Total/NAMinority interestsControlling interests

Page 290: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Hierarchy node label Sign Weight Owner Usable Applicable Applicable s2c LL

x0 Total/NA =x1 Minority interests +x2 Controlling interests +

Page 291: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity datLast modifi Comment7/7/20147/7/20147/7/20147/7/2014

Page 292: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerNot reported x0 yes s2cReported x1 s2cNot reported other reason x2 s2cNot reported o/a no derivative transactions x3 s2cNot reported o/a no life and health SLT business x4 s2cNot reported o/a materiality threshold x5 s2cNot reported o/a no non-life business x6 s2cNot reported o/a composite undertaking x7 s2cNot reported o/a non-composite undertaking x8 s2cNot reported o/a below threshold (of non-home currency tox9 s2cNot reported o/a full use of Standard Formula x10 s2cNot reported o/a use full internal model x11 s2cNot reported o/a use partial internal model x12 s2cNot reported as risk not existent x13 s2cNot reported o/a no non-(re)insurance business in the scox14 s2cNot reported as no RFF or MAP x15 s2cNot reported as refers to MAP fund x16 s2cNot reported as method 2 is used exclusively x17 s2cNot due in accordance with instructions of the template x19 s2cNot reported as no off-balance sheet items x20 s2cNot reported as no Collective investment undertakings x21 s2cExempted under Article 35 (6) to (8) x22 s2cNot due annually as reported for Quarter 4 x23 s2cNot due as S.06.02 and S.08.01 reported quarterly x25 s2cNot due as S.06.02 and S.08.01 reported annually x26 s2cNot reported as no unlimited guarantees received x27 s2cNot reported as no unlimited guarantees provided x28 s2cNot reported as no activity outside the home country x29 s2cNot reported as no activity outside the home country in relx30 s2cNot reported as no structured products x31 s2cNot reported as no Securities lending and repos x32 s2cNot reported as no Assets held as collateral x33 s2cNot reported as no variable annuities x34 s2cNot reported as no annuities stemming from Non-Life Insux35 s2cNot reported as no LTG measures or transitional are appli x36 s2cNot reported as no MA is applied x37 s2cNot reported as refers to RFF or remaining part x38 s2cNot reported as no such transitional measure is applied x39 s2cNot reported as no participations held x40 s2cNot reported as reported at RFF/MAP level x41 s2cNot reported as no simplified calculations used x42 s2cNot reported as no facultative covers x43 s2cNot reported as no reinsurance x44 s2cNot reported as no Special Purpose Insurance Vehicles x45 s2cNot reported as no IGT on Equity-type transactions, debt ax46 s2cNot reported as no parent undertaking is a mixed-activity x47 s2cNot reported as no IGT on Derivatives x48 s2cNot reported as no IGT on Internal reinsurance x49 s2cNot reported as no IGT on Cost Sharing, contingent liabilitx50 s2cNot due in accordance with threshold decided by group sux51 s2c

Page 293: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Full recalculation x52 s2cSimplification at risk sub-module level x53 s2cSimplification at risk module level x54 s2cNo adjustment x55 s2cLife company without pension entitlements x56 s2cNot reported in Q1 and Q3 x57 s2cNot reported as volatility adjustment not applied x58 s2cReported as standard formula is used x59 s2cReported due to article 112 request x60 s2cNot reported as both life and non-life insurance or reinsurx61 s2cNot reported as only life or only non-life insurance or reinx62 s2cExempted under Article 254(2) x63 s2cNot reported as no RFF/MAP or no life and health SLT busx64 s2cNot reported as no RFF/MAP or no non-life business x65 s2cNot reported as no pension entitlements x66 s2cExempted under Guideline 48 x67 s2cNot due in accordance with article 9 of this Regulation x68 s2cExempted under Article 35 (6) to (8) or Guideline 48 x69 s2cNot reported as no direct insurance business x70 s2cReported twice due to use of PIM x71 s2c

Page 294: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modified Count Comment7/7/2014 67/7/2014 1197/7/2014 1147/7/2014 47/7/2014 67/7/2014 27/7/2014 77/7/2014 17/7/2014 17/7/2014 17/7/2014 47/7/2014 167/7/2014 147/7/2014 9/30/2015 57/7/2014 1

9/30/2015 49/30/2015 29/30/2015 149/30/2015 169/30/2015 19/30/2015 79/30/2015 149/30/2015 7/15/2017 149/30/2015 7/15/2017 19/30/2015 7/15/2017 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 69/30/2015 49/30/2015 39/30/2015 19/30/2015 19/30/2015 19/30/2015 29/30/2015 19/30/2015 19/30/2015 19/30/2015 89/30/2015 29/30/2015 19/30/2015 49/30/2015 19/30/2015 29/30/2015 49/30/2015 29/30/2015 29/30/2015 29/30/2015 1

Page 295: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015 12/31/2013 19/30/2015 12/31/2013 19/30/2015 12/31/2013 19/30/2015 12/31/2013 19/30/2015 9/30/2015 29/30/2015 19/30/2015 29/30/2015 7/15/2016 29/30/2015 109/30/2015 19/30/2015 19/30/2015 129/30/2015 19/30/2015 19/30/2015 19/30/2015 147/15/2016 17/15/2016 07/15/2017 47/15/2017 6

Page 296: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy1: Content

ReportedNot reported

2: Basic InformationReported

3: Assets and liabilities by currencyReportedNot reported o/a below threshold (of non-home currency total being <10% of assets and liabilities)Not reported other reason

4: Open derivativesReportedNot reported o/a no derivative transactionsNot reported other reason

5: Life and Health SLT Technical Provisions (Preparatory scope)ReportedNot reported o/a no life and health SLT businessNot reported o/a materiality thresholdNot reported other reason

6: Non-Life Technical Provisions (Preparatory scope)ReportedNot reported o/a no non-life businessNot reported o/a materiality thresholdNot reported other reason

7: Solvency Capital Requirement - SF (Preparatory scope)ReportedNot reported o/a use full internal modelNot reported other reason

8: Solvency Capital Requirement - PIM (Preparatory scope)ReportedNot reported o/a use full internal modelNot reported o/a full use of Standard FormulaNot reported other reason

9: Solvency Capital Requirement - IM (Preparatory scope)ReportedNot reported o/a use partial internal modelNot reported o/a full use of Standard FormulaNot reported other reason

10: Solvency Capital Requirement (Preparatory scope)ReportedNot reported o/a use full internal modelNot reported as risk not existentNot reported other reason

11: Minimum Capital RequirementReportedNot reported o/a composite undertakingNot reported other reason

12: Minimum Capital Requirement - CompositeReportedNot reported o/a non-composite undertakingNot reported other reason

Page 297: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

13: Non-(re)insurance individual requirementsReportedNot reported o/a no non-(re)insurance business in the scope of the groupNot reported other reason

14: Basic Information - RFF and matching adjustment portfolios (Full scope individual)ReportedNot reported as no RFF or MAPNot reported other reason

15: ContentReportedNot reported other reason

16: Balance Sheet (Full scope group)ReportedExempted under Article 254(2)Not reported as method 2 is used exclusivelyNot reported other reason

17: Basic Information - RFF and matching adjustment portfolios (Full scope group)ReportedNot reported as no RFF or MAPNot reported as method 2 is used exclusivelyNot reported other reason

18: Assets and liabilities by currency (Full scope individual)ReportedNot due in accordance with instructions of the templateNot reported other reason

19: Assets and liabilities by currency (Full scope group)ReportedNot due in accordance with instructions of the templateNot reported as method 2 is used exclusivelyNot reported other reason

20: Off-balance sheet items - generalReportedNot reported as no off-balance sheet itemsNot reported other reason

23: List of assets (Full scope individual)ReportedExempted under Article 35 (6) to (8)Not due annually as reported for Quarter 4Not reported other reason

24: List of assets (Full scope group)ReportedExempted under Article 254(2)Not due annually as reported for Quarter 4Not reported other reason

25: Collective investment undertakings - look-through approach (Individual)ReportedNot reported as no Collective investment undertakingsExempted under Article 35 (6) to (8)Not due annually as reported for Quarter 4Not reported other reason

26: Collective investment undertakings - look-through approach (Group)

Page 298: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ReportedNot reported as no Collective investment undertakingsExempted under Article 254(2)Not due annually as reported for Quarter 4Not reported other reason

27: Summary of AssetsReportedNot due as S.06.02 and S.08.01 reported quarterlyNot due as S.06.02 and S.08.01 reported annuallyNot reported other reason

28: Open derivatives (Full scope individual)ReportedNot reported o/a no derivative transactionsExempted under Article 35 (6) to (8)Not due annually as reported for Quarter 4Not reported other reason

29: Open derivatives (Full scope group)ReportedNot reported o/a no derivative transactionsExempted under Article 254(2)Not due annually as reported for Quarter 4Not reported other reason

30: Life and Health SLT Technical Provisions (Full scope)ReportedNot reported o/a no life and health SLT businessNot reported other reason

31: Life and Health SLT Technical Provisions (Full scope by country)ReportedNot reported o/a no life and health SLT businessNot due in accordance with instructions of the templateNot reported other reason

32: Non-Life Technical Provisions (Full scope)ReportedNot reported o/a no non-life businessNot reported other reason

33: Non-Life Technical Provisions (Full scope)ReportedNot reported o/a no non-life businessNot due in accordance with instructions of the templateNot reported as no direct insurance businessNot reported other reason

34: Off-balance sheet items - List of unlimited guarantees received by the undertakingReportedNot reported as no unlimited guarantees receivedNot reported other reason

35: Off-balance sheet items - List of unlimited guarantees provided by the undertakingReportedNot reported as no unlimited guarantees providedNot reported other reason

36: Activity by countryReported

Page 299: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Not reported as no activity outside the home countryNot reported other reason

37: Information on class 10 in Part A of Annex I of Solvency II Directive, excluding carrier's liabilityReportedNot reported as no activity outside the home country in relation to specific classNot reported as no direct insurance businessNot reported other reason

38: Structured productsReportedNot reported as no structured productsExempted under Article 35 (6) to (8)Not reported other reason

39: Securities lending and repos (Individual and group)ReportedNot reported as no Securities lending and reposNot due in accordance with instructions of the templateExempted under Article 35 (6) to (8)Not reported other reason

40: Assets held as collateralReportedNot reported as no Assets held as collateralExempted under Article 35 (6) to (8)Not reported other reason

41: Description of the guarantees of variable annuities and Hedging of guarantees of variable annuitiesReportedNot reported as no variable annuitiesNot reported as no direct insurance businessNot reported other reason

42: Information on annuities stemming from Non-Life Insurance obligationsReportedNot reported as no annuities stemming from Non-Life Insurance obligationsNot reported other reason

43: Impact of long term guarantees and transitional measuresReportedNot reported as no LTG measures or transitional are appliedNot reported other reason

44: Projection of future cash flows (Best Estimate - Matching portfolios)ReportedNot reported as no MA is appliedNot reported other reason

45: Information on the transitional on interest rates calculationReportedNot reported as no such transitional measure is appliedNot reported other reason

46: Participations heldReportedNot reported as no participations heldNot reported other reason

47: Solvency Capital Requirement - Only SF (Full scope individual)ReportedReported due to article 112 request

Page 300: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Not reported o/a use partial internal modelNot reported o/a use full internal modelNot reported other reason

48: Solvency Capital Requirement - SF (Full scope group)ReportedReported due to article 112 requestNot reported o/a use partial internal modelNot reported o/a use full internal modelNot reported as method 2 is used exclusivelyNot reported other reason

49: Solvency Capital Requirement - SF and PIM (Full scope group)ReportedNot reported o/a use full internal modelNot reported o/a full use of Standard FormulaNot reported as method 2 is used exclusivelyNot reported other reason

50: Solvency Capital Requirement - IM (Full scope group)ReportedNot reported o/a use partial internal modelNot reported o/a full use of Standard FormulaNot reported as method 2 is used exclusivelyNot reported other reason

51: Solvency Capital Requirement (Full scope individual)ReportedNot reported as risk not existentNot reported o/a use partial internal modelNot reported o/a use full internal modelNot reported as reported at RFF/MAP levelNot reported other reason

52: Solvency Capital Requirement (Full scope group)ReportedNot reported as risk not existentNot reported o/a use partial internal modelNot reported o/a use full internal modelNot reported as reported at RFF/MAP levelNot reported as method 2 is used exclusivelyNot reported other reason

53: Solvency Capital Requirement - Operational risk (Full scope individual)ReportedNot reported o/a use partial internal modelNot reported o/a use full internal modelNot reported as reported at RFF/MAP levelReported due to article 112 requestReported twice due to use of PIMNot reported other reason

54: Solvency Capital Requirement - Operational risk (Full scope group)ReportedNot reported o/a use partial internal modelNot reported o/a use full internal modelNot reported as reported at RFF/MAP levelNot reported as method 2 is used exclusively

Page 301: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Reported due to article 112 requestReported twice due to use of PIMNot reported other reason

55: Solvency Capital Requirement - Simplifications (Full scope individual)ReportedNot reported as no simplified calculations usedNot reported o/a use partial internal modelNot reported o/a use full internal modelNot reported as reported at RFF/MAP levelReported due to article 112 requestReported twice due to use of PIMNot reported other reason

56: Solvency Capital Requirement - Simplifications (Full scope group)ReportedNot reported as no simplified calculations usedNot reported o/a use partial internal modelNot reported o/a use full internal modelNot reported as reported at RFF/MAP levelNot reported as method 2 is used exclusivelyReported due to article 112 requestReported twice due to use of PIMNot reported other reason

57: Facultative covers for non-life and lifeReportedNot reported as no facultative coversNot reported other reason

58: Reinsurance DataReportedNot reported as no reinsuranceNot reported other reason

59: Special Purpose VehiclesReportedNot reported as no Special Purpose Insurance VehiclesNot reported other reason

60: IGT - Equity-type transactions, debt and asset transfer (Full scope individual)ReportedNot reported as no IGT on Equity-type transactions, debt and asset transferNot reported as no parent undertaking is a mixed-activity insurance holding company where they are not paNot reported other reason

61: IGT - Equity-type transactions, debt and asset transfer (Full scope group)ReportedNot reported as no IGT on Equity-type transactions, debt and asset transferNot reported other reason

62: IGT - Derivatives (Full scope individual)ReportedNot reported as no IGT on DerivativesNot reported as no parent undertaking is a mixed-activity insurance holding company where they are not paNot reported other reason

63: IGT - Derivatives (Full scope group)ReportedNot reported as no IGT on Derivatives

Page 302: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Not reported other reason64: IGT - Internal reinsurance (Full scope individual)

ReportedNot reported as no IGT on Internal reinsuranceNot reported as no parent undertaking is a mixed-activity insurance holding company where they are not paNot reported other reason

65: IGT - Internal reinsurance (Full scope group)ReportedNot reported as no IGT on Internal reinsuranceNot reported other reason

66: IGT - Cost Sharing, contingent liabilities, off BS and other items (Full scope individual)ReportedNot reported as no IGT on Cost Sharing, contingent liabilities, off BS and other itemsNot reported as no parent undertaking is a mixed-activity insurance holding company where they are not paNot reported other reason

67: IGT - Cost Sharing, contingent liabilities, off BS and other items (Full scope group)ReportedNot reported as no IGT on Cost Sharing, contingent liabilities, off BS and other itemsNot reported other reason

68: Risk concentrationReportedNot due in accordance with threshold decided by group supervisorNot reported other reason

69: Risk concentrationFull recalculationSimplification at risk sub-module levelSimplification at risk module levelNo adjustment

71: Pension entitlementsReportedNot reported o/a no life and health SLT businessNot reported other reasonLife company without pension entitlements

72: Non-life Technical Provisions - reinsurance policiesReportedNot reported o/a no non-life businessNot reported other reasonLife company without pension entitlements

73: Collective investment undertakings - look-through approach (Financial stability)ReportedNot reported as no Collective investment undertakingsNot reported other reason

74: Securities lending and repos (Financial stability)ReportedNot reported as no Securities lending and reposNot reported other reason

75: Profit or loss sharingReportedNot reported in Q1 and Q3Not reported other reason

77: Balance Sheet (Full scope individual Ring-fenced fund/matching portfolio/remaining part)

Page 303: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ReportedNot reported as no RFF or MAPNot reported as refers to MAP fundNot reported other reason

78: Balance Sheet (Full scope group Ring-fenced fund/matching portfolio/remaining part)ReportedNot reported as no RFF or MAPNot reported as method 2 is used exclusivelyNot reported as refers to MAP fundNot reported other reason

79: ContentReportedNot reported as no MA is appliedNot reported as refers to RFF or remaining partNot reported other reason

80: ContentReportedNot reported as volatility adjustment not appliedNot reported

81: Balance Sheet (Full scope individual)ReportedExempted under Article 35 (6) to (8)Not reported other reason

82: ContentReportedExempted under Article 35 (6) to (8)Not reported

83: Life and Health SLT Technical Provisions (Full scope)ReportedNot reported o/a no life and health SLT businessExempted under Article 35 (6) to (8)Not reported other reason

84: Non-Life Technical Provisions (Full scope)ReportedNot reported o/a no non-life businessExempted under Article 35 (6) to (8)Not reported other reason

85: Minimum Capital Requirement - Only life or only non-life insurance or reinsurance activityReportedNot reported as both life and non-life insurance or reinsurance activityNot reported other reason

86: Minimum Capital Requirement - Both life and non-life insurance activityReportedNot reported as only life or only non-life insurance or reinsurance activity or only reinsurance activityNot reported other reason

87: ContentReportedExempted under Article 254(2)Not reported other reason

88: Structured products (Group)Reported

Page 304: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Not reported as no structured productsExempted under Article 254(2)Not reported other reason

89: Securities lending and repos (Group)ReportedNot reported as no Securities lending and reposNot due in accordance with instructions of the templateExempted under Article 254(2)Not reported other reason

90: Assets held as collateral (Group)ReportedNot reported as no Assets held as collateralExempted under Article 254(2)Not reported other reason

91: ContentReportedExempted under Article 254(2)Not reported

92: Life and Health SLT Technical Provisions (Full scope)ReportedNot reported as no RFF/MAP or no life and health SLT businessNot reported other reason

93: Non-Life Technical Provisions (Full scope Ring-fenced fund/matching portfolio/remaining part)ReportedNot reported as no RFF/MAP or no non-life businessNot reported other reason

94: Pension entitlementsReportedNot reported as no pension entitlementsNot reported other reason

95: Non-life Technical Provisions - reinsurance policiesReportedNot reported as no reinsuranceNot due in accordance with instructions of the templateNot reported other reason

96: Balance Sheet (Full scope group)ReportedNot reported as method 2 is used exclusivelyNot reported other reason

97: List of assetsReportedExempted under Guideline 48Not due annually as reported for Quarter 4Not reported other reason

98: Collective investment undertakings - look-through approach (Individual)ReportedNot reported as no Collective investment undertakingsExempted under Guideline 48Not due annually as reported for Quarter 4Not reported other reason

99: Structured products

Page 305: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ReportedNot reported as no structured productsExempted under Guideline 48Not reported other reason

100: Open derivativesReportedNot reported o/a no derivative transactionsExempted under Guideline 48Not due annually as reported for Quarter 4Not reported other reason

101: Securities lending and reposReportedNot reported as no Securities lending and reposNot due in accordance with instructions of the templateExempted under Guideline 48Not reported other reason

102: Assets held as collateralReportedNot reported as no Assets held as collateralExempted under Guideline 48Not reported other reason

103: Life and Health SLT Technical Provisions (Full scope)ReportedNot reported o/a no life and health SLT businessExempted under Guideline 48Not reported other reason

104: Non-Life Technical ProvisionsReportedNot reported o/a no non-life businessExempted under Guideline 48Not reported other reason

105: ContentReportedExempted under Guideline 48Not reported

106: Balance Sheet (Third country branches)ReportedExempted under Guideline 48Not reported other reason

107: Assets and liabilities by currency (Full scope individual)ReportedNot due in accordance with instructions of the templateNot reported

108: Solvency Capital Requirement - Only SF (Full scope individual)[210]Reported as standard formula is usedReported due to article 112 requestNot reported o/a use partial internal modelNot reported o/a use full internal modelNot reported other reason

109: Solvency Capital Requirement - SF (Full scope group)[210]Reported as standard formula is used

Page 306: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Reported due to article 112 requestNot reported o/a use partial internal modelNot reported o/a use full internal modelNot reported as method 2 is used exclusivelyNot reported other reason

110: Assets and liabilities by currency (Full scope group)[210]ReportedNot due in accordance with article 9 of this RegulationNot reported as method 2 is used exclusivelyNot reported other reason

111: Deposits to cedants - line-by-line reporting (Full scope individual)[210]ReportedNot reported as no reinsuranceExempted under Article 35 (6) to (8)Not due annually as reported for Quarter 4Not reported other reason

112: Best estimate subject to volatility adjustment by country and currency [210]ReportedNot reported as volatility adjustment not appliedNot reported other reason

113: Content [210]ReportedExempted under Article 35 (6) to (8)Not reported other reason

114: Content [210]ReportedExempted under Article 254(2)Not reported other reason

115: Content [210]ReportedExempted under Guideline 48Not reported other reason

116: Assets and liabilities by currency (Full scope individual)[210]ReportedNot due in accordance with instructions of the templateNot reported other reason

117: Collective investment undertakings - look-through approach (Individual)[210]ReportedNot reported as no Collective investment undertakingsNot due in accordance with instructions of the templateExempted under Article 35 (6) to (8)Not due annually as reported for Quarter 4Not reported other reason

118: Collective investment undertakings - look-through approach (Group)[210]ReportedNot reported as no Collective investment undertakingsNot due in accordance with instructions of the templateExempted under Article 254(2)Not due annually as reported for Quarter 4Not reported other reason

119: Collective investment undertakings - look-through approach (Third country branches)[210]

Page 307: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ReportedNot reported as no Collective investment undertakingsNot due in accordance with instructions of the templateExempted under Guideline 48Not due annually as reported for Quarter 4Not reported other reason

120: Structured products (Individual)[210]ReportedNot reported as no structured productsNot due in accordance with instructions of the templateExempted under Article 35 (6) to (8)Not reported other reason

121: Structured products (Third country branches)[210]ReportedNot reported as no structured productsNot due in accordance with instructions of the templateExempted under Guideline 48Not reported other reason

122: Deposits to cedants - line-by-line reporting (Third country branches)[210]ReportedNot reported as no reinsuranceExempted under Guideline 48Not due annually as reported for Quarter 4Not reported other reason

123: Non-Life Technical Provisions (Full scope)[220]ReportedNot reported o/a no non-life businessNot reported as no direct insurance businessNot reported other reason

124: Solvency Capital Requirement (Full scope individual)[220]ReportedNot reported as risk not existentNot reported o/a use partial internal modelNot reported o/a use full internal modelNot reported as reported at RFF/MAP levelReported due to article 112 requestReported twice due to use of PIMNot reported other reason

125: Solvency Capital Requirement (Full scope group)[220]ReportedNot reported as risk not existentNot reported o/a use partial internal modelNot reported o/a use full internal modelNot reported as reported at RFF/MAP levelNot reported as method 2 is used exclusivelyReported due to article 112 requestReported twice due to use of PIMNot reported other reason

126: Structured products (Group)[220]ReportedNot reported as no structured products

Page 308: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Not due in accordance with instructions of the templateExempted under Article 254(2)Not reported other reason

Page 309: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name

x1x0

x1

x1x9x2

x1x3x2

x1x4x5x2

x1x6x5x2

x1x11x2

x1x11x10x2

x1x12x10x2

x1x11x13x2

x1x7x2

x1x8x2

Page 310: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x1x14x2

x1x15x2

x1x2

x1x63x17x2

x1x15x17x2

x1x19x2

x1x19x17x2

x1x20x2

x1x22x23x2

x1x63x23x2

x1x21x22x23x2

Page 311: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x1x21x63x23x2

x1x25x26x2

x1x3x22x23x2

x1x3x63x23x2

x1x4x2

x1x4x19x2

x1x6x2

x1x6x19x70x2

x1x27x2

x1x28x2

x1

Page 312: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x29x2

x1x30x70x2

x1x31x22x2

x1x32x19x22x2

x1x33x22x2

x1x34x70x2

x1x35x2

x1x36x2

x1x37x2

x1x39x2

x1x40x2

x1x60

Page 313: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x12x11x2

x1x60x12x11x17x2

x1x11x10x17x2

x1x12x10x17x2

x1x13x12x11x41x2

x1x13x12x11x41x17x2

x1x12x11x41x60x71x2

x1x12x11x41x17

Page 314: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x60x71x2

x1x42x12x11x41x60x71x2

x1x42x12x11x41x17x60x71x2

x1x43x2

x1x44x2

x1x45x2

x1x46x47x2

x1x46x2

x1x48x47x2

x1x48

Page 315: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x2

x1x49x47x2

x1x49x2

x1x50x47x2

x1x50x2

x1x51x2

x52x53x54x55

x1x4x2x56

x1x6x2x56

x1x21x2

x1x32x2

x1x57x2

Page 316: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x1x15x16x2

x1x15x17x16x2

x1x37x38x2

x1x58x0

x1x22x2

x1x22x0

x1x4x22x2

x1x6x22x2

x1x61x2

x1x62x2

x1x63x2

x1

Page 317: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x31x63x2

x1x32x19x63x2

x1x33x63x2

x1x63x0

x1x64x2

x1x65x2

x1x66x2

x1x44x19x2

x1x17x2

x1x67x23x2

x1x21x67x23x2

Page 318: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x1x31x67x2

x1x3x67x23x2

x1x32x19x67x2

x1x33x67x2

x1x4x67x2

x1x6x67x2

x1x67x0

x1x67x2

x1x19x0

x59x60x12x11x2

x59

Page 319: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x60x12x11x17x2

x1x68x17x2

x1x44x22x23x2

x1x58x2

x1x22x2

x1x63x2

x1x67x2

x1x19x2

x1x21x19x22x23x2

x1x21x19x63x23x2

Page 320: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x1x21x19x67x23x2

x1x31x19x22x2

x1x31x19x67x2

x1x44x67x23x2

x1x6x70x2

x1x13x12x11x41x60x71x2

x1x13x12x11x41x17x60x71x2

x1x31

Page 321: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x19x63x2

Page 322: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy node label

1 - Reported0 - Not reported (in this case special justification is needed)

1 - Reported

ReportedNot reported o/a below threshold (of non-home currency total being <10% of assets and liabilities)Not reported other reason

ReportedNot reported o/a no derivative transactionsNot reported other reason

ReportedNot reported o/a no life and health SLT businessNot reported o/a materiality thresholdNot reported other reason

ReportedNot reported o/a no non-life businessNot reported o/a materiality thresholdNot reported other reason

ReportedNot reported o/a use full internal modelNot reported other reason

1 - Reported9 - Not reported as use of full internal model10 - Not reported as use of standard formula0 - Not reported other reason (in this case special justification is needed)

1 - Reported8 - Not reported as use of partial internal model10 - Not reported as use of standard formula0 - Not reported other reason (in this case special justification is needed)

ReportedNot reported o/a use full internal modelNot reported as risk not existentNot reported other reason

1 - Reported2 - Not reported o/a composite undertaking0 - Not reported other reason

ReportedNot reported o/a non-composite undertakingNot reported other reason

Page 323: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1 - Reported2 - Not reported as no non-(re)insurance business in the scope of the group0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no RFF or MAP0 - Not reported other reason (in this case special justification is needed)

1 - Reported0 - Not reported other reason (in this case special justification is needed)

1 - Reported6 - Exempted under Article 254(2)13 - Not reported as method 2 is used exclusively0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no RFF or MAP13 - Not reported as method 2 is used exclusively0 - Not reported other reason (in this case special justification is needed)

1 - Reported3 - Not due in accordance with instructions of the template0 - Not reported other reason (in this case special justification is needed)

1 - Reported3 - Not due in accordance with article 9 of this Regulation13 - Not reported as method 2 is used exclusively0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no off-balance sheet items0 - Not reported other reason (in this case special justification is needed)

1 - Reported6 - Exempted under Article 35 (6) to (8)7 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported (in this case special justification is needed)

1 - Reported6 - Exempted under Article 254(2)7 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no Collective investment undertakings6 - Exempted under Article 35 (6) to (8)7 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported (in this case special justification is needed)

Page 324: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1 - Reported2 - Not reported as no Collective investment undertakings6 - Exempted under Article 254(2)7 - Not due annually as reported for Quarter 40 - Not reported other reason (in this case special justification is needed)

1 - Reported4 - Not due as S.06.02 and S.08.01 reported quarterly5 - Not due as S.06.02 and S.08.01 reported annually0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no derivative transactions6 - Exempted under Article 35 (6) to (8)7 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no derivative transactions6 - Exempted under Article 254(2)7 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no life and health SLT business0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no life and health SLT business3 - Not due in accordance with instructions of the template0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no non-life business0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no non-life business3 - Not due in accordance with instructions of the template18 - Not reported as no direct insurance business0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no unlimited guarantees received0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no unlimited guarantees provided0 - Not reported other reason (in this case special justification is needed)

1 - Reported

Page 325: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

2 - Not reported as no activity outside the home country0 - Not reported (in this case special justification is needed)

1 - Reported2 - Not reported as no activity outside the home country in relation to specific class18 - Not reported as no direct insurance business0 - Not reported (in this case special justification is needed)

1 - Reported2 - Not reported as no structured products6 - Exempted under 35 (6) to (8)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no Securities lending and repos3 - Not due in accordance with instructions of the template6 - Exempted under Article 35 (6) to (8)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no Assets held as collateral6 - Exempted under Article 35 (6) to (8)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no variable annuities18 - Not reported as no direct insurance business0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no annuities stemming from Non-Life Insurance obligations0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no LTG measures or transitionals are applied0 - Not reported other reason (in this case special justification is needed)

ReportedNot reported as no MA is appliedNot reported other reason

1 - Reported2 - Not reported as no such transitional measure is applied0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no participations held0 - Not reported (in this case special justification is needed)

1 - Reported as standard formula is used2 - Reported due to article 112 request

Page 326: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

8 - Not reported as use of partial internal model9 - Not reported as use of full internal model0 - Not reported other reason (in this case special justification is needed)

1 - Reported as standard formula is used2 - Reported due to article 112 request8 - Not reported as use of partial internal model9 - Not reported as use of full internal model13 - Not reported as method 2 is used exclusively0 - Not reported other reason (in this case special justification is needed)

1 - Reported9 - Not reported as use of full internal model10 - Not reported as use of standard formula13 - Not reported as method 2 is used exclusively0 - Not reported other reason (in this case special justification is needed)

1 - Reported8 - Not reported as use of partial internal model10 - Not reported as use of standard formula13 - Not reported as method 2 is used exclusively0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as risk not existent8 - Not reported as use of partial internal model9 - Not reported as use of full internal model11 - Not reported as reported at RFF/MAP level0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as risk not existent8 - Not reported as use of partial internal model9 - Not reported as use of full internal model11 - Not reported as reported at RFF/MAP level13 - Not reported as method 2 is used exclusively0 - Not reported other reason (in this case special justification is needed)

1 - Reported8 - Not reported as use of partial internal model9 - Not reported as use of full internal model11 - Not reported as reported at RFF/MAP level16 - Reported due to request of Article 112 of Directive 2009/138/EC17 - Reported twice due to use of PIM0 - Not reported other reason (in this case special justification is needed)

1 - Reported8 - Not reported as use of partial internal model9 - Not reported as use of full internal model11 - Not reported as reported at RFF/MAP level13 - Not reported as method 2 is used exclusively

Page 327: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

16 - Reported due to request of Article 112 of Directive 2009/138/EC17 - Reported twice due to use of PIM0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no simplified calculations used8 - Not reported as use of partial internal model9 - Not reported as use of full internal model11 - Not reported as reported at RFF/MAP level16 - Reported due to request of Article 112 of Directive 2009/138/EC17 - Reported twice due to use of PIM0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no simplified calculations used8 - Not reported as use of partial internal model9 - Not reported as use of full internal model11 - Not reported as reported at RFF/MAP level13 - Not reported as method 2 is used exclusively16 - Reported due to request of Article 112 of Directive 2009/138/EC17 - Reported twice due to use of PIM0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no facultative covers0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no reinsurance0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no Special Purpose Insurance Vehicles0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no IGT on Equity-type transactions, debt and asset transfer12 - Not reported as no parent undertaking is a mixed-activity insurance holding company where they are not part of a group as defined under article 213 (2) (a), (b) and (c) of Solvency II Directive0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no IGT on Equity-type transactions, debt and asset transfer0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no IGT on Derivatives12 - Not reported as no parent undertaking is a mixed-activity insurance holding company where they are not part of a group as defined under article 213 (2) (a), (b) and (c) of Solvency II Directive0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no IGT on Derivatives

Page 328: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no IGT on Internal reinsurance12 - Not reported as no parent undertaking is a mixed-activity insurance holding company where they are not part of a group as defined under article 213 (2) (a), (b) and (c) of Solvency II Directive0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no IGT on Internal reinsurance0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no IGT on Cost Sharing, contingent liabilities, off BS and other items12 - Not reported as no parent undertaking is a mixed-activity insurance holding company where they are not part of a group as defined under article 213 (2) (a), (b) and (c) of Solvency II Directive0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no IGT on Cost Sharing, contingent liabilities, off BS and other items0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not due in accordance with threshold decided by group supervisor0 - Not reported other reason (in this case special justification is needed)

1 - Full recalculation2 - Simplification at risk sub-module level3 - Simplification at risk module level4 - No adjustment

ReportedNot reported o/a no life and health SLT businessNot reported other reasonLife company without pension entitlements

ReportedNot reported o/a no non-life businessNot reported other reasonLife company without pension entitlements

ReportedNot reported as no Collective investment undertakingsNot reported other reason

ReportedNot reported as no Securities lending and reposNot reported other reason

1 - Reported15 - Not reported in Q1 and Q30 - Not reported other reason (in this case special justification is needed)

Page 329: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1 - Reported2 - Not reported as no RFF/MAP14 - Not reported as refers to MAP fund0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no RFF/MAP13 - Not reported as method 2 is used exclusively14 - Not reported as refers to MAP fund0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no Matching Adjustment is applied15 - Not reported as refers to RFF or remaining part0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as volatility adjustment not applied0 - Not reported (in this case special justification is needed)

1 - Reported6 - Exempted under Article 35 (6) to (8)0 - Not reported other reason (in this case special justification is needed)

1 - Reported6 - Exempted under Article 35 (6) to (8)0 - Not reported (in this case special justification is needed)

1 - Reported2 - Not reported as no life and health SLT business6 - Exempted under Article 35 (6) to (8)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no non-life business6 - Exempted under Article 35 (6) to (8)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as both life and non-life insurance or reinsurance activity0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as only life or only non-life insurance or reinsurance activity or only reinsurance activity0 - Not reported other reason (in this case special justification is needed)

1 - Reported6 - Exempted under Article 254(2)0 - Not reported other reason (in this case special justification is needed)

1 - Reported

Page 330: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

2 - Not reported as no structured products6 - Exempted under Article 254(2)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no Securities lending and repos3 - Not due in accordance with instructions of the template6 - Exempted under Article 254(2)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no Assets held as collateral6 - Exempted under Article 254(2)0 - Not reported other reason (in this case special justification is needed)

1 - Reported6 - Exempted under Article 254(2)0 - Not reported (in this case special justification is needed)

1 - Reported2 - Not reported as no RFF/MAP or no life and health SLT business0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no RFF/MAP or no non-life business0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no pension entitlements0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no reinsurance business3 - Not due in accordance with instructions of the template0 - Not reported other reason (in this case special justification is needed)

1 - Reported13 - Not reported as method 2 is used exclusively0 - Not reported other reason (in this case special justification is needed)

1 - Reported6 - Exempted under Guideline 487 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported (in this case special justification is needed)

1 - Reported2 - Not reported as no Collective investment undertakings6 - Exempted under Guideline 487 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported (in this case special justification is needed)

Page 331: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1 - Reported2 - Not reported as no structured products6 - Exempted under Guideline 480 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no derivative transactions6 - Exempted under Guideline 487 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no Securities lending and repos3 - Not due in accordance with instructions of the template6 - Exempted under Guideline 480 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no Assets held as collateral6 - Exempted under Guideline 480 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no life and health SLT business6 - Exempted under Guideline 480 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no non-life business6 - Exempted under Guideline 480 - Not reported other reason (in this case special justification is needed)

1 - Reported6 - Exempted under Guideline 480 - Not reported (in this case special justification is needed)

1 - Reported6 - Exempted under Guideline 480 - Not reported other reason (in this case special justification is needed)

1 - Reported3 - Not due in accordance with instructions of the template0 - Not reported (in this case special justification is needed)

1 - Reported as standard formula is used16 - Reported due to request of Article 112 of Directive 2009/138/EC8 - Not reported as use of partial internal model9 - Not reported as use of full internal model0 - Not reported other reason (in this case special justification is needed)

1 - Reported as standard formula is used

Page 332: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

16 - Reported due to request of Article 112 of Directive 2009/138/EC8 - Not reported as use of partial internal model9 - Not reported as use of full internal model13 - Not reported as method 2 is used exclusively0 - Not reported other reason (in this case special justification is needed)

1 - Reported3 - Not due in accordance with article 9 of this Regulation13 - Not reported as method 2 is used exclusively0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no reinsurance business6 - Exempted under Article 35 (6) to (8)7 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported (in this case special justification is needed)

1 - Reported2 - Not reported as volatility adjustment not applied0 - Not reported (in this case special justification is needed)

1 - Reported6 - Exempted under Article 35 (6) to (8)0 - Not reported (in this case special justification is needed)

1 - Reported6 - Exempted under Article 254(2)0 - Not reported (in this case special justification is needed)

1 - Reported6 - Exempted under Guideline 480 - Not reported (in this case special justification is needed)

1 - Reported3 - Not due in accordance with instructions of the template0 - Not reported (in this case special justification is needed)

1 - Reported2 - Not reported as no Collective investment undertakings3 - Not due in accordance with instructions of the template6 - Exempted under Article 35 (6) to (8)7 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported (in this case special justification is needed)

1 - Reported2 - Not reported as no Collective investment undertakings3 - Not due in accordance with instructions of the template6 - Exempted under Article 254(2)7 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported other reason (in this case special justification is needed)

Page 333: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1 - Reported2 - Not reported as no Collective investment undertakings3 - Not due in accordance with instructions of the template6 - Exempted under Guideline 487 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported (in this case special justification is needed)

1 - Reported2 - Not reported as no structured products3 - Not due in accordance with instructions of the template6 - Exempted under Article 35 (6) to (8)0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no structured products3 - Not due in accordance with instructions of the template6 - Exempted under Guideline 480 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no reinsurance business6 - Exempted under Guideline 487 - Not due annually as reported for Quarter 4 (this option is only applicable on annual submissions)0 - Not reported (in this case special justification is needed)

1 - Reported2 - Not reported as no non-life business18 - Not reported as no direct insurance business0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as risk not existent8 - Not reported as use of partial internal model9 - Not reported as use of full internal model11 - Not reported as reported at RFF/MAP level16 - Reported due to request of Article 112 of Directive 2009/138/EC17 - Reported twice due to use of PIM0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as risk not existent8 - Not reported as use of partial internal model9 - Not reported as use of full internal model11 - Not reported as reported at RFF/MAP level13 - Not reported as method 2 is used exclusively16 - Reported due to request of Article 112 of Directive 2009/138/EC17 - Reported twice due to use of PIM0 - Not reported other reason (in this case special justification is needed)

1 - Reported2 - Not reported as no structured products

Page 334: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

3 - Not due in accordance with instructions of the template6 - Exempted under Article 254(2)0 - Not reported other reason (in this case special justification is needed)

Page 335: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Sign Weight Owner Usable Applicable Applicable sheets for dropdownss2c N/A S.01.01 (201), SE.01.01 (201), SPV.01.01 (

s2c N/A S.01.01 (201), SE.01.01 (201), SPV.01.01 (

s2c N/A

s2c N/A

s2c N/A

s2c N/A

s2c N/A

s2c N/A S.01.01 (201), SR.01.01 (201), SE.01.01 (20

s2c N/A S.01.01 (201), SR.01.01 (201), SE.01.01 (20

s2c N/A

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

Page 336: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201),SE.01.01 (201), SPV.01.01 (2

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201)

Page 337: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SR.01.01 (201), SE.01.01 (20

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

Page 338: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A SR.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SR.01.01 (201), SE.01.01 (20

Page 339: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c N/A S.01.01 (201), SR.01.01 (201)

s2c N/A S.01.01 (201), SR.01.01 (201)

s2c N/A S.01.01 (201), SR.01.01 (201)

s2c N/A S.01.01 (201), SR.01.01 (201), SE.01.01 (20

s2c N/A S.01.01 (201), SR.01.01 (201)

s2c N/A S.01.01 (201), SR.01.01 (201), SE.01.01 (20

s2c N/A S.01.01 (201), SR.01.01 (201)

Page 340: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c N/A S.01.01 (201), SR.01.01 (201), SE.01.01 (20

s2c N/A S.01.01 (201), SR.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

12 - Not reported as no parent undertaking is a mixed-activity insurance holding company where they are not part of a group as defined under article 213 (2) (a), (b) and (c) of Solvency II Directive

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

12 - Not reported as no parent undertaking is a mixed-activity insurance holding company where they are not part of a group as defined under article 213 (2) (a), (b) and (c) of Solvency II Directive

s2c N/A S.01.01 (201)

Page 341: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c N/A S.01.01 (201), SE.01.01 (201)

12 - Not reported as no parent undertaking is a mixed-activity insurance holding company where they are not part of a group as defined under article 213 (2) (a), (b) and (c) of Solvency II Directive

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

12 - Not reported as no parent undertaking is a mixed-activity insurance holding company where they are not part of a group as defined under article 213 (2) (a), (b) and (c) of Solvency II Directive

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201)

s2c N/A

s2c N/A

s2c N/A

s2c N/A

s2c N/A

s2c N/A S.01.01 (201)

s2c N/A SR.01.01 (201)

Page 342: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c N/A SR.01.01 (201)

s2c N/A SR.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

2 - Not reported as only life or only non-life insurance or reinsurance activity or only reinsurance activity

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201)

Page 343: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201)

s2c N/A SR.01.01 (201)

s2c N/A SR.01.01 (201)

s2c N/A SE.01.01 (201)

s2c N/A SE.01.01 (201)

s2c N/A S.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

Page 344: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (210), SR.01.01 (210), SE.01.01 (21

s2c N/A S.01.01 (210), SR.01.01 (210)

Page 345: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c N/A S.01.01 (210)

s2c N/A SE.01.01 (210)

s2c N/A S.01.01 (210), SE.01.01 (210)

s2c N/A S.01.01 (210), SE.01.01 (210)

s2c N/A S.01.01 (210)

s2c N/A S.01.01 (210), SE.01.01 (210)

s2c N/A S.01.01 (201), SE.01.01 (201)

s2c N/A S.01.01 (210), SE.01.01 (210)

s2c N/A S.01.01 (210)

s2c N/A S.01.01 (210), SE.01.01 (210)

Page 346: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c N/A S.01.01 (210), SE.01.01 (210)

s2c N/A S.01.01 (210), SE.01.01 (210)

s2c N/A SE.01.01 (210)

s2c N/A S.01.01 (220), SR.01.01 (220), SE.01.01 (22

s2c N/A S.01.01 (220), SR.01.01 (220), SE.01.01 (22

s2c N/A S.01.01 (220), SR.01.01 (220)

s2c N/A S.01.01 (220), SE.01.01 (220)

Page 347: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modified date Comment7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 348: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/2014

9/30/20157/7/2014

9/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015 7/15/2016

7/7/20149/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/2015 7/15/2017

7/7/20149/30/2015

7/7/20149/30/20159/30/2015 7/15/2017 1

7/7/20149/30/2015 7/15/2016

7/7/20149/30/20159/30/20159/30/2015 7/15/2017

7/7/20149/30/2015 7/15/2016

Page 349: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20149/30/20159/30/20159/30/2015 7/15/2017 1

7/7/20149/30/2015

7/7/20149/30/2015 7/15/20179/30/2015 7/15/2017

7/7/20149/30/2015

7/7/20147/7/2014

9/30/20159/30/2015 7/15/2017

7/7/20149/30/2015

7/7/20147/7/2014

9/30/20159/30/2015 7/15/2017 1

7/7/20149/30/2015

7/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/20147/7/2014

9/30/2015 7/15/20177/7/20147/7/2014

9/30/20157/15/2017

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/2014

Page 350: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20157/7/2014

9/30/2015 7/15/20177/7/2014

9/30/20157/15/2017

7/7/20149/30/2015 7/15/2016

7/7/20149/30/20159/30/2015

7/7/20149/30/2015 7/15/2016

7/7/20149/30/20159/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/2015

7/7/20149/30/2015 7/15/2017

7/7/20149/30/20157/15/2017

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015 12/31/2013

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015 7/15/2016

7/7/20149/30/2015

Page 351: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/2014

9/30/2015 7/15/20167/7/2014

9/30/20157/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/2014 9/30/20157/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/2014 9/30/20157/7/20147/7/2014

9/30/20159/30/2015

7/7/20149/30/2015 7/15/2017

7/7/20147/7/20147/7/2014

9/30/20159/30/20157/15/2017

7/7/20149/30/2015 7/15/2017

7/7/20147/7/20147/7/2014

9/30/20159/30/2015

Page 352: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20157/15/2017

7/7/20149/30/2015 7/15/2017

7/7/20149/30/2015

7/7/20147/7/2014

9/30/20159/30/20157/15/2017

7/7/20149/30/2015 7/15/2017

7/7/20149/30/2015

7/7/20147/7/2014

9/30/20159/30/20159/30/20157/15/2017

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

Page 353: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20149/30/2015

7/7/20149/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/2013

7/7/20147/7/20147/7/2014

9/30/2015 9/30/20159/30/2015 12/31/2013

7/7/20147/7/20147/7/2014

9/30/2015 12/31/20139/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

Page 354: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20149/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/2015

7/7/20149/30/2015 7/15/2016

7/7/20149/30/2015

7/7/20149/30/2015 7/15/2016

7/7/20149/30/2015

7/7/20149/30/2015 7/15/2016

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/2014

9/30/20157/7/2014

9/30/20157/7/2014

9/30/20157/7/2014

9/30/20157/7/2014

9/30/20157/7/2014

9/30/2015 7/15/20167/7/2014

Page 355: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/2015

7/7/20149/30/2015 7/15/2016

7/7/20149/30/20159/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/2015

7/7/20149/30/2015 7/15/2016

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/2015 7/15/2017

7/7/20149/30/2015 7/15/2016

7/7/20149/30/20159/30/20159/30/2015 7/15/2017

7/7/20149/30/2015 7/15/2016

Page 356: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20149/30/20159/30/2015

7/7/20149/30/2015

7/7/20147/7/2014

9/30/20159/30/2015 7/15/2017

7/7/20149/30/2015

7/7/20149/30/20159/30/20159/30/2015

7/7/20149/30/2015

7/7/20149/30/20159/30/2015

7/7/20149/30/2015

7/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/2014

9/30/20157/7/2014

9/30/2015 7/15/20167/7/2014

9/30/20157/7/2014

9/30/20157/7/2014

9/30/20157/7/2014

9/30/2015 7/15/20167/7/2014

9/30/20157/7/2014

7/15/2016 7/15/20179/30/2015 7/15/20169/30/2015

7/7/20147/7/20147/7/2014

7/15/2016 7/15/20179/30/2015 7/15/2016

Page 357: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20157/7/20147/7/2014

9/30/20157/7/2014

7/15/20167/7/2014

7/15/20169/30/2015

7/7/20147/15/2016

7/7/20149/30/20159/30/20159/30/2015 7/15/2017

7/7/20147/15/2016

7/7/20149/30/2015

7/7/20147/15/2016

7/7/20149/30/2015

7/7/20147/15/2016

7/7/20149/30/2015

7/7/20147/15/2016

7/7/20149/30/2015

7/7/20147/15/2016

7/7/20149/30/2015

7/7/20147/15/2016

7/7/20149/30/20159/30/20159/30/20159/30/2015 7/15/2017

7/7/20147/15/2016

7/7/20149/30/20159/30/20159/30/20159/30/2015 7/15/2017 1

7/7/20147/15/2016

Page 358: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20149/30/20159/30/20159/30/20159/30/2015 7/15/2017

7/7/20147/15/2016 7/15/2017

7/7/20149/30/20159/30/20159/30/2015

7/7/20147/15/2016

7/7/20149/30/20159/30/20159/30/2015

7/7/20147/15/2016

7/7/20149/30/20159/30/20159/30/2015 7/15/2017

7/7/20147/15/2017

7/7/20147/7/2014

7/15/20177/7/2014

7/15/20177/7/20147/7/2014 9/30/20157/7/20147/7/2014

9/30/20159/30/20157/15/2017

7/7/20147/15/2017

7/7/20147/7/2014 9/30/20157/7/20147/7/2014

9/30/20159/30/20159/30/20157/15/2017

7/7/20147/15/2017

7/7/20149/30/2015

Page 359: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/2015

7/7/2014

Page 360: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name DefaultOwnerNA x0 yes s2cAccounting consolidation-based method [method 1 and part of combinatiox1 s2cAccounting consolidation-based method [method 1] x2 s2cAccounting consolidation-based method [method 1] and combination of mx3 s2cBelonging to the same group x4 s2cCombination of methods 1 and 2 x5 s2cAggregated x6 s2cConsolidation method 1 used for group solvency assessment of at least on x7 s2cConsolidation method 1 used for group solvency assessment of none underx8 s2cMethod 1: Adjusted equity method x9 s2cMethod 1: Full consolidation x10 s2cMethod 1: Proportional consolidation x11 s2cMethod 2: Local rules x12 s2cDeduction and aggregation method [method 2 and part of combination of x13 s2cDeduction and aggregation method [method 2] x14 s2cMethod 2: Solvency II x15 s2cDeduction of the participation in relation to article 229 of Directive 2009/ x16 s2cDominant x17 s2cGroup x18 s2cIncluded into scope of group supervision x19 s2cNo inclusion in the scope of group supervision as defined in Art. 214 Dire x20 s2cNot belonging to the same group x21 s2cNot included into scope of group supervision x22 s2cPart of combination of methods 1 and 2 that is accounting consolidation-b x23 s2cPart of combination of methods 1 and 2 that is deduction and aggregatio x24 s2cSignificant x25 s2cSolo x26 s2cSolo [life activity] x27 s2cSolo [non-life activity] x28 s2cNot aggregated x29 s2cMethod 2: Other sectoral Rules x30 s2cOther Method x31 s2cNot included into scope of group supervision (art. 214 a) x32 s2cNot included into scope of group supervision (art. 214 b) x33 s2cNot included into scope of group supervision (art. 214 c) x34 s2cRegular reporting x35 s2cAd-hoc reporting x36 s2cInitial submission x37 s2cRe-submission x38 s2cNo sub-group information x39 s2cSub-group information x40 s2cMethod 1: Sectoral rules x41 s2cMethod 1 x42 s2cOther than method 1 x43 s2cRe-submission of S.30 templates in accordance with instructions of the te x44 s2cEmpty submission x45 s2c

Page 361: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modified date Count Comment7/7/2014 07/7/2014 27/7/2014 77/7/2014 12/31/2013 17/7/2014 27/7/2014 47/7/2014 9/30/2015 17/7/2014 17/7/2014 17/7/2014 9/30/2015 37/7/2014 9/30/2015 37/7/2014 9/30/2015 37/7/2014 9/30/2015 37/7/2014 27/7/2014 77/7/2014 9/30/2015 37/7/2014 37/7/2014 17/7/2014 77/7/2014 27/7/2014 9/30/2015 37/7/2014 27/7/2014 17/7/2014 12/31/2013 37/7/2014 12/31/2013 37/7/2014 17/7/2014 77/7/2014 9/30/2015 17/7/2014 9/30/2015 17/7/2014 9/30/2015 17/7/2014 9/30/2015 37/7/2014 37/7/2014 27/7/2014 27/7/2014 2

9/30/2015 29/30/2015 29/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 29/30/2015 19/30/2015 17/15/2017 17/15/2017 2

Page 362: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name Hierarchy nSign1: Consolidation scope

Solo x26 SoloSolo [life activity] x27 Solo [life activity]Solo [non-life activity] x28 Solo [non-life activity]

Group x18 GroupAccounting consolidation-based method [method 1] and combination ox3 Accounting consolidation-based method [method 1] and combination of methods 1 and 2

Accounting consolidation-based method [method 1] x2 Accounting consolidation-based method [method 1]Combination of methods 1 and 2 x5 Combination of methods 1 and 2

Deduction and aggregation method [method 2] x14 Deduction and aggregation method [method 2]2: Relation to group

Belonging to the same group x4 Belonging to the same groupIncluded into scope of group supervision x19 Included into scope of group supervisionNot included into scope of group supervision x22 Not included into scope of group supervisio

Not included into scope of group supervision (art. 214 a) x32 Not included into scope of group supervision (art. 214 a)Not included into scope of group supervision (art. 214 b) x33 Not included into scope of group supervision (art. 214 b)Not included into scope of group supervision (art. 214 c) x34 Not included into scope of group supervision (art. 214 c)

Not belonging to the same group x21 Not belonging to the same group3: Level of influence

Dominant x17 1 - DominantSignificant x25 2 - Significant

4: Consolidated capital requirement or soloAggregated x6 1 - AggregatedNot aggregated x29 2 – Not aggregated

5: Methodology used for group solvency calculationSolo x26 SoloGroup x18 Group

Consolidation method 1 used for group solvency assessment of at leastx7 Consolidation method 1 used for group solvency assessment of at least one undertaking in Consolidation method 1 used for group solvency assessment of none unx8 Consolidation method 1 used for group solvency assessment of none undertaking in the sc

6: Methodology used for group solvency calculationSolo x26 SoloGroup x18 Group =

Method 1: Full consolidation x10 Method 1: Full consoliMethod 1: Proportional consolidation x11 Method 1: ProportionaMethod 1: Adjusted equity method x9 Method 1: Adjusted eMethod 2: Solvency II x15 Method 2: Solvency IIMethod 2: Other sectoral Rules x30 Method 2: Other sectoMethod 2: Local rules x12 Method 2: Local rulesDeduction of the participation in relation to article 229 of Directive 2 x16 Deduction of the partiNo inclusion in the scope of group supervision as defined in Art. 214 D x20 No inclusion in the scOther Method x31 Other Method

7: Methodology used for group solvency calculationSolo x26 SoloGroup x18 Group =

Accounting consolidation-based method [method 1] x2 Accounting consolidaDeduction and aggregation method [method 2] x14 Deduction and aggregCombination of methods 1 and 2 x5 Combination of metho

8: Consolidation scopeSolo x26 SoloGroup x18 Group

9: Consolidation scope

Page 363: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Solo x26 SoloGroup x18 Group

Accounting consolidation-based method [method 1 and part of combinax1 Accounting consolidation-based method [method 1 and part of combination of methods 1 aAccounting consolidation-based method [method 1] x2 Accounting consolidation-based method [method 1]Part of combination of methods 1 and 2 that is accounting consolidatx23 Part of combination of methods 1 and 2 that is accounting consolidation-based

Deduction and aggregation method [method 2 and part of combinationx13 Deduction and aggregation method [method 2 and part of combination of methods 1 and 2Deduction and aggregation method [method 2] x14 Deduction and aggregation method [method 2]Part of combination of methods 1 and 2 that is deduction and aggre x24 Part of combination of methods 1 and 2 that is deduction and aggregation method

10: Method of group solvency calculation used (contribution to group TP)Solo x26 SoloGroup x18 Group

Accounting consolidation-based method [method 1] x2 1 - Method 1Deduction and aggregation method [method 2] x14 2 - Method 2

11: Relation to groupBelonging to the same group x4 1 – Belonging to the same groupNot belonging to the same group x21 2 – Not belonging to the same group

12: Regular/Ad-hoc submission (solo)Regular reporting x35 1 - Regular reportingAd-hoc reporting x36 2 - Ad-hoc reportingRe-submission of S.30 templates in accordance with instructions of the x44 3 – Re-submission of S.30 templates in accordance with instructions of the templateEmpty submission x45 4 – Empty submission

13: Initial submission or re-submissionInitial submission x37 1 – Initial submissionRe-submission x38 2 – Re-submission

14: Sub-group informationNo sub-group information x39 1 - No sub-group informationSub-group information x40 2 - Sub-group information

15: Method of group solvency calculation used (Basic information)Accounting consolidation-based method [method 1] x2 1 - Method 1 is used exclusivelyDeduction and aggregation method [method 2] x14 2 - Method 2 is used exclusivelyCombination of methods 1 and 2 x5 3 - A combination of method 1 and method 2 is used

16: Methodology used for group solvency calculationMethod 1: Full consolidation x10 1 - Method 1: Full consolidationMethod 1: Proportional consolidation x11 2 - Method 1: Proportional consolidationMethod 1: Adjusted equity method x9 3 - Method 1: Adjusted equity methodMethod 1: Sectoral rules x41 4 - Method 1: Sectoral rulesMethod 2: Solvency II x15 5 - Method 2: Solvency IIMethod 2: Other sectoral Rules x30 6 - Method 2: Other sectoral RulesMethod 2: Local rules x12 7 - Method 2: Local rulesDeduction of the participation in relation to article 229 of Directive 200 x16 8 - Deduction of the participation in relation to article 229 of Directive 2009/138/ECNo inclusion in the scope of group supervision as defined in Art. 214 Di x20 9 - No inclusion in the scope of group supervision as defined in Art. 214 Directive 2009/138Other Method x31 10 - Other method

17: Methodology used for group solvency calculationAccounting consolidation-based method [method 1 and part of combinatx1 Accounting consolidation-based method [method 1 and part of combination of methods 1 a

Accounting consolidation-based method [method 1] x2 Accounting consolidation-based method [method 1]Part of combination of methods 1 and 2 that is accounting consolidati x23 Part of combination of methods 1 and 2 that is accounting consolidation-based

Deduction and aggregation method [method 2 and part of combination ox13 Deduction and aggregation method [method 2 and part of combination of methods 1 and 2Deduction and aggregation method [method 2] x14 Deduction and aggregation method [method 2]Part of combination of methods 1 and 2 that is deduction and aggrega x24 Part of combination of methods 1 and 2 that is deduction and aggregation method

18: Methodology used for group solvency calculationAccounting consolidation-based method [method 1] x2 Accounting consolidation-based method [method 1]

Page 364: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Deduction and aggregation method [method 2] x14 Deduction and aggregation method [method 2]Combination of methods 1 and 2 x5 Combination of methods 1 and 2

Part of combination of methods 1 and 2 that is accounting consolidati x23 Part of combination of methods 1 and 2 that is accounting consolidation-basedPart of combination of methods 1 and 2 that is deduction and aggrega x24 Part of combination of methods 1 and 2 that is deduction and aggregation method

19: Methodology used for group solvency calculationMethod 1 x42 Method 1

Method 1: Full consolidation x10 Method 1: Full consolidationMethod 1: Proportional consolidation x11 Method 1: Proportional consolidationMethod 1: Adjusted equity method x9 Method 1: Adjusted equity methodMethod 1: Sectoral rules x41 Method 1: Sectoral rules

Other than method 1 x43 Other than method 1Method 2: Solvency II x15 Method 2: Solvency IIMethod 2: Other sectoral Rules x30 Method 2: Other sectoral RulesMethod 2: Local rules x12 Method 2: Local rulesDeduction of the participation in relation to article 229 of Directive 2 x16 Deduction of the participation in relation to article 229 of Directive 2009/138/ECNo inclusion in the scope of group supervision as defined in Art. 214 D x20 No inclusion in the scope of group supervision as defined in Art. 214 Directive 2009/138/ECOther Method x31 Other Method

20: Relation to groupIncluded into scope of group supervision x19 1 - Included in the scopeNot included into scope of group supervision (art. 214 a) x32 2 - Not included in the scope (art. 214 a)Not included into scope of group supervision (art. 214 b) x33 3 - Not included in the scope (art. 214 b)Not included into scope of group supervision (art. 214 c) x34 4 - Not included in the scope (art. 214 c)

21: Regular/Ad-hoc submission (group)Regular reporting x35 1 - Regular reportingAd-hoc reporting x36 2 - Ad-hoc reportingEmpty submission x45 4 – Empty submission

Page 365: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Weight Owner Usable Applicable Applicable sheets for dro Creation dates2c CS 7/7/2014

7/7/20147/7/2014

Solo [non-life activity] 7/7/20147/7/2014

Accounting consolidation-based method [method 1] and combination of methods 1 and 2 7/7/2014Accounting consolidation-based method [method 1] 7/7/2014Combination of methods 1 and 2 7/7/2014Deduction and aggregation method [method 2] 7/7/2014

s2c RO 7/7/2014Belonging to the same group 7/7/2014Included into scope of group supervision 7/7/2014Not included into scope of group supervisio no 7/7/2014Not included into scope of group supervision (art. 214 a) 7/7/2014Not included into scope of group supervision (art. 214 b) 7/7/2014Not included into scope of group supervision (art. 214 c) 7/7/2014Not belonging to the same group 7/7/2014

s2c N/A S.32.01 (201) 7/7/20147/7/20147/7/2014

s2c N/A S.34.01 (201) 7/7/20147/7/20147/7/2014

s2c CS 7/7/20147/7/20147/7/2014

Consolidation method 1 used for group solvency assessment of at least one undertaking in 7/7/2014Consolidation method 1 used for group solvency assessment of none undertaking in the sc 7/7/2014

s2c CS 7/7/20147/7/20147/7/2014

+ 7/7/2014+ 7/7/2014+ 7/7/2014+ 7/7/2014+ 7/7/2014+ 7/7/2014+ 7/7/2014+ 7/7/2014+ 7/7/2014

s2c CS 7/7/20147/7/20147/7/2014

+ 7/7/2014+ 7/7/2014+ 7/7/2014

s2c CS 7/7/20147/7/20147/7/2014

s2c CS 7/7/2014

Page 366: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/2014

Accounting consolidation-based method [method 1 and part of combination of methods 1 a 7/7/2014Accounting consolidation-based method [method 1] 7/7/2014Part of combination of methods 1 and 2 that is accounting consolidation-based 7/7/2014Deduction and aggregation method [method 2 and part of combination of methods 1 and 2 7/7/2014Deduction and aggregation method [method 2] 7/7/2014Part of combination of methods 1 and 2 that is deduction and aggregation method 7/7/2014

s2c CS S.35.01 (201) 7/7/2014no 7/7/2014no 7/7/2014

7/7/20147/7/2014

s2c RO S.03.02 (201), S.03.03 (201 7/7/20141 – Belonging to the same group 7/7/20142 – Not belonging to the same group 7/7/2014

s2c CS S.01.02 (201) 9/30/20159/30/20159/30/2015

3 – Re-submission of S.30 templates in accordance with instructions of the template 7/15/20174 – Empty submission 7/15/2017

s2c CS S.01.02 (201) 9/30/20159/30/20159/30/2015

s2c CS S.01.02 (201) 9/30/20151 - No sub-group information 9/30/20152 - Sub-group information 9/30/2015

s2c CM S.01.02 (201) 9/30/20151 - Method 1 is used exclusively 7/7/20142 - Method 2 is used exclusively 7/7/20143 - A combination of method 1 and method 2 is used 7/7/2014

s2c CM S.32.01 (201) 9/30/20151 - Method 1: Full consolidation 7/7/20142 - Method 1: Proportional consolidation 7/7/20143 - Method 1: Adjusted equity method 7/7/20144 - Method 1: Sectoral rules 9/30/20155 - Method 2: Solvency II 7/7/20146 - Method 2: Other sectoral Rules 7/7/20147 - Method 2: Local rules 7/7/20148 - Deduction of the participation in relation to article 229 of Directive 2009/138/EC 7/7/20149 - No inclusion in the scope of group supervision as defined in Art. 214 Directive 2009/138 7/7/2014

7/7/2014s2c CM 9/30/2015

Accounting consolidation-based method [method 1 and part of combination of methods 1 a 7/7/2014Accounting consolidation-based method [method 1] 7/7/2014Part of combination of methods 1 and 2 that is accounting consolidation-based 7/7/2014Deduction and aggregation method [method 2 and part of combination of methods 1 and 2 7/7/2014Deduction and aggregation method [method 2] 7/7/2014Part of combination of methods 1 and 2 that is deduction and aggregation method 7/7/2014

s2c CM 9/30/2015Accounting consolidation-based method [method 1] 7/7/2014

Page 367: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Deduction and aggregation method [method 2] 7/7/2014Combination of methods 1 and 2 7/7/2014Part of combination of methods 1 and 2 that is accounting consolidation-based 7/7/2014Part of combination of methods 1 and 2 that is deduction and aggregation method 7/7/2014

s2c CM 9/30/20159/30/2015

Method 1: Full consolidation 7/7/2014Method 1: Proportional consolidation 7/7/2014Method 1: Adjusted equity method 7/7/2014Method 1: Sectoral rules 9/30/2015

9/30/2015Method 2: Solvency II 7/7/2014Method 2: Other sectoral Rules 7/7/2014Method 2: Local rules 7/7/2014Deduction of the participation in relation to article 229 of Directive 2009/138/EC 7/7/2014No inclusion in the scope of group supervision as defined in Art. 214 Directive 2009/138/EC 7/7/2014

7/7/2014s2c RO S.32.01 (201) 9/30/2015

1 - Included in the scope 7/7/20142 - Not included in the scope (art. 214 a) 7/7/20143 - Not included in the scope (art. 214 b) 7/7/20144 - Not included in the scope (art. 214 c) 7/7/2014

s2c CS S.01.02 (220) 7/15/20179/30/20159/30/2015

4 – Empty submission 7/15/2017

Page 368: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modifiedComment

9/30/20159/30/2015

12/31/2013

9/30/20159/30/2015

9/30/2015

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9/30/2015

Page 369: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

12/31/2013

12/31/2013

7/15/2017

9/30/20159/30/20159/30/2015

9/30/20159/30/20159/30/2015

9/30/2015

12/31/2013

12/31/2013

Page 370: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

12/31/201312/31/2013

9/30/20159/30/20159/30/2015

9/30/20159/30/20159/30/2015

9/30/2015

Page 371: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity date Last modTotal/NA x0 yes s2c 7/7/2014EUR EUR s2c 7/7/2014AED AED s2c 7/7/2014AFN AFN s2c 7/7/2014ALL ALL s2c 7/7/2014AMD AMD s2c 7/7/2014ANG ANG s2c 7/7/2014AOA AOA s2c 7/7/2014ARS ARS s2c 7/7/2014AUD AUD s2c 7/7/2014AWG AWG s2c 7/7/2014AZN AZN s2c 7/7/2014BAM BAM s2c 7/7/2014BBD BBD s2c 7/7/2014BDT BDT s2c 7/7/2014BGN BGN s2c 7/7/2014BHD BHD s2c 7/7/2014BIF BIF s2c 7/7/2014BMD BMD s2c 7/7/2014BND BND s2c 7/7/2014BOB BOB s2c 7/7/2014BOV BOV s2c 7/7/2014BRL BRL s2c 7/7/2014BSD BSD s2c 7/7/2014BTN BTN s2c 7/7/2014BWP BWP s2c 7/7/2014BYR BYR s2c 7/7/2014BZD BZD s2c 7/7/2014CAD CAD s2c 7/7/2014CDF CDF s2c 7/7/2014CHE CHE s2c 7/7/2014CHF CHF s2c 7/7/2014CHW CHW s2c 7/7/2014CLF CLF s2c 7/7/2014CLP CLP s2c 7/7/2014CNY CNY s2c 7/7/2014COP COP s2c 7/7/2014COU COU s2c 7/7/2014CRC CRC s2c 7/7/2014CUC CUC s2c 7/7/2014CUP CUP s2c 7/7/2014CVE CVE s2c 7/7/2014CZK CZK s2c 7/7/2014DJF DJF s2c 7/7/2014DKK DKK s2c 7/7/2014DOP DOP s2c 7/7/2014DZD DZD s2c 7/7/2014EEK EEK s2c 7/7/2014EGP EGP s2c 7/7/2014ERN ERN s2c 7/7/2014

Page 372: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ETB ETB s2c 7/7/2014FJD FJD s2c 7/7/2014FKP FKP s2c 7/7/2014GBP GBP s2c 7/7/2014GEL GEL s2c 7/7/2014GHS GHS s2c 7/7/2014GIP GIP s2c 7/7/2014GMD GMD s2c 7/7/2014GNF GNF s2c 7/7/2014GTQ GTQ s2c 7/7/2014GYD GYD s2c 7/7/2014HKD HKD s2c 7/7/2014HNL HNL s2c 7/7/2014HRK HRK s2c 7/7/2014HTG HTG s2c 7/7/2014HUF HUF s2c 7/7/2014IDR IDR s2c 7/7/2014ILS ILS s2c 7/7/2014INR INR s2c 7/7/2014IQD IQD s2c 7/7/2014IRR IRR s2c 7/7/2014ISK ISK s2c 7/7/2014JMD JMD s2c 7/7/2014JOD JOD s2c 7/7/2014JPY JPY s2c 7/7/2014KES KES s2c 7/7/2014KGS KGS s2c 7/7/2014KHR KHR s2c 7/7/2014KMF KMF s2c 7/7/2014KPW KPW s2c 7/7/2014KRW KRW s2c 7/7/2014KWD KWD s2c 7/7/2014KYD KYD s2c 7/7/2014KZT KZT s2c 7/7/2014LAK LAK s2c 7/7/2014LBP LBP s2c 7/7/2014LKR LKR s2c 7/7/2014LRD LRD s2c 7/7/2014LSL LSL s2c 7/7/2014LTL LTL s2c 7/7/2014LVL LVL s2c 7/7/2014LYD LYD s2c 7/7/2014MAD MAD s2c 7/7/2014MDL MDL s2c 7/7/2014MGA MGA s2c 7/7/2014MKD MKD s2c 7/7/2014MMK MMK s2c 7/7/2014MNT MNT s2c 7/7/2014MOP MOP s2c 7/7/2014MRO MRO s2c 7/7/2014MUR MUR s2c 7/7/2014

Page 373: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MVR MVR s2c 7/7/2014MWK MWK s2c 7/7/2014MXN MXN s2c 7/7/2014MXV MXV s2c 7/7/2014MYR MYR s2c 7/7/2014MZN MZN s2c 7/7/2014NAD NAD s2c 7/7/2014NGN NGN s2c 7/7/2014NIO NIO s2c 7/7/2014NOK NOK s2c 7/7/2014NPR NPR s2c 7/7/2014NZD NZD s2c 7/7/2014OMR OMR s2c 7/7/2014PAB PAB s2c 7/7/2014PEN PEN s2c 7/7/2014PGK PGK s2c 7/7/2014PHP PHP s2c 7/7/2014PKR PKR s2c 7/7/2014PLN PLN s2c 7/7/2014PYG PYG s2c 7/7/2014QAR QAR s2c 7/7/2014RON RON s2c 7/7/2014RSD RSD s2c 7/7/2014RUB RUB s2c 7/7/2014RWF RWF s2c 7/7/2014SAR SAR s2c 7/7/2014SBD SBD s2c 7/7/2014SCR SCR s2c 7/7/2014SDG SDG s2c 7/7/2014SEK SEK s2c 7/7/2014SGD SGD s2c 7/7/2014SHP SHP s2c 7/7/2014SLL SLL s2c 7/7/2014SOS SOS s2c 7/7/2014SRD SRD s2c 7/7/2014STD STD s2c 7/7/2014SYP SYP s2c 7/7/2014SZL SZL s2c 7/7/2014THB THB s2c 7/7/2014TJS TJS s2c 7/7/2014TMT TMT s2c 7/7/2014TND TND s2c 7/7/2014TOP TOP s2c 7/7/2014TRY TRY s2c 7/7/2014TTD TTD s2c 7/7/2014TWD TWD s2c 7/7/2014TZS TZS s2c 7/7/2014UAH UAH s2c 7/7/2014UGX UGX s2c 7/7/2014USD USD s2c 7/7/2014USN USN s2c 7/7/2014

Page 374: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

USS USS s2c 7/7/2014UYU UYU s2c 7/7/2014UZS UZS s2c 7/7/2014VEF VEF s2c 7/7/2014VND VND s2c 7/7/2014VUV VUV s2c 7/7/2014WST WST s2c 7/7/2014XAF XAF s2c 7/7/2014XAG XAG s2c 7/7/2014XAU XAU s2c 7/7/2014XBA XBA s2c 7/7/2014XBB XBB s2c 7/7/2014XBC XBC s2c 7/7/2014XBD XBD s2c 7/7/2014XCD XCD s2c 7/7/2014XDR XDR s2c 7/7/2014XFU XFU s2c 7/7/2014XOF XOF s2c 7/7/2014XPD XPD s2c 7/7/2014XPF XPF s2c 7/7/2014XPT XPT s2c 7/7/2014XTS XTS s2c 7/7/2014XXX XXX s2c 7/7/2014 9/30/2015YER YER s2c 7/7/2014ZAR ZAR s2c 7/7/2014ZMK ZMK s2c 7/7/2014ZWL ZWL s2c 7/7/2014Local x1 s2c 7/7/2014Foreign x2 s2c 7/7/2014Reporting currency x3 s2c 7/7/2014Other than reporting currency x4 s2c 7/7/2014SSP SSP s2c 9/30/2015SVC SVC s2c 9/30/2015UYI UYI s2c 9/30/2015ZMW ZMW s2c 9/30/2015XUA XUA s2c 9/30/2015XSU XSU s2c 9/30/2015BYN BYN s2c 7/15/2016

Page 375: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Count Comment Hierarchy4 1: Currency2 Total/NA2 EUR2 AED2 AFN2 ALL2 AMD2 ANG2 AOA2 ARS2 AUD2 AWG2 AZN2 BAM2 BBD2 BDT2 BGN2 BHD2 BIF2 BMD2 BND2 BOB2 BOV2 BRL2 BSD2 BTN2 BWP2 BYN2 BYR2 BZD2 CAD2 CDF2 CHE2 CHF2 CHW2 CLF2 CLP2 CNY2 COP2 COU2 CRC2 CUC2 CUP2 CVE2 CZK2 DJF2 DKK2 DOP2 DZD2 EEK

Page 376: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

2 EGP2 ERN2 ETB2 FJD2 FKP2 GBP2 GEL2 GHS2 GIP2 GMD2 GNF2 GTQ2 GYD2 HKD2 HNL2 HRK2 HTG2 HUF2 IDR2 ILS2 INR2 IQD2 IRR2 ISK2 JMD2 JOD2 JPY2 KES2 KGS2 KHR2 KMF2 KPW2 KRW2 KWD2 KYD2 KZT2 LAK2 LBP2 LKR2 LRD2 LSL2 LTL2 LVL2 LYD2 MAD2 MDL2 MGA2 MKD2 MMK2 MNT2 MOP

Page 377: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

2 MRO2 MUR2 MVR2 MWK2 MXN2 MXV2 MYR2 MZN2 NAD2 NGN2 NIO2 NOK2 NPR2 NZD2 OMR2 PAB2 PEN2 PGK2 PHP2 PKR2 PLN2 PYG2 QAR2 RON2 RSD2 RUB2 RWF2 SAR2 SBD2 SCR2 SDG2 SEK2 SGD2 SHP2 SLL2 SOS2 SRD2 SSP2 STD2 SVC2 SYP2 SZL2 THB2 TJS2 TMT2 TND2 TOP2 TRY2 TTD2 TWD2 TZS

Page 378: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

2 UAH2 UGX2 USD2 USN2 USS2 UYI2 UYU2 UZS2 VEF2 VND2 VUV2 WST2 XAF2 XAG2 XAU2 XBA2 XBB2 XBC2 XBD2 XCD2 XDR2 XFU0 XOF2 XPD2 XPF2 XPT2 XSU2 XTS2 XUA1 YER1 ZAR2 ZMK2 ZMW2 ZWL2 2: Original currency of underlying2 Total/NA2 Local2 Foreign

3: Reporting currencyTotal/NA

Reporting currencyOther than reporting currency

4: Currency of underlyingLocalForeign

5: CurrencyTotal/NA

EURAEDAFNALL

Page 379: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

AMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBOVBRLBSDBTNBWPBYNBYRBZDCADCDFCHECHFCHWCLFCLPCNYCOPCOUCRCCUCCUPCVECZKDJFDKKDOPDZDEEKEGPERNETBFJDFKPGBPGEL

Page 380: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

GHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSINRIQDIRRISKJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLTLLVLLYDMADMDLMGAMKDMMKMNTMOPMROMURMVRMWKMXNMXVMYR

Page 381: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUSNUSSUYIUYU

Page 382: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

UZSVEFVNDVUVWSTXAFXAGXAUXBAXBBXBCXBDXCDXDRXFUXOFXPDXPFXPTXSUXTSXUAYERZARZMKZMWZWL

Page 383: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Hierarchy nSign Weight Owner Usable Applicable Applicable shCreation dates2c CD, OC, RCS.06.02 (201), 7/7/2014

x0 Total/NA = 7/7/2014EUR EUR + 7/7/2014AED AED + 7/7/2014AFN AFN + 7/7/2014ALL ALL + 7/7/2014AMD AMD + 7/7/2014ANG ANG + 7/7/2014AOA AOA + 7/7/2014ARS ARS + 7/7/2014AUD AUD + 7/7/2014AWG AWG + 7/7/2014AZN AZN + 7/7/2014BAM BAM + 7/7/2014BBD BBD + 7/7/2014BDT BDT + 7/7/2014BGN BGN + 7/7/2014BHD BHD + 7/7/2014BIF BIF + 7/7/2014BMD BMD + 7/7/2014BND BND + 7/7/2014BOB BOB + 7/7/2014BOV BOV + 7/7/2014BRL BRL + 7/7/2014BSD BSD + 7/7/2014BTN BTN + 7/7/2014BWP BWP + 7/7/2014BYN BYN + 7/15/2016BYR BYR + 7/7/2014BZD BZD + 7/7/2014CAD CAD + 7/7/2014CDF CDF + 7/7/2014CHE CHE + 7/7/2014CHF CHF + 7/7/2014CHW CHW + 7/7/2014CLF CLF + 7/7/2014CLP CLP + 7/7/2014CNY CNY + 7/7/2014COP COP + 7/7/2014COU COU + 7/7/2014CRC CRC + 7/7/2014CUC CUC + 7/7/2014CUP CUP + 7/7/2014CVE CVE + 7/7/2014CZK CZK + 7/7/2014DJF DJF + 7/7/2014DKK DKK + 7/7/2014DOP DOP + 7/7/2014DZD DZD + 7/7/2014EEK EEK + 7/7/2014

Page 384: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

EGP EGP + 7/7/2014ERN ERN + 7/7/2014ETB ETB + 7/7/2014FJD FJD + 7/7/2014FKP FKP + 7/7/2014GBP GBP + 7/7/2014GEL GEL + 7/7/2014GHS GHS + 7/7/2014GIP GIP + 7/7/2014GMD GMD + 7/7/2014GNF GNF + 7/7/2014GTQ GTQ + 7/7/2014GYD GYD + 7/7/2014HKD HKD + 7/7/2014HNL HNL + 7/7/2014HRK HRK + 7/7/2014HTG HTG + 7/7/2014HUF HUF + 7/7/2014IDR IDR + 7/7/2014ILS ILS + 7/7/2014INR INR + 7/7/2014IQD IQD + 7/7/2014IRR IRR + 7/7/2014ISK ISK + 7/7/2014JMD JMD + 7/7/2014JOD JOD + 7/7/2014JPY JPY + 7/7/2014KES KES + 7/7/2014KGS KGS + 7/7/2014KHR KHR + 7/7/2014KMF KMF + 7/7/2014KPW KPW + 7/7/2014KRW KRW + 7/7/2014KWD KWD + 7/7/2014KYD KYD + 7/7/2014KZT KZT + 7/7/2014LAK LAK + 7/7/2014LBP LBP + 7/7/2014LKR LKR + 7/7/2014LRD LRD + 7/7/2014LSL LSL + 7/7/2014LTL LTL + 7/7/2014LVL LVL + 7/7/2014LYD LYD + 7/7/2014MAD MAD + 7/7/2014MDL MDL + 7/7/2014MGA MGA + 7/7/2014MKD MKD + 7/7/2014MMK MMK + 7/7/2014MNT MNT + 7/7/2014MOP MOP + 7/7/2014

Page 385: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MRO MRO + 7/7/2014MUR MUR + 7/7/2014MVR MVR + 7/7/2014MWK MWK + 7/7/2014MXN MXN + 7/7/2014MXV MXV + 7/7/2014MYR MYR + 7/7/2014MZN MZN + 7/7/2014NAD NAD + 7/7/2014NGN NGN + 7/7/2014NIO NIO + 7/7/2014NOK NOK + 7/7/2014NPR NPR + 7/7/2014NZD NZD + 7/7/2014OMR OMR + 7/7/2014PAB PAB + 7/7/2014PEN PEN + 7/7/2014PGK PGK + 7/7/2014PHP PHP + 7/7/2014PKR PKR + 7/7/2014PLN PLN + 7/7/2014PYG PYG + 7/7/2014QAR QAR + 7/7/2014RON RON + 7/7/2014RSD RSD + 7/7/2014RUB RUB + 7/7/2014RWF RWF + 7/7/2014SAR SAR + 7/7/2014SBD SBD + 7/7/2014SCR SCR + 7/7/2014SDG SDG + 7/7/2014SEK SEK + 7/7/2014SGD SGD + 7/7/2014SHP SHP + 7/7/2014SLL SLL + 7/7/2014SOS SOS + 7/7/2014SRD SRD + 7/7/2014SSP SSP + 9/30/2015STD STD + 7/7/2014SVC SVC + 9/30/2015SYP SYP + 7/7/2014SZL SZL + 7/7/2014THB THB + 7/7/2014TJS TJS + 7/7/2014TMT TMT + 7/7/2014TND TND + 7/7/2014TOP TOP + 7/7/2014TRY TRY + 7/7/2014TTD TTD + 7/7/2014TWD TWD + 7/7/2014TZS TZS + 7/7/2014

Page 386: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

UAH UAH + 7/7/2014UGX UGX + 7/7/2014USD USD + 7/7/2014USN USN + 7/7/2014USS USS + 7/7/2014UYI UYI + 9/30/2015UYU UYU + 7/7/2014UZS UZS + 7/7/2014VEF VEF + 7/7/2014VND VND + 7/7/2014VUV VUV + 7/7/2014WST WST + 7/7/2014XAF XAF + 7/7/2014XAG XAG + 7/7/2014XAU XAU + 7/7/2014XBA XBA + 7/7/2014XBB XBB + 7/7/2014XBC XBC + 7/7/2014XBD XBD + 7/7/2014XCD XCD + 7/7/2014XDR XDR + 7/7/2014XFU XFU + 7/7/2014XOF XOF + 7/7/2014XPD XPD + 7/7/2014XPF XPF + 7/7/2014XPT XPT + 7/7/2014XSU XSU + 9/30/2015XTS XTS + 7/7/2014XUA XUA + 9/30/2015YER YER + 7/7/2014ZAR ZAR + 7/7/2014ZMK ZMK + 7/7/2014ZMW ZMW + 9/30/2015ZWL ZWL + 7/7/2014

s2c N/A 7/7/2014x0 Total/NA = 7/7/2014x1 Local + 7/7/2014x2 Foreign + 7/7/2014

s2c RC 7/7/2014x0 Total/NA = 7/7/2014x3 Reporting currency + 7/7/2014x4 Other than reporting + 7/7/2014

s2c CD S.06.03 (201) 7/7/2014x1 1 - Reporting currency 7/7/2014x2 2 - Foreign currency 7/7/2014

s2c CD, OC, RCS.01.02 (201), 9/30/2015x0 Total/NA no 7/7/2014EUR EUR 7/7/2014AED AED 7/7/2014AFN AFN 7/7/2014ALL ALL 7/7/2014

Page 387: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

AMD AMD 7/7/2014ANG ANG 7/7/2014AOA AOA 7/7/2014ARS ARS 7/7/2014AUD AUD 7/7/2014AWG AWG 7/7/2014AZN AZN 7/7/2014BAM BAM 7/7/2014BBD BBD 7/7/2014BDT BDT 7/7/2014BGN BGN 7/7/2014BHD BHD 7/7/2014BIF BIF 7/7/2014BMD BMD 7/7/2014BND BND 7/7/2014BOB BOB 7/7/2014BOV BOV 7/7/2014BRL BRL 7/7/2014BSD BSD 7/7/2014BTN BTN 7/7/2014BWP BWP 7/7/2014BYN BYN 7/15/2016BYR BYR 7/7/2014BZD BZD 7/7/2014CAD CAD 7/7/2014CDF CDF 7/7/2014CHE CHE 7/7/2014CHF CHF 7/7/2014CHW CHW 7/7/2014CLF CLF 7/7/2014CLP CLP 7/7/2014CNY CNY 7/7/2014COP COP 7/7/2014COU COU 7/7/2014CRC CRC 7/7/2014CUC CUC 7/7/2014CUP CUP 7/7/2014CVE CVE 7/7/2014CZK CZK 7/7/2014DJF DJF 7/7/2014DKK DKK 7/7/2014DOP DOP 7/7/2014DZD DZD 7/7/2014EEK EEK 7/7/2014EGP EGP 7/7/2014ERN ERN 7/7/2014ETB ETB 7/7/2014FJD FJD 7/7/2014FKP FKP 7/7/2014GBP GBP 7/7/2014GEL GEL 7/7/2014

Page 388: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

GHS GHS 7/7/2014GIP GIP 7/7/2014GMD GMD 7/7/2014GNF GNF 7/7/2014GTQ GTQ 7/7/2014GYD GYD 7/7/2014HKD HKD 7/7/2014HNL HNL 7/7/2014HRK HRK 7/7/2014HTG HTG 7/7/2014HUF HUF 7/7/2014IDR IDR 7/7/2014ILS ILS 7/7/2014INR INR 7/7/2014IQD IQD 7/7/2014IRR IRR 7/7/2014ISK ISK 7/7/2014JMD JMD 7/7/2014JOD JOD 7/7/2014JPY JPY 7/7/2014KES KES 7/7/2014KGS KGS 7/7/2014KHR KHR 7/7/2014KMF KMF 7/7/2014KPW KPW 7/7/2014KRW KRW 7/7/2014KWD KWD 7/7/2014KYD KYD 7/7/2014KZT KZT 7/7/2014LAK LAK 7/7/2014LBP LBP 7/7/2014LKR LKR 7/7/2014LRD LRD 7/7/2014LSL LSL 7/7/2014LTL LTL 7/7/2014LVL LVL 7/7/2014LYD LYD 7/7/2014MAD MAD 7/7/2014MDL MDL 7/7/2014MGA MGA 7/7/2014MKD MKD 7/7/2014MMK MMK 7/7/2014MNT MNT 7/7/2014MOP MOP 7/7/2014MRO MRO 7/7/2014MUR MUR 7/7/2014MVR MVR 7/7/2014MWK MWK 7/7/2014MXN MXN 7/7/2014MXV MXV 7/7/2014MYR MYR 7/7/2014

Page 389: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MZN MZN 7/7/2014NAD NAD 7/7/2014NGN NGN 7/7/2014NIO NIO 7/7/2014NOK NOK 7/7/2014NPR NPR 7/7/2014NZD NZD 7/7/2014OMR OMR 7/7/2014PAB PAB 7/7/2014PEN PEN 7/7/2014PGK PGK 7/7/2014PHP PHP 7/7/2014PKR PKR 7/7/2014PLN PLN 7/7/2014PYG PYG 7/7/2014QAR QAR 7/7/2014RON RON 7/7/2014RSD RSD 7/7/2014RUB RUB 7/7/2014RWF RWF 7/7/2014SAR SAR 7/7/2014SBD SBD 7/7/2014SCR SCR 7/7/2014SDG SDG 7/7/2014SEK SEK 7/7/2014SGD SGD 7/7/2014SHP SHP 7/7/2014SLL SLL 7/7/2014SOS SOS 7/7/2014SRD SRD 7/7/2014SSP SSP 9/30/2015STD STD 7/7/2014SVC SVC 9/30/2015SYP SYP 7/7/2014SZL SZL 7/7/2014THB THB 7/7/2014TJS TJS 7/7/2014TMT TMT 7/7/2014TND TND 7/7/2014TOP TOP 7/7/2014TRY TRY 7/7/2014TTD TTD 7/7/2014TWD TWD 7/7/2014TZS TZS 7/7/2014UAH UAH 7/7/2014UGX UGX 7/7/2014USD USD 7/7/2014USN USN 7/7/2014USS USS 7/7/2014UYI UYI 9/30/2015UYU UYU 7/7/2014

Page 390: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

UZS UZS 7/7/2014VEF VEF 7/7/2014VND VND 7/7/2014VUV VUV 7/7/2014WST WST 7/7/2014XAF XAF 7/7/2014XAG XAG 7/7/2014XAU XAU 7/7/2014XBA XBA 7/7/2014XBB XBB 7/7/2014XBC XBC 7/7/2014XBD XBD 7/7/2014XCD XCD 7/7/2014XDR XDR 7/7/2014XFU XFU 7/7/2014XOF XOF 7/7/2014XPD XPD 7/7/2014XPF XPF 7/7/2014XPT XPT 7/7/2014XSU XSU 9/30/2015XTS XTS 7/7/2014XUA XUA 9/30/2015YER YER 7/7/2014ZAR ZAR 7/7/2014ZMK ZMK 7/7/2014ZMW ZMW 9/30/2015ZWL ZWL 7/7/2014

Page 391: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modifiedComment7/15/2016

Page 392: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 393: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 394: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

7/15/2017

Page 395: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 396: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 397: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 398: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 399: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity dateNA x0 yes s2c 7/7/2014Age of beneficiaries [years] x1 s2c 7/7/2014Delta x2 s2c 7/7/2014Quantity x3 s2c 7/7/2014Residual modified duration x4 s2c 7/7/2014Residual modified duration of liabilities x5 s2c 9/30/2015Residual modified duration of obligationsx6 s2c 9/30/2015Years x7 s2c 9/30/2015 12/31/2013Run off period x8 s2c 9/30/2015Modified duration x9 s2c 9/30/2015Macaulay duration [months] x10 s2c 7/15/2016Macaulay duration [years] x11 s2c 7/15/2016Macaulay duration of the insurance and rx12 s2c 7/15/2016

Page 400: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modifi Count Comment Hierarchy Name Hierarchy n0 1: Types of decimal1 Delta x2 Delta1 Residual modified duration x4 Residual modified duration1 Residual modified duration of liabilities x5 Residual modified duration of liabilities1 Residual modified duration of obligations x6 Residual modified duration of obligations1 Age of beneficiaries [years] x1 Age of beneficiaries [years]1 Quantity x3 Quantity1 Years x7 Years1 Run off period x8 Run off period1 Modified duration x9 Modified duration1 Macaulay duration [months] x10 Macaulay duration [months]1 Macaulay duration [years] x11 Macaulay duration [years]1 Macaulay duration of the insurance and reinsurancex12 Macaulay duration of the insurance and reinsurance obligations [years]

Page 401: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Sign Weight Owner Usable Applicable Applicable Creation date Validity dates2c DC 7/7/2014

7/7/2014Residual modified duration 7/7/2014Residual modified duration of liabilities 9/30/2015Residual modified duration of obligations 9/30/2015Age of beneficiaries [years] 7/7/2014

7/7/20149/30/2015 12/31/2013

Run off period 9/30/2015Modified duration 9/30/2015Macaulay duration [months] 7/15/2016Macaulay duration [years] 7/15/2016Macaulay duration of the insurance and reinsurance obligations [years] 7/15/2016

Page 402: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modified date Comment9/30/2015

Page 403: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity date Last modifi CountEnd x0 yes s2c 7/7/2014 1Beginning x1 s2c 7/7/2014 1Duration x2 s2c 7/7/2014 1Instant x4 s2c 7/7/2014 1Year to Date x5 s2c 7/7/2014 112 Months x6 s2c 7/7/2014 113-24 previousx7 s2c 9/30/2015 1

Page 404: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Comment Hierarchy Name Hierarchy nSign Weight Owner Usable1: Instant or duration s2c

Instant x4 InstantBeginning x1 BeginningEnd x0 End

Duration x2 DurationYear to Date x5 Year to Date12 Months x6 12 Months13-24 previous montx7 13-24 previous months

Page 405: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable Applicable sheets for dropdowns Creation date Validity date Last modified dateDI 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/2015

Page 406: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Comment

Page 407: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity date Last modifi CountSolvency II x0 yes s2c 7/7/2014 12/31/2013 1

Page 408: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 409: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Comment Hierarchy Name Hierarchy nSign Weight Owner Usable1: Datapoint Owner s2c

Solvency II x0 Solvency II

Page 410: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable Applicable Creation date Validity date Last modifi CommentN/A 7/7/2014

7/7/2014 12/31/2013

Page 411: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation dateValidity dateTotal/NA x0 yes s2c 7/7/2014Tier 1 – restricted x1 s2c 7/7/2014Ancillary own funds x2 s2c 7/7/2014Attributable to shareholders x3 s2c 7/7/2014Available to meet MCR criteria x4 s2c 7/7/2014Available to meet SCR criteria x5 s2c 7/7/2014Basic or ancillary own funds x6 s2c 7/7/2014Basic own funds x7 s2c 7/7/2014Tier 1 – unrestricted x8 s2c 7/7/2014Counted under transitionals x9 s2c 7/7/2014Eligible for undertaking x10 s2c 7/7/2014 12/31/2013Eligible to meet MCR criteria x11 s2c 7/7/2014Eligible to meet minimum SCR criteria x12 s2c 7/7/2014Eligible to meet SCR [other than minimum] crx13 s2c 7/7/2014 12/31/2013Eligible to meet SCR criteria x14 s2c 7/7/2014Items for which a method was approved x15 s2c 7/7/2014Items for which an amount was approved x16 s2c 7/7/2014Not available to meet MCR criteria x17 s2c 7/7/2014 12/31/2013Not available to meet SCR criteria x18 s2c 7/7/2014Not basic nor ancillary own funds x19 s2c 7/7/2014Not eligible to meet MCR criteria x20 s2c 7/7/2014 12/31/2013Not restricted x21 s2c 7/7/2014 9/30/2015Other than ancillary own funds x22 s2c 7/7/2014Other than counted under transitionals x23 s2c 7/7/2014Restricted x24 s2c 7/7/2014 9/30/2015Subordinated liabilities x25 s2c 7/7/2014 7/15/2016Tier 1 x26 s2c 7/7/2014Tier 1 and Tier 2 x27 s2c 7/7/2014Tier 2 x28 s2c 7/7/2014Tier 2 and Tier 3 x29 s2c 7/7/2014 12/31/2013Tier 3 x30 s2c 7/7/2014Type 1 Equity x31 s2c 7/7/2014 7/15/2016Type 2 Equity x32 s2c 7/7/2014 7/15/2016Other than basic own funds x33 s2c 7/7/2014Not available to meet SCR criteria [due to locax34 s2c 7/7/2014Not available to meet SCR criteria [other thanx35 s2c 7/7/2014

Page 412: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modified date Count Comment Hierarchy Name12 1: Solvency II own funds eligibility

9/30/2015 2 Total/NA x02 Basic or ancillary own funds x61 Basic own funds x71 Ancillary own funds x21 Items for which an amount was approx161 Items for which a method was approv x152 Not basic nor ancillary own funds x19

9/30/2015 2 2: Tiers2 Total/NA x01 Tier 1 and Tier 2 x271 Tier 1 x261 Tier 1 – unrestricted x81 Tier 1 – restricted x11 Tier 2 x281 Tier 3 x301 3: Tiers1 Total/NA x01 Tier 1 x261 Tier 2 and Tier 3 x291 Tier 2 x281 Tier 3 x301 4: Types of equity2 Total/NA x01 Type 1 Equity x311 Type 2 Equity x324 Subordinated liabilities x251 5: Treatment in relation to ring fencing4 Total/NA x01 Restricted x244 Not restricted x211 6: Tiers1 Total/NA x01 Tier 1 x261 Tier 2 x281 Tier 3 x30

7: Solvency II own funds eligibilityTotal/NA x0

Ancillary own funds x2Other than ancillary own funds x22

8: Counting under transitionalsTotal/NA x0

Counted under transitionals x9Other than counted under transitionals x23

9: Availability to meet SCR criteriaTotal/NA x0

Available to meet SCR criteria x5Eligible to meet SCR criteria x14

Eligible to meet minimum SCR criteria x12Eligible to meet SCR [other than minimx13

Page 413: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Not available to meet SCR criteria x18Not available to meet SCR criteria [due tox34Not available to meet SCR criteria [otherx35

10: Availability to meet MCR criteriaTotal/NA x0

Available to meet MCR criteria x4Eligible to meet MCR criteria x11Not eligible to meet MCR criteria x20

Not available to meet MCR criteria x1711: Availability of excess of assets over liabilities for RFF or MP

Total/NA x0Attributable to shareholders x3Eligible for undertaking x10

12: Solvency II own funds eligibilityTotal/NA x0

Basic own funds x7Other than basic own funds x33

13: TiersTier 1 x26Tier 1 – unrestricted x8Tier 1 – restricted x1Tier 2 x28Tier 3 x30

14: Counting under transitionalsCounted under transitionals x9Other than counted under transitionals x23

Page 414: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy nSign Weight Owner Usable Applicable Applicable Creation dates2c BE 7/7/2014

Total/NA = 7/7/2014Basic or an = + 7/7/2014Basic own funds + 7/7/2014Ancillary own funds + 7/7/2014Items for which an amount was approved 7/7/2014Items for which a method was approved 7/7/2014Not basic nor ancillar + 7/7/2014

s2c TX 7/7/2014Total/NA = 7/7/2014Tier 1 and T= + 7/7/2014Tier 1 = + 7/7/2014Tier 1 – unrestricted + 7/7/2014Tier 1 – restricted + 7/7/2014Tier 2 + 7/7/2014Tier 3 + 7/7/2014

s2c TX 7/7/2014Total/NA = 7/7/2014Tier 1 + 7/7/2014Tier 2 and T= + 7/7/2014Tier 2 + 7/7/2014Tier 3 + 7/7/2014

s2c OE 7/7/2014Total/NA = 7/7/2014Type 1 Equity + 7/7/2014Type 2 Equity + 7/7/2014Subordinated liabilitie+ 7/7/2014

s2c N/A 7/7/2014Total/NA = 7/7/2014Restricted + 7/7/2014Not restricted + 7/7/2014

s2c TX 7/7/2014Total/NA = 7/7/2014Tier 1 + 7/7/2014Tier 2 + 7/7/2014Tier 3 + 7/7/2014

s2c BE S.03.02 (20 7/7/2014Total/NA = 7/7/20141 - Ancillary own fund+ 7/7/20142 - Not an ancillary o + 7/7/2014

s2c LV 7/7/2014Total/NA = 7/7/2014Counted under transit+ 7/7/2014Other than counted un+ 7/7/2014

s2c MS 7/7/2014Total/NA = 7/7/2014Available t >= + 7/7/2014Eligible to = + 7/7/2014Eligible to meet minim+ 7/7/2014Eligible to meet SCR [ + 7/7/2014

Page 415: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Not availab= + 7/7/2014Not available to meet S+ 7/7/2014Not available to meet S+ 7/7/2014

s2c MX 7/7/2014Total/NA = 7/7/2014Available t = + 7/7/2014Eligible to meet MCR c+ 7/7/2014Not eligible to meet M+ 7/7/2014Not available to meet + 7/7/2014

11: Availability of excess of assets over liabilities for RFF or MP s2c AA 7/7/2014Total/NA = 7/7/2014Attributable to shareh+ 7/7/2014Eligible for undertakin+ 7/7/2014

s2c BE 7/7/2014Total/NA = 7/7/2014Basic own funds + 7/7/2014Other than basic own + 7/7/2014

s2c TX S.23.04 (20 9/30/20151 - Tier 1 7/7/20142 - Tier 1 – unrestricted 7/7/20143 - Tier 1 – restricted 7/7/20144 - Tier 2 7/7/20145 - Tier 3 7/7/2014

s2c LV S.23.04 (20 7/7/20141- Counted under transitionals 7/7/20142- Not counted under transitionals 7/7/2014

Page 416: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modified Comment

9/30/20159/30/2015

12/31/2013

7/15/2016

7/15/20167/15/20167/15/2016

9/30/20159/30/2015

12/31/2013

Page 417: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

12/31/201312/31/2013

12/31/2013

9/30/20159/30/2015

Page 418: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity dateTotal/NA x0 yes s2c 7/7/201410 biggest x1 s2c 7/7/2014 12/31/201310th biggest x2 s2c 7/7/20141st and 2nd biggest x3 s2c 7/7/2014 12/31/20131st biggest x4 s2c 7/7/20142nd biggest x5 s2c 7/7/20143rd biggest x6 s2c 7/7/20144th biggest x7 s2c 7/7/20145th biggest x8 s2c 7/7/20146th biggest x9 s2c 7/7/20147th biggest x10 s2c 7/7/20148th biggest x11 s2c 7/7/20149th biggest x12 s2c 7/7/2014Assets exposure x13 s2c 7/7/2014Exposure other than reinsurancex14 s2c 7/7/2014 12/31/2013Liabilities exposure x15 s2c 7/7/2014Other than 10 biggest x16 s2c 7/7/2014 12/31/2013Receivables from intermediaries x17 s2c 7/7/2014 9/30/2015Reinsurance exposure x18 s2c 7/7/2014Type 2 exposures other than recex19 s2c 7/7/2014 9/30/2015Assets – Bonds x20 s2c 9/30/2015Assets – Equity x21 s2c 9/30/2015Assets - reinsurance x22 s2c 9/30/2015Assets – others x23 s2c 9/30/2015Liabilitites – insurance x24 s2c 9/30/2015Liabilities – loans x25 s2c 9/30/2015Liabilities – debts x26 s2c 9/30/2015Liabilities – others x27 s2c 9/30/2015Off-balance-sheet (contingent assx28 s2c 9/30/2015Off-balance-sheet (contingent liabx29 s2c 9/30/2015Type 1 Equity x30 s2c 7/15/2016Type 2 Equity x31 s2c 7/15/2016Subordinated liabilities x32 s2c 7/15/2016Qualifying infrastructure equitiesx33 s2c 7/15/2016Bonds and loans x34 s2c 7/15/2016Bonds and loans (qualifying infra x35 s2c 7/15/2016Bonds and loans (other than qualix36 s2c 7/15/2016Credit derivatives x37 s2c 7/15/2016Securitisation positions x38 s2c 7/15/2016Type 1 securitisations x39 s2c 7/15/2016Type 2 securitisations x40 s2c 7/15/2016Resecuritisations x41 s2c 7/15/2016

Page 419: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modifi Count Comment Hierarchy Name Hierarchy nSign Weight5 1: Exposure types1 Total/NA x0 Total/NA =1 10 biggest x1 10 biggest = +1 1st and 2nd biggest x3 1st and 2nd= +1 1st biggest x4 1st biggest +1 2nd biggest x5 2nd biggest +1 3rd biggest x6 3rd biggest +1 4th biggest x7 4th biggest +1 5th biggest x8 5th biggest +1 6th biggest x9 6th biggest +1 7th biggest x10 7th biggest +1 8th biggest x11 8th biggest +1 9th biggest x12 9th biggest +1 10th biggest x2 10th biggest +1 Other than 10 biggest x16 Other than 10 biggest +1 2: Exposure types1 Total/NA x0 Total/NA =1 Receivables from intermedix17 Receivables from inte +1 Type 2 exposures other thax19 Type 2 exposures othe+1 3: Exposure types1 Assets exposure x13 Assets exposure1 Liabilities exposure x15 Liabilities exposure1 4: Exposure types1 Total/NA x0 Total/NA =1 Reinsurance exposure x18 Reinsurance exposure+1 Exposure other than reinsux14 Exposure other than r+1 5: Exposure types1 Assets – Bonds x20 1 - Assets – bonds1 Assets – Equity x21 2 - Assets – equity1 Assets - reinsurance x22 3 - Assets - reinsurance1 Assets – others x23 4 - Assets – others1 Liabilitites – insurance x24 5 - Liabilities – insurance1 Liabilities – loans x25 6 - Liabilities – loans1 Liabilities – debts x26 7 - Liabilities – debts1 Liabilities – others x27 8 - Liabilities – others1 Off-balance-sheet (contingentx28 9 - Off-balance-sheet (contingent asset)1 Off-balance-sheet (contingent x29 10 – Off-balance-sheet (contingent liability)1 6: Exposures to equity risk1 Total/NA x0 Total/NA =1 Type 1 Equity x30 Type 1 Equity +1 Type 2 Equity x31 Type 2 Equity +1 Subordinated liabilities x32 Subordinated liabilitie+

Qualifying infrastructure eqx33 Qualifying infrastructu+7: Exposures to spread risk

Total/NA x0 Total/NA =Bonds and loans x34 Bonds and = +

Bonds and loans (qualifyinx35 Bonds and loans (quali+Bonds and loans (other thax36 Bonds and loans (other+

Credit derivatives x37 Credit derivatives +Securitisation positions x38 Securitisati = +

Page 420: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Type 1 securitisations x39 Type 1 securitisations +Type 2 securitisations x40 Type 2 securitisations +Resecuritisations x41 Resecuritisations +

Page 421: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Owner Usable Applicable Applicable sheets fo Creation date Validity dates2c EX 7/7/2014

7/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/2013

s2c EX 7/7/20147/7/20147/7/2014 9/30/20157/7/2014 9/30/2015

s2c EX 7/7/20147/7/20147/7/2014

s2c EX 7/7/20147/7/20147/7/20147/7/2014 12/31/2013

s2c EX S.37.01 (201) 9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

9 - Off-balance-sheet (contingent asset) 9/30/201510 – Off-balance-sheet (contingent liability) 9/30/2015

s2c ET S.24.01 (210), S/SR.2 7/15/20167/7/2014

7/15/20167/15/20167/15/20167/15/2016

s2c ET S/SR.26.01 (210) 7/15/20167/7/2014

7/15/20167/15/20167/15/20167/15/20167/15/2016

Page 422: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/20167/15/20167/15/2016

Page 423: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modified date Comment9/30/2015

Page 424: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation dateNot applicable/All geographical areas x0 yes s2c 7/7/2014AFGHANISTAN AF s2c 7/7/2014ÅLAND ISLANDS AX s2c 7/7/2014ALBANIA AL s2c 7/7/2014ALGERIA DZ s2c 7/7/2014AMERICAN SAMOA AS s2c 7/7/2014ANDORRA AD s2c 7/7/2014ANGOLA AO s2c 7/7/2014ANGUILLA AI s2c 7/7/2014ANTARCTICA AQ s2c 7/7/2014ANTIGUA AND BARBUDA AG s2c 7/7/2014ARGENTINA AR s2c 7/7/2014ARMENIA AM s2c 7/7/2014ARUBA AW s2c 7/7/2014AUSTRALIA AU s2c 7/7/2014AUSTRIA AT s2c 7/7/2014AZERBAIJAN AZ s2c 7/7/2014BAHAMAS BS s2c 7/7/2014BAHRAIN BH s2c 7/7/2014BANGLADESH BD s2c 7/7/2014BARBADOS BB s2c 7/7/2014BELARUS BY s2c 7/7/2014BELGIUM BE s2c 7/7/2014BELIZE BZ s2c 7/7/2014BENIN BJ s2c 7/7/2014BERMUDA BM s2c 7/7/2014BHUTAN BT s2c 7/7/2014BOLIVIA, PLURINATIONAL STATE OF BO s2c 7/7/2014BONAIRE, SINT EUSTATIUS AND SABA BQ s2c 7/7/2014BOSNIA AND HERZEGOVINA BA s2c 7/7/2014BOTSWANA BW s2c 7/7/2014BOUVET ISLAND BV s2c 7/7/2014BRAZIL BR s2c 7/7/2014BRITISH INDIAN OCEAN TERRITORY IO s2c 7/7/2014BRUNEI DARUSSALAM BN s2c 7/7/2014BULGARIA BG s2c 7/7/2014BURKINA FASO BF s2c 7/7/2014BURUNDI BI s2c 7/7/2014CAMBODIA KH s2c 7/7/2014CAMEROON CM s2c 7/7/2014CANADA CA s2c 7/7/2014CAPE VERDE CV s2c 7/7/2014CAYMAN ISLANDS KY s2c 7/7/2014CENTRAL AFRICAN REPUBLIC CF s2c 7/7/2014CHAD TD s2c 7/7/2014CHILE CL s2c 7/7/2014CHINA CN s2c 7/7/2014CHRISTMAS ISLAND CX s2c 7/7/2014COCOS (KEELING) ISLANDS CC s2c 7/7/2014COLOMBIA CO s2c 7/7/2014

Page 425: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

COMOROS KM s2c 7/7/2014CONGO CG s2c 7/7/2014CONGO, THE DEMOCRATIC REPUBLIC OF THE CD s2c 7/7/2014COOK ISLANDS CK s2c 7/7/2014COSTA RICA CR s2c 7/7/2014CÔTE D'IVOIRE CI s2c 7/7/2014CROATIA HR s2c 7/7/2014CUBA CU s2c 7/7/2014CURAÇAO CW s2c 7/7/2014CYPRUS CY s2c 7/7/2014CZECH REPUBLIC CZ s2c 7/7/2014DENMARK DK s2c 7/7/2014DJIBOUTI DJ s2c 7/7/2014DOMINICA DM s2c 7/7/2014DOMINICAN REPUBLIC DO s2c 7/7/2014ECUADOR EC s2c 7/7/2014EGYPT EG s2c 7/7/2014EL SALVADOR SV s2c 7/7/2014EQUATORIAL GUINEA GQ s2c 7/7/2014ERITREA ER s2c 7/7/2014ESTONIA EE s2c 7/7/2014ETHIOPIA ET s2c 7/7/2014FALKLAND ISLANDS (MALVINAS) FK s2c 7/7/2014FAROE ISLANDS FO s2c 7/7/2014FIJI FJ s2c 7/7/2014FINLAND FI s2c 7/7/2014FRANCE FR s2c 7/7/2014FRENCH GUIANA GF s2c 7/7/2014FRENCH POLYNESIA PF s2c 7/7/2014FRENCH SOUTHERN TERRITORIES TF s2c 7/7/2014GABON GA s2c 7/7/2014GAMBIA GM s2c 7/7/2014GEORGIA GE s2c 7/7/2014GERMANY DE s2c 7/7/2014GHANA GH s2c 7/7/2014UNITED KINGDOM (GIBRALTAR) GI s2c 7/7/2014GREECE GR s2c 7/7/2014GREENLAND GL s2c 7/7/2014GRENADA GD s2c 7/7/2014GUADELOUPE GP s2c 7/7/2014GUAM GU s2c 7/7/2014GUATEMALA GT s2c 7/7/2014GUERNSEY GG s2c 7/7/2014GUINEA GN s2c 7/7/2014GUINEA-BISSAU GW s2c 7/7/2014GUYANA GY s2c 7/7/2014HAITI HT s2c 7/7/2014HEARD ISLAND AND MCDONALD ISLANDS HM s2c 7/7/2014HOLY SEE (VATICAN CITY STATE) VA s2c 7/7/2014HONDURAS HN s2c 7/7/2014HONG KONG HK s2c 7/7/2014

Page 426: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

HUNGARY HU s2c 7/7/2014ICELAND IS s2c 7/7/2014INDIA IN s2c 7/7/2014INDONESIA ID s2c 7/7/2014IRAN, ISLAMIC REPUBLIC OF IR s2c 7/7/2014IRAQ IQ s2c 7/7/2014IRELAND IE s2c 7/7/2014ISLE OF MAN IM s2c 7/7/2014ISRAEL IL s2c 7/7/2014ITALY IT s2c 7/7/2014JAMAICA JM s2c 7/7/2014JAPAN JP s2c 7/7/2014JERSEY JE s2c 7/7/2014JORDAN JO s2c 7/7/2014KAZAKHSTAN KZ s2c 7/7/2014KENYA KE s2c 7/7/2014KIRIBATI KI s2c 7/7/2014KOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF KP s2c 7/7/2014KOREA, REPUBLIC OF KR s2c 7/7/2014KUWAIT KW s2c 7/7/2014KYRGYZSTAN KG s2c 7/7/2014LAO PEOPLE'S DEMOCRATIC REPUBLIC LA s2c 7/7/2014LATVIA LV s2c 7/7/2014LEBANON LB s2c 7/7/2014LESOTHO LS s2c 7/7/2014LIBERIA LR s2c 7/7/2014LIBYA LY s2c 7/7/2014LIECHTENSTEIN LI s2c 7/7/2014LITHUANIA LT s2c 7/7/2014LUXEMBOURG LU s2c 7/7/2014MACAO MO s2c 7/7/2014MACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMK s2c 7/7/2014MADAGASCAR MG s2c 7/7/2014MALAWI MW s2c 7/7/2014MALAYSIA MY s2c 7/7/2014MALDIVES MV s2c 7/7/2014MALI ML s2c 7/7/2014MALTA MT s2c 7/7/2014MARSHALL ISLANDS MH s2c 7/7/2014MARTINIQUE MQ s2c 7/7/2014MAURITANIA MR s2c 7/7/2014MAURITIUS MU s2c 7/7/2014MAYOTTE YT s2c 7/7/2014MEXICO MX s2c 7/7/2014MICRONESIA, FEDERATED STATES OF FM s2c 7/7/2014MOLDOVA, REPUBLIC OF MD s2c 7/7/2014MONACO MC s2c 7/7/2014MONGOLIA MN s2c 7/7/2014MONTENEGRO ME s2c 7/7/2014MONTSERRAT MS s2c 7/7/2014MOROCCO MA s2c 7/7/2014

Page 427: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MOZAMBIQUE MZ s2c 7/7/2014MYANMAR MM s2c 7/7/2014NAMIBIA NA s2c 7/7/2014NAURU NR s2c 7/7/2014NEPAL NP s2c 7/7/2014NETHERLANDS NL s2c 7/7/2014NEW CALEDONIA NC s2c 7/7/2014NEW ZEALAND NZ s2c 7/7/2014NICARAGUA NI s2c 7/7/2014NIGER NE s2c 7/7/2014NIGERIA NG s2c 7/7/2014NIUE NU s2c 7/7/2014NORFOLK ISLAND NF s2c 7/7/2014NORTHERN MARIANA ISLANDS MP s2c 7/7/2014NORWAY NO s2c 7/7/2014OMAN OM s2c 7/7/2014PAKISTAN PK s2c 7/7/2014PALAU PW s2c 7/7/2014PALESTINIAN TERRITORY, OCCUPIED PS s2c 7/7/2014PANAMA PA s2c 7/7/2014PAPUA NEW GUINEA PG s2c 7/7/2014PARAGUAY PY s2c 7/7/2014PERU PE s2c 7/7/2014PHILIPPINES PH s2c 7/7/2014PITCAIRN PN s2c 7/7/2014POLAND PL s2c 7/7/2014PORTUGAL PT s2c 7/7/2014PUERTO RICO PR s2c 7/7/2014QATAR QA s2c 7/7/2014RÉUNION RE s2c 7/7/2014ROMANIA RO s2c 7/7/2014RUSSIAN FEDERATION RU s2c 7/7/2014RWANDA RW s2c 7/7/2014SAINT BARTHÉLEMY BL s2c 7/7/2014SAINT HELENA, ASCENSION AND TRISTAN DA CUNH SH s2c 7/7/2014SAINT KITTS AND NEVIS KN s2c 7/7/2014SAINT LUCIA LC s2c 7/7/2014SAINT MARTIN (FRENCH PART) MF s2c 7/7/2014SAINT PIERRE AND MIQUELON PM s2c 7/7/2014SAINT VINCENT AND THE GRENADINES VC s2c 7/7/2014SAMOA WS s2c 7/7/2014SAN MARINO SM s2c 7/7/2014SAO TOME AND PRINCIPE ST s2c 7/7/2014SAUDI ARABIA SA s2c 7/7/2014SENEGAL SN s2c 7/7/2014SERBIA RS s2c 7/7/2014SEYCHELLES SC s2c 7/7/2014SIERRA LEONE SL s2c 7/7/2014SINGAPORE SG s2c 7/7/2014SINT MAARTEN (DUTCH PART) SX s2c 7/7/2014SLOVAKIA SK s2c 7/7/2014

Page 428: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SLOVENIA SI s2c 7/7/2014SOLOMON ISLANDS SB s2c 7/7/2014SOMALIA SO s2c 7/7/2014SOUTH AFRICA ZA s2c 7/7/2014SOUTH GEORGIA AND THE SOUTH SANDWICH ISLANGS s2c 7/7/2014SPAIN ES s2c 7/7/2014SRI LANKA LK s2c 7/7/2014SUDAN SD s2c 7/7/2014SURINAME SR s2c 7/7/2014SVALBARD AND JAN MAYEN SJ s2c 7/7/2014SWAZILAND SZ s2c 7/7/2014SWEDEN SE s2c 7/7/2014SWITZERLAND CH s2c 7/7/2014SYRIAN ARAB REPUBLIC SY s2c 7/7/2014TAIWAN, PROVINCE OF CHINA TW s2c 7/7/2014TAJIKISTAN TJ s2c 7/7/2014TANZANIA, UNITED REPUBLIC OF TZ s2c 7/7/2014THAILAND TH s2c 7/7/2014TIMOR-LESTE TL s2c 7/7/2014TOGO TG s2c 7/7/2014TOKELAU TK s2c 7/7/2014TONGA TO s2c 7/7/2014TRINIDAD AND TOBAGO TT s2c 7/7/2014TUNISIA TN s2c 7/7/2014TURKEY TR s2c 7/7/2014TURKMENISTAN TM s2c 7/7/2014TURKS AND CAICOS ISLANDS TC s2c 7/7/2014TUVALU TV s2c 7/7/2014UGANDA UG s2c 7/7/2014UKRAINE UA s2c 7/7/2014UNITED ARAB EMIRATES AE s2c 7/7/2014UNITED KINGDOM GB s2c 7/7/2014UNITED STATES US s2c 7/7/2014UNITED STATES MINOR OUTLYING ISLANDS UM s2c 7/7/2014URUGUAY UY s2c 7/7/2014UZBEKISTAN UZ s2c 7/7/2014VANUATU VU s2c 7/7/2014VENEZUELA, BOLIVARIAN REPUBLIC OF VE s2c 7/7/2014VIET NAM VN s2c 7/7/2014VIRGIN ISLANDS, BRITISH VG s2c 7/7/2014VIRGIN ISLANDS, U.S. VI s2c 7/7/2014WALLIS AND FUTUNA WF s2c 7/7/2014WESTERN SAHARA EH s2c 7/7/2014YEMEN YE s2c 7/7/2014ZAMBIA ZM s2c 7/7/2014ZIMBABWE ZW s2c 7/7/2014European Union institutions EU s2c 7/7/2014Supranational Issuers XA s2c 7/7/2014SOUTH SUDAN SS s2c 7/7/20141st biggest x1 s2c 7/7/20142nd biggest x2 s2c 7/7/2014

Page 429: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

31 countries for health catastrophe risk - mass acc x3 s2c 7/7/20143rd biggest x4 s2c 7/7/20144th biggest x5 s2c 7/7/20145 biggest x6 s2c 7/7/20145th biggest x7 s2c 7/7/2014Caribbean and Central America x8 s2c 7/7/2014Central and Western Asia x9 s2c 7/7/2014Collectivity of Saint Martin x10 s2c 7/7/2014Eastern Asia x12 s2c 7/7/2014Eastern South America x13 s2c 7/7/2014EEA x14 s2c 7/7/2014EEA countries [other than home country] x15 s2c 7/7/2014Federal Republic of Germany x16 s2c 7/7/2014French Republic x17 s2c 7/7/2014French Republic [except Guadeloupe, Martinique, thex18 s2c 7/7/2014French Republic [except Guadeloupe, Martinique, the x20 s2c 7/7/2014Grand Duchy of Luxemburg x21 s2c 7/7/2014Hellenic Republic x23 s2c 7/7/2014Home country x24 s2c 7/7/2014Italian Republic x26 s2c 7/7/2014ITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATEx27 s2c 7/7/2014Kingdom of Belgium x28 s2c 7/7/2014Kingdom of Denmark x29 s2c 7/7/2014Kingdom of Norway x30 s2c 7/7/2014Kingdom of Spain x31 s2c 7/7/2014SPAIN; ANDORRA x32 s2c 7/7/2014Kingdom of Sweden x33 s2c 7/7/2014Kingdom of the Netherlands x34 s2c 7/7/2014Mid-west United States of America x36 s2c 7/7/2014Non-EEA x37 s2c 7/7/2014North-east United States of America x38 s2c 7/7/2014Northern Africa x39 s2c 7/7/2014Northern America excluding the United States of Amx40 s2c 7/7/2014Northern, southern and western South America x41 s2c 7/7/2014Not EEA countries x42 s2c 7/7/2014Oceania x43 s2c 7/7/2014OECD [non-EEA] x44 s2c 7/7/2014Other than 31 countries for health catastrophe risk x45 s2c 7/7/2014Other than 5 biggest x46 s2c 7/7/2014Portuguese Republic x47 s2c 7/7/2014Republic of Austria x48 s2c 7/7/2014Republic of Bulgaria x49 s2c 7/7/2014Republic of Croatia x50 s2c 7/7/2014Republic of Cyprus x51 s2c 7/7/2014Republic of Estonia x52 s2c 7/7/2014Republic of Finland x53 s2c 7/7/2014Republic of Hungary x54 s2c 7/7/2014Republic of Iceland x55 s2c 7/7/2014Republic of Latvia x56 s2c 7/7/2014Republic of Lithuania x57 s2c 7/7/2014Republic of Malta x58 s2c 7/7/2014

Page 430: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Republic of Poland x59 s2c 7/7/2014Republic of Slovenia x60 s2c 7/7/2014RoW [rest of the world] x63 s2c 7/7/2014Slovak Republic x64 s2c 7/7/2014South and South-Eastern Asia x65 s2c 7/7/2014South-east United States of America x66 s2c 7/7/2014Southern Africa x67 s2c 7/7/2014Swiss Confederation x68 s2c 7/7/2014SWITZERLAND; LIECHTENSTEIN x69 s2c 7/7/2014United Kingdom of Great Britain and Northern Irela x70 s2c 7/7/2014Western United States of America x71 s2c 7/7/20145 biggest and home country x72 s2c 9/30/2015Other than 5 biggest and home country x73 s2c 9/30/2015Other than home country x74 s2c 9/30/2015Local x75 s2c 9/30/2015Not local x76 s2c 9/30/2015Not local [EEA] x77 s2c 9/30/2015Euro area x78 s2c 9/30/2015Non-euro area x79 s2c 9/30/2015Euro area other than home country x80 s2c 9/30/2015FRANCE; MONACO; ANDORRA x81 s2c 9/30/201535 countries for health catastrophe risk - mass acc x82 s2c 9/30/2015Other than 35 countries for health catastrophe risk x83 s2c 9/30/2015Northern Europe x84 s2c 9/30/2015Western Europe x85 s2c 9/30/2015Eastern Europe x86 s2c 9/30/2015Southern Europe x87 s2c 9/30/2015Aggregated countries due to application of threshol AA s2c 9/30/2015Specified Regions explicitly subject to windstorm ris x88 s2c 9/30/2015Other Regions subject to windstorm risk charge x89 s2c 9/30/2015Other Northern Europe Regions subject to windstormx90 s2c 9/30/2015Other Western European Regions subject to windstox91 s2c 9/30/2015Other Eastern European Regions subject to windstorx92 s2c 9/30/2015Other Southern European Regions subject to windstox93 s2c 9/30/2015Specified Regions explicitly subject to earthquake ri x94 s2c 9/30/2015Other Regions subject to earthquake risk charge x95 s2c 9/30/2015Other Northern Europe Regions subject to earthquakx96 s2c 9/30/2015Other Western European Regions subject to earthquax97 s2c 9/30/2015Other Eastern European Regions subject to earthquax98 s2c 9/30/2015Other Southern European Regions subject to earthqux99 s2c 9/30/2015Specified Regions explicitly subject to flood risk charx100 s2c 9/30/2015Other Regions subject to flood risk charge x101 s2c 9/30/2015Other Northern Europe Regions subject to flood risk x102 s2c 9/30/2015Other Western European Regions subject to flood ri x103 s2c 9/30/2015Other Eastern European Regions subject to flood ris x104 s2c 9/30/2015Other Southern European Regions subject to flood rix105 s2c 9/30/2015Specified Regions explicitly subject to hail risk charg x106 s2c 9/30/2015Other Regions subject to hail risk charge x107 s2c 9/30/2015Other Northern Europe Regions subject to hail risk c x108 s2c 9/30/2015Other Western European Regions subject to hail riskx109 s2c 9/30/2015Other Eastern European Regions subject to hail risk x110 s2c 9/30/2015

Page 431: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other Southern European Regions subject to hail ris x111 s2c 9/30/2015

Page 432: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modified datCount Comment27

99999

1099999999

13999999

13999999999999

1199999999999999

Page 433: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

999999

1099

101610

999999999999999999999

139

7/15/2016 1010

99

1499999999

1099

Page 434: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1110

9999

1299999999999999999999

109

119999999

109

14999999

109999

Page 435: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

99999

1199999999

109999999999

1110

99

1214

999999

12999

1099999999

11

Page 436: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

119999

1199999

1010

999999999999999999

11999999999999993

7/15/2017 39

12/31/2013 212/31/2013 2

Page 437: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015 9/30/2015 112/31/2013 212/31/2013 2

212/31/2013 2

992999251223241

9/30/2015 85221

9/30/2015 223979999291

9/30/2015 19/30/2015 1

253221132112

Page 438: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

33139991

9/30/2015 9391

9/30/2015 11111

9/30/2015 11161111111

7/15/2016 111111

7/15/2016 111111

7/15/2016 111111

7/15/2016 11111

Page 439: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1

Page 440: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name1: Countries

Not applicable/All geographical areas x0AFGHANISTAN AFÅLAND ISLANDS AXALBANIA ALALGERIA DZAMERICAN SAMOA ASANDORRA ADANGOLA AOANTARCTICA AQANTIGUA AND BARBUDA AGARGENTINA ARARMENIA AMARUBA AWAUSTRALIA AUAUSTRIA ATAZERBAIJAN AZBAHAMAS BSBAHRAIN BHBANGLADESH BDBARBADOS BBBELARUS BYBELGIUM BEBELIZE BZBENIN BJBHUTAN BTBOLIVIA, PLURINATIONAL STATE OF BOBONAIRE, SINT EUSTATIUS AND SABA BQBOSNIA AND HERZEGOVINA BABOTSWANA BWBOUVET ISLAND BVBRAZIL BRBRUNEI DARUSSALAM BNBULGARIA BGBURKINA FASO BFBURUNDI BICAMBODIA KHCAMEROON CMCANADA CACAPE VERDE CVCENTRAL AFRICAN REPUBLIC CFCHAD TDCHILE CLCHINA CNCHRISTMAS ISLAND CXCOCOS (KEELING) ISLANDS CCCOLOMBIA COCOMOROS KMCONGO CGCONGO, THE DEMOCRATIC REPUBLIC OF THE CD

Page 441: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

COOK ISLANDS CKCOSTA RICA CRCÔTE D'IVOIRE CICROATIA HRCUBA CUCURAÇAO CWCYPRUS CYCZECH REPUBLIC CZDENMARK DKDJIBOUTI DJDOMINICA DMDOMINICAN REPUBLIC DOECUADOR ECEGYPT EGEL SALVADOR SVEQUATORIAL GUINEA GQERITREA ERESTONIA EEETHIOPIA ETFAROE ISLANDS FOFIJI FJFINLAND FIFRANCE FRFRENCH GUIANA GFFRENCH POLYNESIA PFFRENCH SOUTHERN TERRITORIES TFGABON GAGAMBIA GMGEORGIA GEGERMANY DEGHANA GHGREECE GRGREENLAND GLGRENADA GDGUADELOUPE GPGUAM GUGUATEMALA GTGUERNSEY GGGUINEA GNGUINEA-BISSAU GWGUYANA GYHAITI HTHEARD ISLAND AND MCDONALD ISLANDS HMHOLY SEE (VATICAN CITY STATE) VAHONDURAS HNHONG KONG HKHUNGARY HUICELAND ISINDIA ININDONESIA IDIRAN, ISLAMIC REPUBLIC OF IR

Page 442: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

IRAQ IQIRELAND IEISLE OF MAN IMISRAEL ILITALY ITJAMAICA JMJAPAN JPJERSEY JEJORDAN JOKAZAKHSTAN KZKENYA KEKIRIBATI KIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF KPKOREA, REPUBLIC OF KRKUWAIT KWKYRGYZSTAN KGLAO PEOPLE'S DEMOCRATIC REPUBLIC LALATVIA LVLEBANON LBLESOTHO LSLIBERIA LRLIBYA LYLIECHTENSTEIN LILITHUANIA LTLUXEMBOURG LUMACAO MOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF MKMADAGASCAR MGMALAWI MWMALAYSIA MYMALDIVES MVMALI MLMALTA MTMARSHALL ISLANDS MHMARTINIQUE MQMAURITANIA MRMAURITIUS MUMAYOTTE YTMEXICO MXMICRONESIA, FEDERATED STATES OF FMMOLDOVA, REPUBLIC OF MDMONACO MCMONGOLIA MNMONTENEGRO MEMOROCCO MAMOZAMBIQUE MZMYANMAR MMNAMIBIA NANAURU NRNEPAL NPNETHERLANDS NL

Page 443: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

NEW CALEDONIA NCNEW ZEALAND NZNICARAGUA NINIGER NENIGERIA NGNIUE NUNORFOLK ISLAND NFNORTHERN MARIANA ISLANDS MPNORWAY NOOMAN OMPAKISTAN PKPALAU PWPALESTINIAN TERRITORY, OCCUPIED PSPANAMA PAPAPUA NEW GUINEA PGPARAGUAY PYPERU PEPHILIPPINES PHPOLAND PLPORTUGAL PTPUERTO RICO PRQATAR QARÉUNION REROMANIA RORUSSIAN FEDERATION RURWANDA RWSAINT BARTHÉLEMY BLSAINT KITTS AND NEVIS KNSAINT LUCIA LCSAINT MARTIN (FRENCH PART) MFSAINT PIERRE AND MIQUELON PMSAINT VINCENT AND THE GRENADINES VCSAMOA WSSAN MARINO SMSAO TOME AND PRINCIPE STSAUDI ARABIA SASENEGAL SNSERBIA RSSEYCHELLES SCSIERRA LEONE SLSINGAPORE SGSINT MAARTEN (DUTCH PART) SXSLOVAKIA SKSLOVENIA SISOLOMON ISLANDS SBSOMALIA SOSOUTH AFRICA ZASPAIN ESSRI LANKA LKSUDAN SDSURINAME SR

Page 444: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SVALBARD AND JAN MAYEN SJSWAZILAND SZSWEDEN SESWITZERLAND CHSYRIAN ARAB REPUBLIC SYTAIWAN, PROVINCE OF CHINA TWTAJIKISTAN TJTANZANIA, UNITED REPUBLIC OF TZTHAILAND THTIMOR-LESTE TLTOGO TGTOKELAU TKTONGA TOTRINIDAD AND TOBAGO TTTUNISIA TNTURKEY TRTURKMENISTAN TMTUVALU TVUGANDA UGUKRAINE UAUNITED ARAB EMIRATES AEUNITED KINGDOM GB

ANGUILLA AIBERMUDA BMBRITISH INDIAN OCEAN TERRITORY IOVIRGIN ISLANDS, BRITISH VGCAYMAN ISLANDS KYFALKLAND ISLANDS (MALVINAS) FKUNITED KINGDOM (GIBRALTAR) GIMONTSERRAT MSPITCAIRN PNSAINT HELENA, ASCENSION AND TRISTAN DA CUNHA SHSOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDS GSTURKS AND CAICOS ISLANDS TC

UNITED STATES USUNITED STATES MINOR OUTLYING ISLANDS UMURUGUAY UYUZBEKISTAN UZVANUATU VUVENEZUELA, BOLIVARIAN REPUBLIC OF VEVIET NAM VNVIRGIN ISLANDS, U.S. VIWALLIS AND FUTUNA WFWESTERN SAHARA EHYEMEN YEZAMBIA ZMZIMBABWE ZWSOUTH SUDAN SS

2: EEA or not EEANot applicable/All geographical areas x0

EEA x14

Page 445: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Home country x24EEA countries [other than home country] x15

Not EEA countries x423: Countries by amount of gross premiums written

Not applicable/All geographical areas x05 biggest x6

1st biggest x12nd biggest x23rd biggest x44th biggest x55th biggest x7

Other than 5 biggest x464: Issuer country/country of residence

Not applicable/All geographical areas x0AFGHANISTAN AFÅLAND ISLANDS AXALBANIA ALALGERIA DZAMERICAN SAMOA ASANDORRA ADANGOLA AOANGUILLA AIANTARCTICA AQANTIGUA AND BARBUDA AGARGENTINA ARARMENIA AMARUBA AWAUSTRALIA AUAUSTRIA ATAZERBAIJAN AZBAHAMAS BSBAHRAIN BHBANGLADESH BDBARBADOS BBBELARUS BYBELGIUM BEBELIZE BZBENIN BJBERMUDA BMBHUTAN BTBOLIVIA, PLURINATIONAL STATE OF BOBONAIRE, SINT EUSTATIUS AND SABA BQBOSNIA AND HERZEGOVINA BABOTSWANA BWBOUVET ISLAND BVBRAZIL BRBRITISH INDIAN OCEAN TERRITORY IOBRUNEI DARUSSALAM BNBULGARIA BGBURKINA FASO BFBURUNDI BI

Page 446: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

CAMBODIA KHCAMEROON CMCANADA CACAPE VERDE CVCAYMAN ISLANDS KYCENTRAL AFRICAN REPUBLIC CFCHAD TDCHILE CLCHINA CNCHRISTMAS ISLAND CXCOCOS (KEELING) ISLANDS CCCOLOMBIA COCOMOROS KMCONGO CGCONGO, THE DEMOCRATIC REPUBLIC OF THE CDCOOK ISLANDS CKCOSTA RICA CRCÔTE D'IVOIRE CICROATIA HRCUBA CUCURAÇAO CWCYPRUS CYCZECH REPUBLIC CZDENMARK DKDJIBOUTI DJDOMINICA DMDOMINICAN REPUBLIC DOECUADOR ECEGYPT EGEL SALVADOR SVEQUATORIAL GUINEA GQERITREA ERESTONIA EEETHIOPIA ETFALKLAND ISLANDS (MALVINAS) FKFAROE ISLANDS FOFIJI FJFINLAND FIFRANCE FRFRENCH GUIANA GFFRENCH POLYNESIA PFFRENCH SOUTHERN TERRITORIES TFGABON GAGAMBIA GMGEORGIA GEGERMANY DEGHANA GHUNITED KINGDOM (GIBRALTAR) GIGREECE GRGREENLAND GLGRENADA GD

Page 447: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

GUADELOUPE GPGUAM GUGUATEMALA GTGUERNSEY GGGUINEA GNGUINEA-BISSAU GWGUYANA GYHAITI HTHEARD ISLAND AND MCDONALD ISLANDS HMHOLY SEE (VATICAN CITY STATE) VAHONDURAS HNHONG KONG HKHUNGARY HUICELAND ISINDIA ININDONESIA IDIRAN, ISLAMIC REPUBLIC OF IRIRAQ IQIRELAND IEISLE OF MAN IMISRAEL ILITALY ITJAMAICA JMJAPAN JPJERSEY JEJORDAN JOKAZAKHSTAN KZKENYA KEKIRIBATI KIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF KPKOREA, REPUBLIC OF KRKUWAIT KWKYRGYZSTAN KGLAO PEOPLE'S DEMOCRATIC REPUBLIC LALATVIA LVLEBANON LBLESOTHO LSLIBERIA LRLIBYA LYLIECHTENSTEIN LILITHUANIA LTLUXEMBOURG LUMACAO MOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF MKMADAGASCAR MGMALAWI MWMALAYSIA MYMALDIVES MVMALI MLMALTA MTMARSHALL ISLANDS MH

Page 448: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MARTINIQUE MQMAURITANIA MRMAURITIUS MUMAYOTTE YTMEXICO MXMICRONESIA, FEDERATED STATES OF FMMOLDOVA, REPUBLIC OF MDMONACO MCMONGOLIA MNMONTENEGRO MEMONTSERRAT MSMOROCCO MAMOZAMBIQUE MZMYANMAR MMNAMIBIA NANAURU NRNEPAL NPNETHERLANDS NLNEW CALEDONIA NCNEW ZEALAND NZNICARAGUA NINIGER NENIGERIA NGNIUE NUNORFOLK ISLAND NFNORTHERN MARIANA ISLANDS MPNORWAY NOOMAN OMPAKISTAN PKPALAU PWPALESTINIAN TERRITORY, OCCUPIED PSPANAMA PAPAPUA NEW GUINEA PGPARAGUAY PYPERU PEPHILIPPINES PHPITCAIRN PNPOLAND PLPORTUGAL PTPUERTO RICO PRQATAR QARÉUNION REROMANIA RORUSSIAN FEDERATION RURWANDA RWSAINT BARTHÉLEMY BLSAINT HELENA, ASCENSION AND TRISTAN DA CUNHA SHSAINT KITTS AND NEVIS KNSAINT LUCIA LCSAINT MARTIN (FRENCH PART) MFSAINT PIERRE AND MIQUELON PM

Page 449: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SAINT VINCENT AND THE GRENADINES VCSAMOA WSSAN MARINO SMSAO TOME AND PRINCIPE STSAUDI ARABIA SASENEGAL SNSERBIA RSSEYCHELLES SCSIERRA LEONE SLSINGAPORE SGSINT MAARTEN (DUTCH PART) SXSLOVAKIA SKSLOVENIA SISOLOMON ISLANDS SBSOMALIA SOSOUTH AFRICA ZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDS GSSOUTH SUDAN SSSPAIN ESSRI LANKA LKSUDAN SDSURINAME SRSVALBARD AND JAN MAYEN SJSWAZILAND SZSWEDEN SESWITZERLAND CHSYRIAN ARAB REPUBLIC SYTAIWAN, PROVINCE OF CHINA TWTAJIKISTAN TJTANZANIA, UNITED REPUBLIC OF TZTHAILAND THTIMOR-LESTE TLTOGO TGTOKELAU TKTONGA TOTRINIDAD AND TOBAGO TTTUNISIA TNTURKEY TRTURKMENISTAN TMTURKS AND CAICOS ISLANDS TCTUVALU TVUGANDA UGUKRAINE UAUNITED ARAB EMIRATES AEUNITED KINGDOM GBUNITED STATES USUNITED STATES MINOR OUTLYING ISLANDS UMURUGUAY UYUZBEKISTAN UZVANUATU VUVENEZUELA, BOLIVARIAN REPUBLIC OF VE

Page 450: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

VIET NAM VNVIRGIN ISLANDS, BRITISH VGVIRGIN ISLANDS, U.S. VIWALLIS AND FUTUNA WFWESTERN SAHARA EHYEMEN YEZAMBIA ZMZIMBABWE ZWEuropean Union institutions EUSupranational Issuers XA

5: Country of authorisationNot applicable/All geographical areas x0

AFGHANISTAN AFÅLAND ISLANDS AXALBANIA ALALGERIA DZAMERICAN SAMOA ASANDORRA ADANGOLA AOANGUILLA AIANTARCTICA AQANTIGUA AND BARBUDA AGARGENTINA ARARMENIA AMARUBA AWAUSTRALIA AUAUSTRIA ATAZERBAIJAN AZBAHAMAS BSBAHRAIN BHBANGLADESH BDBARBADOS BBBELARUS BYBELGIUM BEBELIZE BZBENIN BJBERMUDA BMBHUTAN BTBOLIVIA, PLURINATIONAL STATE OF BOBONAIRE, SINT EUSTATIUS AND SABA BQBOSNIA AND HERZEGOVINA BABOTSWANA BWBOUVET ISLAND BVBRAZIL BRBRITISH INDIAN OCEAN TERRITORY IOBRUNEI DARUSSALAM BNBULGARIA BGBURKINA FASO BFBURUNDI BICAMBODIA KHCAMEROON CM

Page 451: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

CANADA CACAPE VERDE CVCAYMAN ISLANDS KYCENTRAL AFRICAN REPUBLIC CFCHAD TDCHILE CLCHINA CNCHRISTMAS ISLAND CXCOCOS (KEELING) ISLANDS CCCOLOMBIA COCOMOROS KMCONGO CGCONGO, THE DEMOCRATIC REPUBLIC OF THE CDCOOK ISLANDS CKCOSTA RICA CRCÔTE D'IVOIRE CICROATIA HRCUBA CUCURAÇAO CWCYPRUS CYCZECH REPUBLIC CZDENMARK DKDJIBOUTI DJDOMINICA DMDOMINICAN REPUBLIC DOECUADOR ECEGYPT EGEL SALVADOR SVEQUATORIAL GUINEA GQERITREA ERESTONIA EEETHIOPIA ETFALKLAND ISLANDS (MALVINAS) FKFAROE ISLANDS FOFIJI FJFINLAND FIFRANCE FRFRENCH GUIANA GFFRENCH POLYNESIA PFFRENCH SOUTHERN TERRITORIES TFGABON GAGAMBIA GMGEORGIA GEGERMANY DEGHANA GHUNITED KINGDOM (GIBRALTAR) GIGREECE GRGREENLAND GLGRENADA GDGUADELOUPE GPGUAM GU

Page 452: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

GUATEMALA GTGUERNSEY GGGUINEA GNGUINEA-BISSAU GWGUYANA GYHAITI HTHEARD ISLAND AND MCDONALD ISLANDS HMHOLY SEE (VATICAN CITY STATE) VAHONDURAS HNHONG KONG HKHUNGARY HUICELAND ISINDIA ININDONESIA IDIRAN, ISLAMIC REPUBLIC OF IRIRAQ IQIRELAND IEISLE OF MAN IMISRAEL ILITALY ITJAMAICA JMJAPAN JPJERSEY JEJORDAN JOKAZAKHSTAN KZKENYA KEKIRIBATI KIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF KPKOREA, REPUBLIC OF KRKUWAIT KWKYRGYZSTAN KGLAO PEOPLE'S DEMOCRATIC REPUBLIC LALATVIA LVLEBANON LBLESOTHO LSLIBERIA LRLIBYA LYLIECHTENSTEIN LILITHUANIA LTLUXEMBOURG LUMACAO MOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF MKMADAGASCAR MGMALAWI MWMALAYSIA MYMALDIVES MVMALI MLMALTA MTMARSHALL ISLANDS MHMARTINIQUE MQMAURITANIA MR

Page 453: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MAURITIUS MUMAYOTTE YTMEXICO MXMICRONESIA, FEDERATED STATES OF FMMOLDOVA, REPUBLIC OF MDMONACO MCMONGOLIA MNMONTENEGRO MEMONTSERRAT MSMOROCCO MAMOZAMBIQUE MZMYANMAR MMNAMIBIA NANAURU NRNEPAL NPNETHERLANDS NLNEW CALEDONIA NCNEW ZEALAND NZNICARAGUA NINIGER NENIGERIA NGNIUE NUNORFOLK ISLAND NFNORTHERN MARIANA ISLANDS MPNORWAY NOOMAN OMPAKISTAN PKPALAU PWPALESTINIAN TERRITORY, OCCUPIED PSPANAMA PAPAPUA NEW GUINEA PGPARAGUAY PYPERU PEPHILIPPINES PHPITCAIRN PNPOLAND PLPORTUGAL PTPUERTO RICO PRQATAR QARÉUNION REROMANIA RORUSSIAN FEDERATION RURWANDA RWSAINT BARTHÉLEMY BLSAINT HELENA, ASCENSION AND TRISTAN DA CUNHA SHSAINT KITTS AND NEVIS KNSAINT LUCIA LCSAINT MARTIN (FRENCH PART) MFSAINT PIERRE AND MIQUELON PMSAINT VINCENT AND THE GRENADINES VCSAMOA WS

Page 454: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SAN MARINO SMSAO TOME AND PRINCIPE STSAUDI ARABIA SASENEGAL SNSERBIA RSSEYCHELLES SCSIERRA LEONE SLSINGAPORE SGSINT MAARTEN (DUTCH PART) SXSLOVAKIA SKSLOVENIA SISOLOMON ISLANDS SBSOMALIA SOSOUTH AFRICA ZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDS GSSPAIN ESSRI LANKA LKSUDAN SDSURINAME SRSVALBARD AND JAN MAYEN SJSWAZILAND SZSWEDEN SESWITZERLAND CHSYRIAN ARAB REPUBLIC SYTAIWAN, PROVINCE OF CHINA TWTAJIKISTAN TJTANZANIA, UNITED REPUBLIC OF TZTHAILAND THTIMOR-LESTE TLTOGO TGTOKELAU TKTONGA TOTRINIDAD AND TOBAGO TTTUNISIA TNTURKEY TRTURKMENISTAN TMTURKS AND CAICOS ISLANDS TCTUVALU TVUGANDA UGUKRAINE UAUNITED ARAB EMIRATES AEUNITED KINGDOM GBUNITED STATES USUNITED STATES MINOR OUTLYING ISLANDS UMURUGUAY UYUZBEKISTAN UZVANUATU VUVENEZUELA, BOLIVARIAN REPUBLIC OF VEVIET NAM VNVIRGIN ISLANDS, BRITISH VGVIRGIN ISLANDS, U.S. VI

Page 455: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

WALLIS AND FUTUNA WFWESTERN SAHARA EHYEMEN YEZAMBIA ZMZIMBABWE ZWSOUTH SUDAN SS

6: Issuer country/country of residenceNot applicable/All geographical areas x0

EEA x14OECD [non-EEA] x44RoW [rest of the world] x63

7: Regions [natural catastrophe - windstorm]Not applicable/All geographical areas x0

EEA x14Republic of Austria x48Kingdom of Belgium x28CZECH REPUBLIC CZSWITZERLAND; LIECHTENSTEIN x69Kingdom of Denmark x29French Republic [except Guadeloupe, Martinique, the Collectivity of Saint Martin a x18Federal Republic of Germany x16Republic of Iceland x55IRELAND IEGrand Duchy of Luxemburg x21Kingdom of the Netherlands x34Kingdom of Norway x30Republic of Poland x59SPAIN; ANDORRA x32Kingdom of Sweden x33United Kingdom of Great Britain and Northern Ireland x70GUADELOUPE GPMARTINIQUE MQCollectivity of Saint Martin x10RÉUNION RE

Non-EEA x37Central and Western Asia x9Eastern Asia x12South and South-Eastern Asia x65Oceania x43Northern Africa x39Southern Africa x67Northern America excluding the United States of America x40Caribbean and Central America x8Eastern South America x13Northern, southern and western South America x41North-east United States of America x38South-east United States of America x66Mid-west United States of America x36Western United States of America x71

8: Regions [natural catastrophe - earthquake]Not applicable/All geographical areas x0

Page 456: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

EEA x14Republic of Austria x48Kingdom of Belgium x28Republic of Bulgaria x49Republic of Croatia x50Republic of Cyprus x51CZECH REPUBLIC CZSWITZERLAND; LIECHTENSTEIN x69French Republic [except Guadeloupe, Martinique, the Collectivity of Saint Martin a x18Federal Republic of Germany x16Hellenic Republic x23Republic of Hungary x54ITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE) x27Republic of Malta x58Portuguese Republic x47ROMANIA ROSlovak Republic x64Republic of Slovenia x60GUADELOUPE GPMARTINIQUE MQCollectivity of Saint Martin x10

Non-EEA x37Central and Western Asia x9Eastern Asia x12South and South-Eastern Asia x65Oceania x43Northern Africa x39Southern Africa x67Northern America excluding the United States of America x40Caribbean and Central America x8Eastern South America x13Northern, southern and western South America x41North-east United States of America x38South-east United States of America x66Mid-west United States of America x36Western United States of America x71

9: Regions [natural catastrophe - flood]Not applicable/All geographical areas x0

EEA x14Republic of Austria x48Kingdom of Belgium x28Republic of Bulgaria x49CZECH REPUBLIC CZSWITZERLAND; LIECHTENSTEIN x69French Republic [except Guadeloupe, Martinique, the Collectivity of Saint Martin a x20Federal Republic of Germany x16Republic of Hungary x54ITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE) x27Republic of Poland x59ROMANIA ROSlovak Republic x64

Page 457: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Republic of Slovenia x60United Kingdom of Great Britain and Northern Ireland x70

Non-EEA x37Central and Western Asia x9Eastern Asia x12South and South-Eastern Asia x65Oceania x43Northern Africa x39Southern Africa x67Northern America excluding the United States of America x40Caribbean and Central America x8Eastern South America x13Northern, southern and western South America x41North-east United States of America x38South-east United States of America x66Mid-west United States of America x36Western United States of America x71

10: Regions [natural catastrophe - hail]Not applicable/All geographical areas x0

EEA x14Republic of Austria x48Kingdom of Belgium x28SWITZERLAND; LIECHTENSTEIN x69French Republic [except Guadeloupe, Martinique, the Collectivity of Saint Martin a x20Federal Republic of Germany x16ITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE) x27Grand Duchy of Luxemburg x21Kingdom of the Netherlands x34SPAIN; ANDORRA x32

Non-EEA x37Central and Western Asia x9Eastern Asia x12South and South-Eastern Asia x65Oceania x43Northern Africa x39Southern Africa x67Northern America excluding the United States of America x40Caribbean and Central America x8Eastern South America x13Northern, southern and western South America x41North-east United States of America x38South-east United States of America x66Mid-west United States of America x36Western United States of America x71

11: Localization of activity [based on place of underwriting]Not applicable/All geographical areas x0

31 countries for health catastrophe risk - mass accident, accident concentration an x3Republic of Austria x48Kingdom of Belgium x28Republic of Bulgaria x49Republic of Croatia x50

Page 458: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Republic of Cyprus x51CZECH REPUBLIC CZKingdom of Denmark x29Republic of Estonia x52Republic of Finland x53French Republic x17Hellenic Republic x23Federal Republic of Germany x16Republic of Hungary x54Republic of Iceland x55IRELAND IEItalian Republic x26Republic of Latvia x56Republic of Lithuania x57Grand Duchy of Luxemburg x21Republic of Malta x58Kingdom of the Netherlands x34Kingdom of Norway x30Republic of Poland x59Portuguese Republic x47ROMANIA ROSlovak Republic x64Republic of Slovenia x60Kingdom of Spain x31Kingdom of Sweden x33Swiss Confederation x68United Kingdom of Great Britain and Northern Ireland x70

Other than 31 countries for health catastrophe risk - mass accident, accident conce x4512: Issuer country/country of residence

Not applicable/All geographical areas x0EEA x14Non-EEA x37

13: Home/Reporting Country [in EEA]Not applicable/All geographical areas x0

AUSTRIA ATBELGIUM BEBULGARIA BGCYPRUS CYCZECH REPUBLIC CZDENMARK DKESTONIA EEFINLAND FIFRANCE FRGERMANY DEGREECE GRCROATIA HRHUNGARY HUICELAND ISIRELAND IEITALY ITLATVIA LV

Page 459: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

LIECHTENSTEIN LILITHUANIA LTLUXEMBOURG LUMALTA MTNETHERLANDS NLNORWAY NOPOLAND PLPORTUGAL PTROMANIA ROSLOVAKIA SKSLOVENIA SISPAIN ESSWEDEN SEUNITED KINGDOM GB

UNITED KINGDOM (GIBRALTAR) GI14: Non-EEA country

Not applicable/All geographical areas x0AFGHANISTAN AFÅLAND ISLANDS AXALBANIA ALALGERIA DZAMERICAN SAMOA ASANDORRA ADANGOLA AOANGUILLA AIANTARCTICA AQANTIGUA AND BARBUDA AGARGENTINA ARARMENIA AMARUBA AWAUSTRALIA AUAZERBAIJAN AZBAHAMAS BSBAHRAIN BHBANGLADESH BDBARBADOS BBBELARUS BYBELIZE BZBENIN BJBERMUDA BMBHUTAN BTBOLIVIA, PLURINATIONAL STATE OF BOBONAIRE, SINT EUSTATIUS AND SABA BQBOSNIA AND HERZEGOVINA BABOTSWANA BWBOUVET ISLAND BVBRAZIL BRBRITISH INDIAN OCEAN TERRITORY IOBRUNEI DARUSSALAM BNBURKINA FASO BFBURUNDI BI

Page 460: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

CAMBODIA KHCAMEROON CMCANADA CACAPE VERDE CVCAYMAN ISLANDS KYCENTRAL AFRICAN REPUBLIC CFCHAD TDCHILE CLCHINA CNCHRISTMAS ISLAND CXCOCOS (KEELING) ISLANDS CCCOLOMBIA COCOMOROS KMCONGO CGCONGO, THE DEMOCRATIC REPUBLIC OF THE CDCOOK ISLANDS CKCOSTA RICA CRCÔTE D'IVOIRE CICUBA CUCURAÇAO CWDJIBOUTI DJDOMINICA DMDOMINICAN REPUBLIC DOECUADOR ECEGYPT EGEL SALVADOR SVEQUATORIAL GUINEA GQERITREA ERETHIOPIA ETFALKLAND ISLANDS (MALVINAS) FKFAROE ISLANDS FOFIJI FJFRENCH GUIANA GFFRENCH POLYNESIA PFFRENCH SOUTHERN TERRITORIES TFGABON GAGAMBIA GMGEORGIA GEGHANA GHUNITED KINGDOM (GIBRALTAR) GIGREENLAND GLGRENADA GDGUADELOUPE GPGUAM GUGUATEMALA GTGUERNSEY GGGUINEA GNGUINEA-BISSAU GWGUYANA GYHAITI HTHEARD ISLAND AND MCDONALD ISLANDS HM

Page 461: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

HOLY SEE (VATICAN CITY STATE) VAHONDURAS HNHONG KONG HKINDIA ININDONESIA IDIRAN, ISLAMIC REPUBLIC OF IRIRAQ IQISLE OF MAN IMISRAEL ILJAMAICA JMJAPAN JPJERSEY JEJORDAN JOKAZAKHSTAN KZKENYA KEKIRIBATI KIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF KPKOREA, REPUBLIC OF KRKUWAIT KWKYRGYZSTAN KGLAO PEOPLE'S DEMOCRATIC REPUBLIC LALEBANON LBLESOTHO LSLIBERIA LRLIBYA LYMACAO MOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF MKMADAGASCAR MGMALAWI MWMALAYSIA MYMALDIVES MVMALI MLMARSHALL ISLANDS MHMARTINIQUE MQMAURITANIA MRMAURITIUS MUMAYOTTE YTMEXICO MXMICRONESIA, FEDERATED STATES OF FMMOLDOVA, REPUBLIC OF MDMONACO MCMONGOLIA MNMONTENEGRO MEMONTSERRAT MSMOROCCO MAMOZAMBIQUE MZMYANMAR MMNAMIBIA NANAURU NRNEPAL NPNEW CALEDONIA NC

Page 462: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

NEW ZEALAND NZNICARAGUA NINIGER NENIGERIA NGNIUE NUNORFOLK ISLAND NFNORTHERN MARIANA ISLANDS MPOMAN OMPAKISTAN PKPALAU PWPALESTINIAN TERRITORY, OCCUPIED PSPANAMA PAPAPUA NEW GUINEA PGPARAGUAY PYPERU PEPHILIPPINES PHPITCAIRN PNPUERTO RICO PRQATAR QARÉUNION RERUSSIAN FEDERATION RURWANDA RWSAINT BARTHÉLEMY BLSAINT HELENA, ASCENSION AND TRISTAN DA CUNHA SHSAINT KITTS AND NEVIS KNSAINT LUCIA LCSAINT MARTIN (FRENCH PART) MFSAINT PIERRE AND MIQUELON PMSAINT VINCENT AND THE GRENADINES VCSAMOA WSSAN MARINO SMSAO TOME AND PRINCIPE STSAUDI ARABIA SASENEGAL SNSERBIA RSSEYCHELLES SCSIERRA LEONE SLSINGAPORE SGSINT MAARTEN (DUTCH PART) SXSOLOMON ISLANDS SBSOMALIA SOSOUTH AFRICA ZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDS GSSRI LANKA LKSUDAN SDSURINAME SRSVALBARD AND JAN MAYEN SJSWAZILAND SZSWITZERLAND CHSYRIAN ARAB REPUBLIC SYTAIWAN, PROVINCE OF CHINA TW

Page 463: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

TAJIKISTAN TJTANZANIA, UNITED REPUBLIC OF TZTHAILAND THTIMOR-LESTE TLTOGO TGTOKELAU TKTONGA TOTRINIDAD AND TOBAGO TTTUNISIA TNTURKEY TRTURKMENISTAN TMTURKS AND CAICOS ISLANDS TCTUVALU TVUGANDA UGUKRAINE UAUNITED ARAB EMIRATES AEUNITED STATES USUNITED STATES MINOR OUTLYING ISLANDS UMURUGUAY UYUZBEKISTAN UZVANUATU VUVENEZUELA, BOLIVARIAN REPUBLIC OF VEVIET NAM VNVIRGIN ISLANDS, BRITISH VGVIRGIN ISLANDS, U.S. VIWALLIS AND FUTUNA WFWESTERN SAHARA EHYEMEN YEZAMBIA ZMZIMBABWE ZWSOUTH SUDAN SS

15: Countries by amount of gross premiums writtenNot applicable/All geographical areas x0

5 biggest and home country x72Home country x245 biggest x6

1st biggest x12nd biggest x23rd biggest x44th biggest x55th biggest x7

Other than 5 biggest and home country x7316: Home country

Not applicable/All geographical areas x0Home country x24Other than home country x74

EEA countries [other than home country] x15Not EEA countries x42

17: Localization of activityNot applicable/All geographical areas x0

Local x75

Page 464: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Not local x76Not local [EEA] x77

18: CountriesNot applicable/All geographical areas x0

AFGHANISTAN AFÅLAND ISLANDS AXALBANIA ALALGERIA DZAMERICAN SAMOA ASANDORRA ADANGOLA AOANGUILLA AIANTARCTICA AQANTIGUA AND BARBUDA AGARGENTINA ARARMENIA AMARUBA AWAUSTRALIA AUAUSTRIA ATAZERBAIJAN AZBAHAMAS BSBAHRAIN BHBANGLADESH BDBARBADOS BBBELARUS BYBELGIUM BEBELIZE BZBENIN BJBERMUDA BMBHUTAN BTBOLIVIA, PLURINATIONAL STATE OF BOBONAIRE, SINT EUSTATIUS AND SABA BQBOSNIA AND HERZEGOVINA BABOTSWANA BWBOUVET ISLAND BVBRAZIL BRBRITISH INDIAN OCEAN TERRITORY IOBRUNEI DARUSSALAM BNBULGARIA BGBURKINA FASO BFBURUNDI BICAMBODIA KHCAMEROON CMCANADA CACAPE VERDE CVCAYMAN ISLANDS KYCENTRAL AFRICAN REPUBLIC CFCHAD TDCHILE CLCHINA CNCHRISTMAS ISLAND CX

Page 465: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

COCOS (KEELING) ISLANDS CCCOLOMBIA COCOMOROS KMCONGO CGCONGO, THE DEMOCRATIC REPUBLIC OF THE CDCOOK ISLANDS CKCOSTA RICA CRCÔTE D'IVOIRE CICROATIA HRCUBA CUCURAÇAO CWCYPRUS CYCZECH REPUBLIC CZDENMARK DKDJIBOUTI DJDOMINICA DMDOMINICAN REPUBLIC DOECUADOR ECEGYPT EGEL SALVADOR SVEQUATORIAL GUINEA GQERITREA ERESTONIA EEETHIOPIA ETFALKLAND ISLANDS (MALVINAS) FKFAROE ISLANDS FOFIJI FJFINLAND FIFRANCE FRFRENCH GUIANA GFFRENCH POLYNESIA PFFRENCH SOUTHERN TERRITORIES TFGABON GAGAMBIA GMGEORGIA GEGERMANY DEGHANA GHGREECE GRGREENLAND GLGRENADA GDGUADELOUPE GPGUAM GUGUATEMALA GTGUERNSEY GGGUINEA GNGUINEA-BISSAU GWGUYANA GYHAITI HTHEARD ISLAND AND MCDONALD ISLANDS HMHOLY SEE (VATICAN CITY STATE) VAHONDURAS HN

Page 466: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

HONG KONG HKHUNGARY HUICELAND ISINDIA ININDONESIA IDIRAN, ISLAMIC REPUBLIC OF IRIRAQ IQIRELAND IEISLE OF MAN IMISRAEL ILITALY ITJAMAICA JMJAPAN JPJERSEY JEJORDAN JOKAZAKHSTAN KZKENYA KEKIRIBATI KIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF KPKOREA, REPUBLIC OF KRKUWAIT KWKYRGYZSTAN KGLAO PEOPLE'S DEMOCRATIC REPUBLIC LALATVIA LVLEBANON LBLESOTHO LSLIBERIA LRLIBYA LYLIECHTENSTEIN LILITHUANIA LTLUXEMBOURG LUMACAO MOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF MKMADAGASCAR MGMALAWI MWMALAYSIA MYMALDIVES MVMALI MLMALTA MTMARSHALL ISLANDS MHMARTINIQUE MQMAURITANIA MRMAURITIUS MUMAYOTTE YTMEXICO MXMICRONESIA, FEDERATED STATES OF FMMOLDOVA, REPUBLIC OF MDMONACO MCMONGOLIA MNMONTENEGRO MEMONTSERRAT MS

Page 467: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MOROCCO MAMOZAMBIQUE MZMYANMAR MMNAMIBIA NANAURU NRNEPAL NPNETHERLANDS NLNEW CALEDONIA NCNEW ZEALAND NZNICARAGUA NINIGER NENIGERIA NGNIUE NUNORFOLK ISLAND NFNORTHERN MARIANA ISLANDS MPNORWAY NOOMAN OMPAKISTAN PKPALAU PWPALESTINIAN TERRITORY, OCCUPIED PSPANAMA PAPAPUA NEW GUINEA PGPARAGUAY PYPERU PEPHILIPPINES PHPITCAIRN PNPOLAND PLPORTUGAL PTPUERTO RICO PRQATAR QARÉUNION REROMANIA RORUSSIAN FEDERATION RURWANDA RWSAINT BARTHÉLEMY BLSAINT HELENA, ASCENSION AND TRISTAN DA CUNHA SHSAINT KITTS AND NEVIS KNSAINT LUCIA LCSAINT MARTIN (FRENCH PART) MFSAINT PIERRE AND MIQUELON PMSAINT VINCENT AND THE GRENADINES VCSAMOA WSSAN MARINO SMSAO TOME AND PRINCIPE STSAUDI ARABIA SASENEGAL SNSERBIA RSSEYCHELLES SCSIERRA LEONE SLSINGAPORE SGSINT MAARTEN (DUTCH PART) SX

Page 468: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SLOVAKIA SKSLOVENIA SISOLOMON ISLANDS SBSOMALIA SOSOUTH AFRICA ZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDS GSSPAIN ESSRI LANKA LKSUDAN SDSURINAME SRSVALBARD AND JAN MAYEN SJSWAZILAND SZSWEDEN SESWITZERLAND CHSYRIAN ARAB REPUBLIC SYTAIWAN, PROVINCE OF CHINA TWTAJIKISTAN TJTANZANIA, UNITED REPUBLIC OF TZTHAILAND THTIMOR-LESTE TLTOGO TGTOKELAU TKTONGA TOTRINIDAD AND TOBAGO TTTUNISIA TNTURKEY TRTURKMENISTAN TMTURKS AND CAICOS ISLANDS TCTUVALU TVUGANDA UGUKRAINE UAUNITED ARAB EMIRATES AEUNITED KINGDOM GB

UNITED KINGDOM (GIBRALTAR) GIUNITED STATES USUNITED STATES MINOR OUTLYING ISLANDS UMURUGUAY UYUZBEKISTAN UZVANUATU VUVENEZUELA, BOLIVARIAN REPUBLIC OF VEVIET NAM VNVIRGIN ISLANDS, BRITISH VGVIRGIN ISLANDS, U.S. VIWALLIS AND FUTUNA WFWESTERN SAHARA EHYEMEN YEZAMBIA ZMZIMBABWE ZWSOUTH SUDAN SS

19: Issuer country/country of residenceAFGHANISTAN AF

Page 469: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ÅLAND ISLANDS AXALBANIA ALALGERIA DZAMERICAN SAMOA ASANDORRA ADANGOLA AOANGUILLA AIANTARCTICA AQANTIGUA AND BARBUDA AGARGENTINA ARARMENIA AMARUBA AWAUSTRALIA AUAUSTRIA ATAZERBAIJAN AZBAHAMAS BSBAHRAIN BHBANGLADESH BDBARBADOS BBBELARUS BYBELGIUM BEBELIZE BZBENIN BJBERMUDA BMBHUTAN BTBOLIVIA, PLURINATIONAL STATE OF BOBONAIRE, SINT EUSTATIUS AND SABA BQBOSNIA AND HERZEGOVINA BABOTSWANA BWBOUVET ISLAND BVBRAZIL BRBRITISH INDIAN OCEAN TERRITORY IOBRUNEI DARUSSALAM BNBULGARIA BGBURKINA FASO BFBURUNDI BICAMBODIA KHCAMEROON CMCANADA CACAPE VERDE CVCAYMAN ISLANDS KYCENTRAL AFRICAN REPUBLIC CFCHAD TDCHILE CLCHINA CNCHRISTMAS ISLAND CXCOCOS (KEELING) ISLANDS CCCOLOMBIA COCOMOROS KMCONGO CGCONGO, THE DEMOCRATIC REPUBLIC OF THE CD

Page 470: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

COOK ISLANDS CKCOSTA RICA CRCÔTE D'IVOIRE CICROATIA HRCUBA CUCURAÇAO CWCYPRUS CYCZECH REPUBLIC CZDENMARK DKDJIBOUTI DJDOMINICA DMDOMINICAN REPUBLIC DOECUADOR ECEGYPT EGEL SALVADOR SVEQUATORIAL GUINEA GQERITREA ERESTONIA EEETHIOPIA ETFALKLAND ISLANDS (MALVINAS) FKFAROE ISLANDS FOFIJI FJFINLAND FIFRANCE FRFRENCH GUIANA GFFRENCH POLYNESIA PFFRENCH SOUTHERN TERRITORIES TFGABON GAGAMBIA GMGEORGIA GEGERMANY DEGHANA GHUNITED KINGDOM (GIBRALTAR) GIGREECE GRGREENLAND GLGRENADA GDGUADELOUPE GPGUAM GUGUATEMALA GTGUERNSEY GGGUINEA GNGUINEA-BISSAU GWGUYANA GYHAITI HTHEARD ISLAND AND MCDONALD ISLANDS HMHOLY SEE (VATICAN CITY STATE) VAHONDURAS HNHONG KONG HKHUNGARY HUICELAND ISINDIA IN

Page 471: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

INDONESIA IDIRAN, ISLAMIC REPUBLIC OF IRIRAQ IQIRELAND IEISLE OF MAN IMISRAEL ILITALY ITJAMAICA JMJAPAN JPJERSEY JEJORDAN JOKAZAKHSTAN KZKENYA KEKIRIBATI KIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF KPKOREA, REPUBLIC OF KRKUWAIT KWKYRGYZSTAN KGLAO PEOPLE'S DEMOCRATIC REPUBLIC LALATVIA LVLEBANON LBLESOTHO LSLIBERIA LRLIBYA LYLIECHTENSTEIN LILITHUANIA LTLUXEMBOURG LUMACAO MOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF MKMADAGASCAR MGMALAWI MWMALAYSIA MYMALDIVES MVMALI MLMALTA MTMARSHALL ISLANDS MHMARTINIQUE MQMAURITANIA MRMAURITIUS MUMAYOTTE YTMEXICO MXMICRONESIA, FEDERATED STATES OF FMMOLDOVA, REPUBLIC OF MDMONACO MCMONGOLIA MNMONTENEGRO MEMONTSERRAT MSMOROCCO MAMOZAMBIQUE MZMYANMAR MMNAMIBIA NA

Page 472: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

NAURU NRNEPAL NPNETHERLANDS NLNEW CALEDONIA NCNEW ZEALAND NZNICARAGUA NINIGER NENIGERIA NGNIUE NUNORFOLK ISLAND NFNORTHERN MARIANA ISLANDS MPNORWAY NOOMAN OMPAKISTAN PKPALAU PWPALESTINIAN TERRITORY, OCCUPIED PSPANAMA PAPAPUA NEW GUINEA PGPARAGUAY PYPERU PEPHILIPPINES PHPITCAIRN PNPOLAND PLPORTUGAL PTPUERTO RICO PRQATAR QARÉUNION REROMANIA RORUSSIAN FEDERATION RURWANDA RWSAINT BARTHÉLEMY BLSAINT HELENA, ASCENSION AND TRISTAN DA CUNHA SHSAINT KITTS AND NEVIS KNSAINT LUCIA LCSAINT MARTIN (FRENCH PART) MFSAINT PIERRE AND MIQUELON PMSAINT VINCENT AND THE GRENADINES VCSAMOA WSSAN MARINO SMSAO TOME AND PRINCIPE STSAUDI ARABIA SASENEGAL SNSERBIA RSSEYCHELLES SCSIERRA LEONE SLSINGAPORE SGSINT MAARTEN (DUTCH PART) SXSLOVAKIA SKSLOVENIA SISOLOMON ISLANDS SBSOMALIA SO

Page 473: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SOUTH AFRICA ZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDS GSSPAIN ESSRI LANKA LKSUDAN SDSURINAME SRSVALBARD AND JAN MAYEN SJSWAZILAND SZSWEDEN SESWITZERLAND CHSYRIAN ARAB REPUBLIC SYTAIWAN, PROVINCE OF CHINA TWTAJIKISTAN TJTANZANIA, UNITED REPUBLIC OF TZTHAILAND THTIMOR-LESTE TLTOGO TGTOKELAU TKTONGA TOTRINIDAD AND TOBAGO TTTUNISIA TNTURKEY TRTURKMENISTAN TMTURKS AND CAICOS ISLANDS TCTUVALU TVUGANDA UGUKRAINE UAUNITED ARAB EMIRATES AEUNITED KINGDOM GBUNITED STATES USUNITED STATES MINOR OUTLYING ISLANDS UMURUGUAY UYUZBEKISTAN UZVANUATU VUVENEZUELA, BOLIVARIAN REPUBLIC OF VEVIET NAM VNVIRGIN ISLANDS, BRITISH VGVIRGIN ISLANDS, U.S. VIWALLIS AND FUTUNA WFWESTERN SAHARA EHYEMEN YEZAMBIA ZMZIMBABWE ZWEuropean Union institutions EUSupranational Issuers XASOUTH SUDAN SS

20: Localization of activityNot applicable/All geographical areas x0

Euro area x78Home country x24Euro area other than home country x80

Page 474: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Non-euro area x7921: Localization of activity [based on place of underwriting] (Full scope)

Not applicable/All geographical areas x035 countries for health catastrophe risk - mass accident, accident concentration an x82

AUSTRIA ATBELGIUM BEBULGARIA BGCROATIA HRCYPRUS CYCZECH REPUBLIC CZDENMARK DKESTONIA EEFINLAND FIFRANCE; MONACO; ANDORRA x81

FRANCE FRMONACO MCANDORRA AD

GREECE GRGERMANY DEHUNGARY HUICELAND ISIRELAND IEITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE) x27

ITALY ITSAN MARINO SMHOLY SEE (VATICAN CITY STATE) VA

LATVIA LVLITHUANIA LTLUXEMBOURG LUMALTA MTNETHERLANDS NLNORWAY NOPOLAND PLPORTUGAL PTROMANIA ROSLOVAKIA SKSLOVENIA SISPAIN ESSWEDEN SESWITZERLAND CHUNITED KINGDOM GB

Other than 35 countries for health catastrophe risk - mass accident, accident conce x8322: Regions (Full scope)

Not applicable/All geographical areas x0EEA x14

AUSTRIA ATBELGIUM BEBULGARIA BGCROATIA HRCYPRUS CYCZECH REPUBLIC CZ

Page 475: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

DENMARK DKESTONIA EEFINLAND FISWITZERLAND; LIECHTENSTEIN x69

SWITZERLAND CHLIECHTENSTEIN LI

FRANCE; MONACO; ANDORRA x81FRANCE FRMONACO MCANDORRA AD

GERMANY DEGREECE GRHUNGARY HUICELAND ISIRELAND IEITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE) x27

ITALY ITSAN MARINO SMHOLY SEE (VATICAN CITY STATE) VA

LATVIA LVLITHUANIA LTLUXEMBOURG LUMALTA MTNETHERLANDS NLNORWAY NOPOLAND PLPORTUGAL PTROMANIA ROSLOVAKIA SKSLOVENIA SISPAIN ESSWEDEN SEUNITED KINGDOM GBGUADELOUPE GPMARTINIQUE MQSAINT MARTIN (FRENCH PART) MFRÉUNION RE

Non-EEA x37Central and Western Asia x9Eastern Asia x12South and South-Eastern Asia x65Oceania x43Northern Africa x39Southern Africa x67Northern America excluding the United States of America x40Caribbean and Central America x8Eastern South America x13Northern, southern and western South America x41North-east United States of America x38South-east United States of America x66Mid-west United States of America x36

Page 476: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Western United States of America x7123: Countries

AFGHANISTAN AFÅLAND ISLANDS AXALBANIA ALALGERIA DZAMERICAN SAMOA ASANGOLA AOANGUILLA AIANTARCTICA AQANTIGUA AND BARBUDA AGARGENTINA ARARMENIA AMARUBA AWAUSTRALIA AUAZERBAIJAN AZBAHAMAS BSBAHRAIN BHBANGLADESH BDBARBADOS BBBELARUS BYBELIZE BZBENIN BJBERMUDA BMBHUTAN BTBOLIVIA, PLURINATIONAL STATE OF BOBONAIRE, SINT EUSTATIUS AND SABA BQBOSNIA AND HERZEGOVINA BABOTSWANA BWBOUVET ISLAND BVBRAZIL BRBRITISH INDIAN OCEAN TERRITORY IOBRUNEI DARUSSALAM BNBURKINA FASO BFBURUNDI BICAMBODIA KHCAMEROON CMCANADA CACAPE VERDE CVCAYMAN ISLANDS KYCENTRAL AFRICAN REPUBLIC CFCHAD TDCHILE CLCHINA CNCHRISTMAS ISLAND CXCOCOS (KEELING) ISLANDS CCCOLOMBIA COCOMOROS KMCONGO CGCONGO, THE DEMOCRATIC REPUBLIC OF THE CDCOOK ISLANDS CK

Page 477: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

COSTA RICA CRCÔTE D'IVOIRE CICUBA CUCURAÇAO CWDJIBOUTI DJDOMINICA DMDOMINICAN REPUBLIC DOECUADOR ECEGYPT EGEL SALVADOR SVEQUATORIAL GUINEA GQERITREA ERETHIOPIA ETFALKLAND ISLANDS (MALVINAS) FKFAROE ISLANDS FOFIJI FJFRENCH GUIANA GFFRENCH POLYNESIA PFFRENCH SOUTHERN TERRITORIES TFGABON GAGAMBIA GMGEORGIA GEGHANA GHUNITED KINGDOM (GIBRALTAR) GIGREENLAND GLGRENADA GDGUADELOUPE GPGUAM GUGUATEMALA GTGUERNSEY GGGUINEA GNGUINEA-BISSAU GWGUYANA GYHAITI HTHEARD ISLAND AND MCDONALD ISLANDS HMHONDURAS HNHONG KONG HKINDIA ININDONESIA IDIRAN, ISLAMIC REPUBLIC OF IRIRAQ IQISLE OF MAN IMISRAEL ILJAMAICA JMJAPAN JPJERSEY JEJORDAN JOKAZAKHSTAN KZKENYA KEKIRIBATI KIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF KP

Page 478: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

KOREA, REPUBLIC OF KRKUWAIT KWKYRGYZSTAN KGLAO PEOPLE'S DEMOCRATIC REPUBLIC LALEBANON LBLESOTHO LSLIBERIA LRLIBYA LYLIECHTENSTEIN LIMACAO MOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF MKMADAGASCAR MGMALAWI MWMALAYSIA MYMALDIVES MVMALI MLMARSHALL ISLANDS MHMARTINIQUE MQMAURITANIA MRMAURITIUS MUMAYOTTE YTMEXICO MXMICRONESIA, FEDERATED STATES OF FMMOLDOVA, REPUBLIC OF MDMONGOLIA MNMONTENEGRO MEMONTSERRAT MSMOROCCO MAMOZAMBIQUE MZMYANMAR MMNAMIBIA NANAURU NRNEPAL NPNEW CALEDONIA NCNEW ZEALAND NZNICARAGUA NINIGER NENIGERIA NGNIUE NUNORFOLK ISLAND NFNORTHERN MARIANA ISLANDS MPOMAN OMPAKISTAN PKPALAU PWPALESTINIAN TERRITORY, OCCUPIED PSPANAMA PAPAPUA NEW GUINEA PGPARAGUAY PYPERU PEPHILIPPINES PHPITCAIRN PN

Page 479: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

PUERTO RICO PRQATAR QARÉUNION RERUSSIAN FEDERATION RURWANDA RWSAINT BARTHÉLEMY BLSAINT HELENA, ASCENSION AND TRISTAN DA CUNHA SHSAINT KITTS AND NEVIS KNSAINT LUCIA LCSAINT MARTIN (FRENCH PART) MFSAINT PIERRE AND MIQUELON PMSAINT VINCENT AND THE GRENADINES VCSAMOA WSSAO TOME AND PRINCIPE STSAUDI ARABIA SASENEGAL SNSERBIA RSSEYCHELLES SCSIERRA LEONE SLSINGAPORE SGSINT MAARTEN (DUTCH PART) SXSOLOMON ISLANDS SBSOMALIA SOSOUTH AFRICA ZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDS GSSOUTH SUDAN SSSRI LANKA LKSUDAN SDSURINAME SRSVALBARD AND JAN MAYEN SJSWAZILAND SZSWITZERLAND CHSYRIAN ARAB REPUBLIC SYTAIWAN, PROVINCE OF CHINA TWTAJIKISTAN TJTANZANIA, UNITED REPUBLIC OF TZTHAILAND THTIMOR-LESTE TLTOGO TGTOKELAU TKTONGA TOTRINIDAD AND TOBAGO TTTUNISIA TNTURKEY TRTURKMENISTAN TMTURKS AND CAICOS ISLANDS TCTUVALU TVUGANDA UGUKRAINE UAUNITED ARAB EMIRATES AEUNITED STATES US

Page 480: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

UNITED STATES MINOR OUTLYING ISLANDS UMURUGUAY UYUZBEKISTAN UZVANUATU VUVENEZUELA, BOLIVARIAN REPUBLIC OF VEVIET NAM VNVIRGIN ISLANDS, BRITISH VGVIRGIN ISLANDS, U.S. VIWALLIS AND FUTUNA WFWESTERN SAHARA EHYEMEN YEZAMBIA ZMZIMBABWE ZW

24: RegionsEEA x14

Northern Europe x84Western Europe x85Eastern Europe x86Southern Europe x87

Non-EEA x3725: Countries

Not applicable/All geographical areas x0AFGHANISTAN AFÅLAND ISLANDS AXALBANIA ALALGERIA DZAMERICAN SAMOA ASANDORRA ADANGOLA AOANGUILLA AIANTARCTICA AQANTIGUA AND BARBUDA AGARGENTINA ARARMENIA AMARUBA AWAUSTRALIA AUAZERBAIJAN AZBAHAMAS BSBAHRAIN BHBANGLADESH BDBARBADOS BBBELARUS BYBELIZE BZBENIN BJBERMUDA BMBHUTAN BTBOLIVIA, PLURINATIONAL STATE OF BOBONAIRE, SINT EUSTATIUS AND SABA BQBOSNIA AND HERZEGOVINA BABOTSWANA BWBOUVET ISLAND BV

Page 481: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

BRAZIL BRBRITISH INDIAN OCEAN TERRITORY IOBRUNEI DARUSSALAM BNBURKINA FASO BFBURUNDI BICAMBODIA KHCAMEROON CMCANADA CACAPE VERDE CVCAYMAN ISLANDS KYCENTRAL AFRICAN REPUBLIC CFCHAD TDCHILE CLCHINA CNCHRISTMAS ISLAND CXCOCOS (KEELING) ISLANDS CCCOLOMBIA COCOMOROS KMCONGO CGCONGO, THE DEMOCRATIC REPUBLIC OF THE CDCOOK ISLANDS CKCOSTA RICA CRCÔTE D'IVOIRE CICUBA CUCURAÇAO CWDJIBOUTI DJDOMINICA DMDOMINICAN REPUBLIC DOECUADOR ECEGYPT EGEL SALVADOR SVEQUATORIAL GUINEA GQERITREA ERETHIOPIA ETFALKLAND ISLANDS (MALVINAS) FKFAROE ISLANDS FOFIJI FJFRENCH GUIANA GFFRENCH POLYNESIA PFFRENCH SOUTHERN TERRITORIES TFGABON GAGAMBIA GMGEORGIA GEGHANA GHUNITED KINGDOM (GIBRALTAR) GIGREENLAND GLGRENADA GDGUADELOUPE GPGUAM GUGUATEMALA GTGUERNSEY GG

Page 482: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

GUINEA GNGUINEA-BISSAU GWGUYANA GYHAITI HTHEARD ISLAND AND MCDONALD ISLANDS HMHOLY SEE (VATICAN CITY STATE) VAHONDURAS HNHONG KONG HKINDIA ININDONESIA IDIRAN, ISLAMIC REPUBLIC OF IRIRAQ IQISLE OF MAN IMISRAEL ILJAMAICA JMJAPAN JPJERSEY JEJORDAN JOKAZAKHSTAN KZKENYA KEKIRIBATI KIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF KPKOREA, REPUBLIC OF KRKUWAIT KWKYRGYZSTAN KGLAO PEOPLE'S DEMOCRATIC REPUBLIC LALEBANON LBLESOTHO LSLIBERIA LRLIBYA LYLIECHTENSTEIN LIMACAO MOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF MKMADAGASCAR MGMALAWI MWMALAYSIA MYMALDIVES MVMALI MLMARSHALL ISLANDS MHMARTINIQUE MQMAURITANIA MRMAURITIUS MUMAYOTTE YTMEXICO MXMICRONESIA, FEDERATED STATES OF FMMOLDOVA, REPUBLIC OF MDMONACO MCMONGOLIA MNMONTENEGRO MEMONTSERRAT MSMOROCCO MA

Page 483: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MOZAMBIQUE MZMYANMAR MMNAMIBIA NANAURU NRNEPAL NPNEW CALEDONIA NCNEW ZEALAND NZNICARAGUA NINIGER NENIGERIA NGNIUE NUNORFOLK ISLAND NFNORTHERN MARIANA ISLANDS MPOMAN OMPAKISTAN PKPALAU PWPALESTINIAN TERRITORY, OCCUPIED PSPANAMA PAPAPUA NEW GUINEA PGPARAGUAY PYPERU PEPHILIPPINES PHPITCAIRN PNPUERTO RICO PRQATAR QARÉUNION RERUSSIAN FEDERATION RURWANDA RWSAINT BARTHÉLEMY BLSAINT HELENA, ASCENSION AND TRISTAN DA CUNHA SHSAINT KITTS AND NEVIS KNSAINT LUCIA LCSAINT MARTIN (FRENCH PART) MFSAINT PIERRE AND MIQUELON PMSAINT VINCENT AND THE GRENADINES VCSAMOA WSSAN MARINO SMSAO TOME AND PRINCIPE STSAUDI ARABIA SASENEGAL SNSERBIA RSSEYCHELLES SCSIERRA LEONE SLSINGAPORE SGSINT MAARTEN (DUTCH PART) SXSOLOMON ISLANDS SBSOMALIA SOSOUTH AFRICA ZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDS GSSOUTH SUDAN SSSRI LANKA LK

Page 484: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SUDAN SDSURINAME SRSVALBARD AND JAN MAYEN SJSWAZILAND SZSYRIAN ARAB REPUBLIC SYTAIWAN, PROVINCE OF CHINA TWTAJIKISTAN TJTANZANIA, UNITED REPUBLIC OF TZTHAILAND THTIMOR-LESTE TLTOGO TGTOKELAU TKTONGA TOTRINIDAD AND TOBAGO TTTUNISIA TNTURKEY TRTURKMENISTAN TMTURKS AND CAICOS ISLANDS TCTUVALU TVUGANDA UGUKRAINE UAUNITED ARAB EMIRATES AEUNITED STATES USUNITED STATES MINOR OUTLYING ISLANDS UMURUGUAY UYUZBEKISTAN UZVANUATU VUVENEZUELA, BOLIVARIAN REPUBLIC OF VEVIET NAM VNVIRGIN ISLANDS, BRITISH VGVIRGIN ISLANDS, U.S. VIWALLIS AND FUTUNA WFWESTERN SAHARA EHYEMEN YEZAMBIA ZMZIMBABWE ZW

26: Issuer country/country of residenceNot applicable/All geographical areas x0

AFGHANISTAN AFÅLAND ISLANDS AXALBANIA ALALGERIA DZAMERICAN SAMOA ASANDORRA ADANGOLA AOANGUILLA AIANTARCTICA AQANTIGUA AND BARBUDA AGARGENTINA ARARMENIA AMARUBA AW

Page 485: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

AUSTRALIA AUAUSTRIA ATAZERBAIJAN AZBAHAMAS BSBAHRAIN BHBANGLADESH BDBARBADOS BBBELARUS BYBELGIUM BEBELIZE BZBENIN BJBERMUDA BMBHUTAN BTBOLIVIA, PLURINATIONAL STATE OF BOBONAIRE, SINT EUSTATIUS AND SABA BQBOSNIA AND HERZEGOVINA BABOTSWANA BWBOUVET ISLAND BVBRAZIL BRBRITISH INDIAN OCEAN TERRITORY IOBRUNEI DARUSSALAM BNBULGARIA BGBURKINA FASO BFBURUNDI BICAMBODIA KHCAMEROON CMCANADA CACAPE VERDE CVCAYMAN ISLANDS KYCENTRAL AFRICAN REPUBLIC CFCHAD TDCHILE CLCHINA CNCHRISTMAS ISLAND CXCOCOS (KEELING) ISLANDS CCCOLOMBIA COCOMOROS KMCONGO CGCONGO, THE DEMOCRATIC REPUBLIC OF THE CDCOOK ISLANDS CKCOSTA RICA CRCÔTE D'IVOIRE CICROATIA HRCUBA CUCURAÇAO CWCYPRUS CYCZECH REPUBLIC CZDENMARK DKDJIBOUTI DJDOMINICA DMDOMINICAN REPUBLIC DO

Page 486: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ECUADOR ECEGYPT EGEL SALVADOR SVEQUATORIAL GUINEA GQERITREA ERESTONIA EEETHIOPIA ETFALKLAND ISLANDS (MALVINAS) FKFAROE ISLANDS FOFIJI FJFINLAND FIFRANCE FRFRENCH GUIANA GFFRENCH POLYNESIA PFFRENCH SOUTHERN TERRITORIES TFGABON GAGAMBIA GMGEORGIA GEGERMANY DEGHANA GHUNITED KINGDOM (GIBRALTAR) GIGREECE GRGREENLAND GLGRENADA GDGUADELOUPE GPGUAM GUGUATEMALA GTGUERNSEY GGGUINEA GNGUINEA-BISSAU GWGUYANA GYHAITI HTHEARD ISLAND AND MCDONALD ISLANDS HMHOLY SEE (VATICAN CITY STATE) VAHONDURAS HNHONG KONG HKHUNGARY HUICELAND ISINDIA ININDONESIA IDIRAN, ISLAMIC REPUBLIC OF IRIRAQ IQIRELAND IEISLE OF MAN IMISRAEL ILITALY ITJAMAICA JMJAPAN JPJERSEY JEJORDAN JOKAZAKHSTAN KZ

Page 487: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

KENYA KEKIRIBATI KIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF KPKOREA, REPUBLIC OF KRKUWAIT KWKYRGYZSTAN KGLAO PEOPLE'S DEMOCRATIC REPUBLIC LALATVIA LVLEBANON LBLESOTHO LSLIBERIA LRLIBYA LYLIECHTENSTEIN LILITHUANIA LTLUXEMBOURG LUMACAO MOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF MKMADAGASCAR MGMALAWI MWMALAYSIA MYMALDIVES MVMALI MLMALTA MTMARSHALL ISLANDS MHMARTINIQUE MQMAURITANIA MRMAURITIUS MUMAYOTTE YTMEXICO MXMICRONESIA, FEDERATED STATES OF FMMOLDOVA, REPUBLIC OF MDMONACO MCMONGOLIA MNMONTENEGRO MEMONTSERRAT MSMOROCCO MAMOZAMBIQUE MZMYANMAR MMNAMIBIA NANAURU NRNEPAL NPNETHERLANDS NLNEW CALEDONIA NCNEW ZEALAND NZNICARAGUA NINIGER NENIGERIA NGNIUE NUNORFOLK ISLAND NFNORTHERN MARIANA ISLANDS MPNORWAY NO

Page 488: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

OMAN OMPAKISTAN PKPALAU PWPALESTINIAN TERRITORY, OCCUPIED PSPANAMA PAPAPUA NEW GUINEA PGPARAGUAY PYPERU PEPHILIPPINES PHPITCAIRN PNPOLAND PLPORTUGAL PTPUERTO RICO PRQATAR QARÉUNION REROMANIA RORUSSIAN FEDERATION RURWANDA RWSAINT BARTHÉLEMY BLSAINT HELENA, ASCENSION AND TRISTAN DA CUNHA SHSAINT KITTS AND NEVIS KNSAINT LUCIA LCSAINT MARTIN (FRENCH PART) MFSAINT PIERRE AND MIQUELON PMSAINT VINCENT AND THE GRENADINES VCSAMOA WSSAN MARINO SMSAO TOME AND PRINCIPE STSAUDI ARABIA SASENEGAL SNSERBIA RSSEYCHELLES SCSIERRA LEONE SLSINGAPORE SGSINT MAARTEN (DUTCH PART) SXSLOVAKIA SKSLOVENIA SISOLOMON ISLANDS SBSOMALIA SOSOUTH AFRICA ZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDS GSSPAIN ESSRI LANKA LKSUDAN SDSURINAME SRSVALBARD AND JAN MAYEN SJSWAZILAND SZSWEDEN SESWITZERLAND CHSYRIAN ARAB REPUBLIC SYTAIWAN, PROVINCE OF CHINA TW

Page 489: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

TAJIKISTAN TJTANZANIA, UNITED REPUBLIC OF TZTHAILAND THTIMOR-LESTE TLTOGO TGTOKELAU TKTONGA TOTRINIDAD AND TOBAGO TTTUNISIA TNTURKEY TRTURKMENISTAN TMTURKS AND CAICOS ISLANDS TCTUVALU TVUGANDA UGUKRAINE UAUNITED ARAB EMIRATES AEUNITED KINGDOM GBUNITED STATES USUNITED STATES MINOR OUTLYING ISLANDS UMURUGUAY UYUZBEKISTAN UZVANUATU VUVENEZUELA, BOLIVARIAN REPUBLIC OF VEVIET NAM VNVIRGIN ISLANDS, BRITISH VGVIRGIN ISLANDS, U.S. VIWALLIS AND FUTUNA WFWESTERN SAHARA EHYEMEN YEZAMBIA ZMZIMBABWE ZWEuropean Union institutions EUSupranational Issuers XASOUTH SUDAN SSAggregated countries due to application of threshold AA

27: Natural Catastrophe risk - WindstormNot applicable/All geographical areas x0

Specified Regions explicitly subject to windstorm risk charge x88AUSTRIA ATBELGIUM BECZECH REPUBLIC CZSWITZERLAND; LIECHTENSTEIN x69DENMARK DKFRANCE; MONACO; ANDORRA x81GERMANY DEICELAND ISIRELAND IELUXEMBOURG LUNETHERLANDS NLNORWAY NOPOLAND PL

Page 490: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SPAIN ESSWEDEN SEUNITED KINGDOM GBGUADELOUPE GPMARTINIQUE MQSAINT MARTIN (FRENCH PART) MFRÉUNION RE

Other Regions subject to windstorm risk charge x89Other Northern Europe Regions subject to windstorm risk charge x90Other Western European Regions subject to windstorm risk charge x91Other Eastern European Regions subject to windstorm risk charge x92Other Southern European Regions subject to windstorm risk charge x93Central and Western Asia x9Eastern Asia x12South and South-Eastern Asia x65Oceania x43Northern Africa x39Southern Africa x67Northern America excluding the United States of America x40Caribbean and Central America x8Eastern South America x13Northern, southern and western South America x41North-east United States of America x38South-east United States of America x66Mid-west United States of America x36Western United States of America x71

28: Natural Catastrophe risk - EarthquakeNot applicable/All geographical areas x0

Specified Regions explicitly subject to earthquake risk charge x94AUSTRIA ATBELGIUM BEBULGARIA BGCROATIA HRCYPRUS CYCZECH REPUBLIC CZSWITZERLAND; LIECHTENSTEIN x69FRANCE; MONACO; ANDORRA x81GERMANY DEGREECE GRHUNGARY HUITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE) x27MALTA MTPORTUGAL PTROMANIA ROSLOVAKIA SKSLOVENIA SIGUADELOUPE GPMARTINIQUE MQSAINT MARTIN (FRENCH PART) MF

Other Regions subject to earthquake risk charge x95Other Northern Europe Regions subject to earthquake risk charge x96

Page 491: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other Western European Regions subject to earthquake risk charge x97Other Eastern European Regions subject to earthquake risk charge x98Other Southern European Regions subject to earthquake risk charge x99Central and Western Asia x9Eastern Asia x12South and South-Eastern Asia x65Oceania x43Northern Africa x39Southern Africa x67Northern America excluding the United States of America x40Caribbean and Central America x8Eastern South America x13Northern, southern and western South America x41North-east United States of America x38South-east United States of America x66Mid-west United States of America x36Western United States of America x71

29: Natural Catastrophe risk - FloodNot applicable/All geographical areas x0

Specified Regions explicitly subject to flood risk charge x100AUSTRIA ATBELGIUM BEBULGARIA BGCZECH REPUBLIC CZSWITZERLAND; LIECHTENSTEIN x69FRANCE; MONACO; ANDORRA x81GERMANY DEHUNGARY HUITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE) x27POLAND PLROMANIA ROSLOVAKIA SKSLOVENIA SIUNITED KINGDOM GB

Other Regions subject to flood risk charge x101Other Northern Europe Regions subject to flood risk charge x102Other Western European Regions subject to flood risk charge x103Other Eastern European Regions subject to flood risk charge x104Other Southern European Regions subject to flood risk charge x105Central and Western Asia x9Eastern Asia x12South and South-Eastern Asia x65Oceania x43Northern Africa x39Southern Africa x67Northern America excluding the United States of America x40Caribbean and Central America x8Eastern South America x13Northern, southern and western South America x41North-east United States of America x38South-east United States of America x66

Page 492: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Mid-west United States of America x36Western United States of America x71

30: Natural Catastrophe risk - HailNot applicable/All geographical areas x0

Specified Regions explicitly subject to hail risk charge x106AUSTRIA ATBELGIUM BESWITZERLAND; LIECHTENSTEIN x69FRANCE; MONACO; ANDORRA x81GERMANY DEITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE) x27LUXEMBOURG LUNETHERLANDS NLSPAIN ES

Other Regions subject to hail risk charge x107Other Northern Europe Regions subject to hail risk charge x108Other Western European Regions subject to hail risk charge x109Other Eastern European Regions subject to hail risk charge x110Other Southern European Regions subject to hail risk charge x111Central and Western Asia x9Eastern Asia x12South and South-Eastern Asia x65Oceania x43Northern Africa x39Southern Africa x67Northern America excluding the United States of America x40Caribbean and Central America x8Eastern South America x13Northern, southern and western South America x41North-east United States of America x38South-east United States of America x66Mid-west United States of America x36Western United States of America x71

Page 493: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy node label Sign Weight Owner Usable Applicable ds2c LA, LX

Not applicable/All geographical areasAFGHANISTANÅLAND ISLANDSALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBHUTANBOLIVIA, PLURINATIONAL STATE OFBONAIRE, SINT EUSTATIUS AND SABABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THE

Page 494: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

COOK ISLANDSCOSTA RICACÔTE D'IVOIRECROATIACUBACURAÇAOCYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUERNSEYGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OF

Page 495: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

IRAQIRELANDISLE OF MANISRAELITALYJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTENEGROMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDS

Page 496: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

NEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPOLANDPORTUGALPUERTO RICOQATARRÉUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT BARTHÉLEMYSAINT KITTS AND NEVISSAINT LUCIASAINT MARTIN (FRENCH PART)SAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIASEYCHELLESSIERRA LEONESINGAPORESINT MAARTEN (DUTCH PART)SLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASPAINSRI LANKASUDANSURINAME

Page 497: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMANGUILLABERMUDABRITISH INDIAN OCEAN TERRITORYVIRGIN ISLANDS, BRITISHCAYMAN ISLANDSFALKLAND ISLANDS (MALVINAS)UNITED KINGDOM (GIBRALTAR)MONTSERRATPITCAIRNSAINT HELENA, ASCENSION AND TRISTAN DA CUNHASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSTURKS AND CAICOS ISLANDSUNITED STATESUNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELA, BOLIVARIAN REPUBLIC OFVIET NAMVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWESOUTH SUDAN

s2c EE, LA, LRNot applicable/All geographical areas =EEA = +

Page 498: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Home country +EEA countries [other than home country] +Not EEA countries +

s2c BINot applicable/All geographical areas =5 biggest = +1st biggest +2nd biggest +3rd biggest +4th biggest +5th biggest +Other than 5 biggest +

s2c CYNot applicable/All geographical areas =AFGHANISTAN +ÅLAND ISLANDS +ALBANIA +ALGERIA +AMERICAN SAMOA +ANDORRA +ANGOLA +ANGUILLA +ANTARCTICA +ANTIGUA AND BARBUDA +ARGENTINA +ARMENIA +ARUBA +AUSTRALIA +AUSTRIA +AZERBAIJAN +BAHAMAS +BAHRAIN +BANGLADESH +BARBADOS +BELARUS +BELGIUM +BELIZE +BENIN +BERMUDA +BHUTAN +BOLIVIA, PLURINATIONAL STATE OF +BONAIRE, SINT EUSTATIUS AND SABA +BOSNIA AND HERZEGOVINA +BOTSWANA +BOUVET ISLAND +BRAZIL +BRITISH INDIAN OCEAN TERRITORY +BRUNEI DARUSSALAM +BULGARIA +BURKINA FASO +BURUNDI +

Page 499: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

CAMBODIA +CAMEROON +CANADA +CAPE VERDE +CAYMAN ISLANDS +CENTRAL AFRICAN REPUBLIC +CHAD +CHILE +CHINA +CHRISTMAS ISLAND +COCOS (KEELING) ISLANDS +COLOMBIA +COMOROS +CONGO +CONGO, THE DEMOCRATIC REPUBLIC OF THE +COOK ISLANDS +COSTA RICA +CÔTE D'IVOIRE +CROATIA +CUBA +CURAÇAO +CYPRUS +CZECH REPUBLIC +DENMARK +DJIBOUTI +DOMINICA +DOMINICAN REPUBLIC +ECUADOR +EGYPT +EL SALVADOR +EQUATORIAL GUINEA +ERITREA +ESTONIA +ETHIOPIA +FALKLAND ISLANDS (MALVINAS) +FAROE ISLANDS +FIJI +FINLAND +FRANCE +FRENCH GUIANA +FRENCH POLYNESIA +FRENCH SOUTHERN TERRITORIES +GABON +GAMBIA +GEORGIA +GERMANY +GHANA +UNITED KINGDOM (GIBRALTAR) +GREECE +GREENLAND +GRENADA +

Page 500: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

GUADELOUPE +GUAM +GUATEMALA +GUERNSEY +GUINEA +GUINEA-BISSAU +GUYANA +HAITI +HEARD ISLAND AND MCDONALD ISLANDS +HOLY SEE (VATICAN CITY STATE) +HONDURAS +HONG KONG +HUNGARY +ICELAND +INDIA +INDONESIA +IRAN, ISLAMIC REPUBLIC OF +IRAQ +IRELAND +ISLE OF MAN +ISRAEL +ITALY +JAMAICA +JAPAN +JERSEY +JORDAN +KAZAKHSTAN +KENYA +KIRIBATI +KOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF +KOREA, REPUBLIC OF +KUWAIT +KYRGYZSTAN +LAO PEOPLE'S DEMOCRATIC REPUBLIC +LATVIA +LEBANON +LESOTHO +LIBERIA +LIBYA +LIECHTENSTEIN +LITHUANIA +LUXEMBOURG +MACAO +MACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF+MADAGASCAR +MALAWI +MALAYSIA +MALDIVES +MALI +MALTA +MARSHALL ISLANDS +

Page 501: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MARTINIQUE +MAURITANIA +MAURITIUS +MAYOTTE +MEXICO +MICRONESIA, FEDERATED STATES OF +MOLDOVA, REPUBLIC OF +MONACO +MONGOLIA +MONTENEGRO +MONTSERRAT +MOROCCO +MOZAMBIQUE +MYANMAR +NAMIBIA +NAURU +NEPAL +NETHERLANDS +NEW CALEDONIA +NEW ZEALAND +NICARAGUA +NIGER +NIGERIA +NIUE +NORFOLK ISLAND +NORTHERN MARIANA ISLANDS +NORWAY +OMAN +PAKISTAN +PALAU +PALESTINIAN TERRITORY, OCCUPIED +PANAMA +PAPUA NEW GUINEA +PARAGUAY +PERU +PHILIPPINES +PITCAIRN +POLAND +PORTUGAL +PUERTO RICO +QATAR +RÉUNION +ROMANIA +RUSSIAN FEDERATION +RWANDA +SAINT BARTHÉLEMY +SAINT HELENA, ASCENSION AND TRISTAN DA CUNH +SAINT KITTS AND NEVIS +SAINT LUCIA +SAINT MARTIN (FRENCH PART) +SAINT PIERRE AND MIQUELON +

Page 502: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SAINT VINCENT AND THE GRENADINES +SAMOA +SAN MARINO +SAO TOME AND PRINCIPE +SAUDI ARABIA +SENEGAL +SERBIA +SEYCHELLES +SIERRA LEONE +SINGAPORE +SINT MAARTEN (DUTCH PART) +SLOVAKIA +SLOVENIA +SOLOMON ISLANDS +SOMALIA +SOUTH AFRICA +SOUTH GEORGIA AND THE SOUTH SANDWICH ISLAN+SOUTH SUDAN +SPAIN +SRI LANKA +SUDAN +SURINAME +SVALBARD AND JAN MAYEN +SWAZILAND +SWEDEN +SWITZERLAND +SYRIAN ARAB REPUBLIC +TAIWAN, PROVINCE OF CHINA +TAJIKISTAN +TANZANIA, UNITED REPUBLIC OF +THAILAND +TIMOR-LESTE +TOGO +TOKELAU +TONGA +TRINIDAD AND TOBAGO +TUNISIA +TURKEY +TURKMENISTAN +TURKS AND CAICOS ISLANDS +TUVALU +UGANDA +UKRAINE +UNITED ARAB EMIRATES +UNITED KINGDOM +UNITED STATES +UNITED STATES MINOR OUTLYING ISLANDS +URUGUAY +UZBEKISTAN +VANUATU +VENEZUELA, BOLIVARIAN REPUBLIC OF +

Page 503: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

VIET NAM +VIRGIN ISLANDS, BRITISH +VIRGIN ISLANDS, U.S. +WALLIS AND FUTUNA +WESTERN SAHARA +YEMEN +ZAMBIA +ZIMBABWE +European Union institutions +Supranational Issuers +

s2c N/ANot applicable/All geographical areas =AFGHANISTAN +ÅLAND ISLANDS +ALBANIA +ALGERIA +AMERICAN SAMOA +ANDORRA +ANGOLA +ANGUILLA +ANTARCTICA +ANTIGUA AND BARBUDA +ARGENTINA +ARMENIA +ARUBA +AUSTRALIA +AUSTRIA +AZERBAIJAN +BAHAMAS +BAHRAIN +BANGLADESH +BARBADOS +BELARUS +BELGIUM +BELIZE +BENIN +BERMUDA +BHUTAN +BOLIVIA, PLURINATIONAL STATE OF +BONAIRE, SINT EUSTATIUS AND SABA +BOSNIA AND HERZEGOVINA +BOTSWANA +BOUVET ISLAND +BRAZIL +BRITISH INDIAN OCEAN TERRITORY +BRUNEI DARUSSALAM +BULGARIA +BURKINA FASO +BURUNDI +CAMBODIA +CAMEROON +

Page 504: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

CANADA +CAPE VERDE +CAYMAN ISLANDS +CENTRAL AFRICAN REPUBLIC +CHAD +CHILE +CHINA +CHRISTMAS ISLAND +COCOS (KEELING) ISLANDS +COLOMBIA +COMOROS +CONGO +CONGO, THE DEMOCRATIC REPUBLIC OF THE +COOK ISLANDS +COSTA RICA +CÔTE D'IVOIRE +CROATIA +CUBA +CURAÇAO +CYPRUS +CZECH REPUBLIC +DENMARK +DJIBOUTI +DOMINICA +DOMINICAN REPUBLIC +ECUADOR +EGYPT +EL SALVADOR +EQUATORIAL GUINEA +ERITREA +ESTONIA +ETHIOPIA +FALKLAND ISLANDS (MALVINAS) +FAROE ISLANDS +FIJI +FINLAND +FRANCE +FRENCH GUIANA +FRENCH POLYNESIA +FRENCH SOUTHERN TERRITORIES +GABON +GAMBIA +GEORGIA +GERMANY +GHANA +UNITED KINGDOM (GIBRALTAR) +GREECE +GREENLAND +GRENADA +GUADELOUPE +GUAM +

Page 505: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

GUATEMALA +GUERNSEY +GUINEA +GUINEA-BISSAU +GUYANA +HAITI +HEARD ISLAND AND MCDONALD ISLANDS +HOLY SEE (VATICAN CITY STATE) +HONDURAS +HONG KONG +HUNGARY +ICELAND +INDIA +INDONESIA +IRAN, ISLAMIC REPUBLIC OF +IRAQ +IRELAND +ISLE OF MAN +ISRAEL +ITALY +JAMAICA +JAPAN +JERSEY +JORDAN +KAZAKHSTAN +KENYA +KIRIBATI +KOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF +KOREA, REPUBLIC OF +KUWAIT +KYRGYZSTAN +LAO PEOPLE'S DEMOCRATIC REPUBLIC +LATVIA +LEBANON +LESOTHO +LIBERIA +LIBYA +LIECHTENSTEIN +LITHUANIA +LUXEMBOURG +MACAO +MACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF+MADAGASCAR +MALAWI +MALAYSIA +MALDIVES +MALI +MALTA +MARSHALL ISLANDS +MARTINIQUE +MAURITANIA +

Page 506: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MAURITIUS +MAYOTTE +MEXICO +MICRONESIA, FEDERATED STATES OF +MOLDOVA, REPUBLIC OF +MONACO +MONGOLIA +MONTENEGRO +MONTSERRAT +MOROCCO +MOZAMBIQUE +MYANMAR +NAMIBIA +NAURU +NEPAL +NETHERLANDS +NEW CALEDONIA +NEW ZEALAND +NICARAGUA +NIGER +NIGERIA +NIUE +NORFOLK ISLAND +NORTHERN MARIANA ISLANDS +NORWAY +OMAN +PAKISTAN +PALAU +PALESTINIAN TERRITORY, OCCUPIED +PANAMA +PAPUA NEW GUINEA +PARAGUAY +PERU +PHILIPPINES +PITCAIRN +POLAND +PORTUGAL +PUERTO RICO +QATAR +RÉUNION +ROMANIA +RUSSIAN FEDERATION +RWANDA +SAINT BARTHÉLEMY +SAINT HELENA, ASCENSION AND TRISTAN DA CUNH +SAINT KITTS AND NEVIS +SAINT LUCIA +SAINT MARTIN (FRENCH PART) +SAINT PIERRE AND MIQUELON +SAINT VINCENT AND THE GRENADINES +SAMOA +

Page 507: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SAN MARINO +SAO TOME AND PRINCIPE +SAUDI ARABIA +SENEGAL +SERBIA +SEYCHELLES +SIERRA LEONE +SINGAPORE +SINT MAARTEN (DUTCH PART) +SLOVAKIA +SLOVENIA +SOLOMON ISLANDS +SOMALIA +SOUTH AFRICA +SOUTH GEORGIA AND THE SOUTH SANDWICH ISLAN+SPAIN +SRI LANKA +SUDAN +SURINAME +SVALBARD AND JAN MAYEN +SWAZILAND +SWEDEN +SWITZERLAND +SYRIAN ARAB REPUBLIC +TAIWAN, PROVINCE OF CHINA +TAJIKISTAN +TANZANIA, UNITED REPUBLIC OF +THAILAND +TIMOR-LESTE +TOGO +TOKELAU +TONGA +TRINIDAD AND TOBAGO +TUNISIA +TURKEY +TURKMENISTAN +TURKS AND CAICOS ISLANDS +TUVALU +UGANDA +UKRAINE +UNITED ARAB EMIRATES +UNITED KINGDOM +UNITED STATES +UNITED STATES MINOR OUTLYING ISLANDS +URUGUAY +UZBEKISTAN +VANUATU +VENEZUELA, BOLIVARIAN REPUBLIC OF +VIET NAM +VIRGIN ISLANDS, BRITISH +VIRGIN ISLANDS, U.S. +

Page 508: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

WALLIS AND FUTUNA +WESTERN SAHARA +YEMEN +ZAMBIA +ZIMBABWE +SOUTH SUDAN +

s2c CYNot applicable/All geographical areas =EEA +OECD [non-EEA] +RoW [rest of the world] +

s2c LXNot applicable/All geographical areas =EEA = +Republic of Austria +Kingdom of Belgium +CZECH REPUBLIC +SWITZERLAND; LIECHTENSTEIN +Kingdom of Denmark +French Republic [except Guadeloupe, Martinique, the+Federal Republic of Germany +Republic of Iceland +IRELAND +Grand Duchy of Luxemburg +Kingdom of the Netherlands +Kingdom of Norway +Republic of Poland +SPAIN; ANDORRA +Kingdom of Sweden +United Kingdom of Great Britain and Northern Irela +GUADELOUPE +MARTINIQUE +Collectivity of Saint Martin +RÉUNION +Non-EEA = +Central and Western Asia +Eastern Asia +South and South-Eastern Asia +Oceania +Northern Africa +Southern Africa +Northern America excluding the United States of Am+Caribbean and Central America +Eastern South America +Northern, southern and western South America +North-east United States of America +South-east United States of America +Mid-west United States of America +Western United States of America +

s2c LXNot applicable/All geographical areas =

Page 509: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

EEA = +Republic of Austria +Kingdom of Belgium +Republic of Bulgaria +Republic of Croatia +Republic of Cyprus +CZECH REPUBLIC +SWITZERLAND; LIECHTENSTEIN +French Republic [except Guadeloupe, Martinique, the+Federal Republic of Germany +Hellenic Republic +Republic of Hungary +ITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE+Republic of Malta +Portuguese Republic +ROMANIA +Slovak Republic +Republic of Slovenia +GUADELOUPE +MARTINIQUE +Collectivity of Saint Martin +Non-EEA = +Central and Western Asia +Eastern Asia +South and South-Eastern Asia +Oceania +Northern Africa +Southern Africa +Northern America excluding the United States of Am+Caribbean and Central America +Eastern South America +Northern, southern and western South America +North-east United States of America +South-east United States of America +Mid-west United States of America +Western United States of America +

s2c LXNot applicable/All geographical areas =EEA = +Republic of Austria +Kingdom of Belgium +Republic of Bulgaria +CZECH REPUBLIC +SWITZERLAND; LIECHTENSTEIN +French Republic [except Guadeloupe, Martinique, the+Federal Republic of Germany +Republic of Hungary +ITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE+Republic of Poland +ROMANIA +Slovak Republic +

Page 510: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Republic of Slovenia +United Kingdom of Great Britain and Northern Irela +Non-EEA = +Central and Western Asia +Eastern Asia +South and South-Eastern Asia +Oceania +Northern Africa +Southern Africa +Northern America excluding the United States of Am+Caribbean and Central America +Eastern South America +Northern, southern and western South America +North-east United States of America +South-east United States of America +Mid-west United States of America +Western United States of America +

s2c LXNot applicable/All geographical areas =EEA = +Republic of Austria +Kingdom of Belgium +SWITZERLAND; LIECHTENSTEIN +French Republic [except Guadeloupe, Martinique, the+Federal Republic of Germany +ITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE+Grand Duchy of Luxemburg +Kingdom of the Netherlands +SPAIN; ANDORRA +Non-EEA = +Central and Western Asia +Eastern Asia +South and South-Eastern Asia +Oceania +Northern Africa +Southern Africa +Northern America excluding the United States of Am+Caribbean and Central America +Eastern South America +Northern, southern and western South America +North-east United States of America +South-east United States of America +Mid-west United States of America +Western United States of America +

s2c LA, LXNot applicable/All geographical areas =31 countries for health catastrophe risk = +Republic of Austria +Kingdom of Belgium +Republic of Bulgaria +Republic of Croatia +

Page 511: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Republic of Cyprus +CZECH REPUBLIC +Kingdom of Denmark +Republic of Estonia +Republic of Finland +French Republic +Hellenic Republic +Federal Republic of Germany +Republic of Hungary +Republic of Iceland +IRELAND +Italian Republic +Republic of Latvia +Republic of Lithuania +Grand Duchy of Luxemburg +Republic of Malta +Kingdom of the Netherlands +Kingdom of Norway +Republic of Poland +Portuguese Republic +ROMANIA +Slovak Republic +Republic of Slovenia +Kingdom of Spain +Kingdom of Sweden +Swiss Confederation +United Kingdom of Great Britain and Northern Irela +Other than 31 countries for health catastrophe risk +

s2c CYNot applicable/All geographical areas =EEA +Non-EEA +

s2c LG, LR, LANot applicable/All geographical areas noAUSTRIABELGIUMBULGARIACYPRUSCZECH REPUBLICDENMARKESTONIAFINLANDFRANCEGERMANYGREECECROATIAHUNGARYICELANDIRELANDITALYLATVIA

Page 512: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

LIECHTENSTEINLITHUANIALUXEMBOURGMALTANETHERLANDSNORWAYPOLANDPORTUGALROMANIASLOVAKIASLOVENIASPAINSWEDENUNITED KINGDOMUNITED KINGDOM (GIBRALTAR)

s2c CY, LRNot applicable/All geographical areas noAFGHANISTANÅLAND ISLANDSALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELIZEBENINBERMUDABHUTANBOLIVIA, PLURINATIONAL STATE OFBONAIRE, SINT EUSTATIUS AND SABABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBURKINA FASOBURUNDI

Page 513: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

CAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACÔTE D'IVOIRECUBACURAÇAODJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGHANAUNITED KINGDOM (GIBRALTAR) noGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUERNSEYGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDS

Page 514: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

HOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQISLE OF MANISRAELJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLEBANONLESOTHOLIBERIALIBYAMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTENEGROMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNEW CALEDONIA

Page 515: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

NEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPUERTO RICOQATARRÉUNIONRUSSIAN FEDERATIONRWANDASAINT BARTHÉLEMYSAINT HELENA, ASCENSION AND TRISTAN DA CUNHASAINT KITTS AND NEVISSAINT LUCIASAINT MARTIN (FRENCH PART)SAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIASEYCHELLESSIERRA LEONESINGAPORESINT MAARTEN (DUTCH PART)SOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINA

Page 516: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

TAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED STATESUNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELA, BOLIVARIAN REPUBLIC OFVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWESOUTH SUDAN

s2c BINot applicable/All geographical areas =5 biggest and home country = +Home country +5 biggest = +1st biggest +2nd biggest +3rd biggest +4th biggest +5th biggest +Other than 5 biggest and home country +

s2c EENot applicable/All geographical areas =Home country +Other than home country = +EEA countries [other than home country] +Not EEA countries +

s2c LANot applicable/All geographical areas =Local +

Page 517: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Not local = +Not local [EEA] +

s2c LA, LG, LXNot applicable/All geographical areas noAFGHANISTANÅLAND ISLANDSALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIA, PLURINATIONAL STATE OFBONAIRE, SINT EUSTATIUS AND SABABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLAND

Page 518: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

COCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACÔTE D'IVOIRECROATIACUBACURAÇAOCYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUERNSEYGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHOLY SEE (VATICAN CITY STATE)HONDURAS

Page 519: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

HONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISLE OF MANISRAELITALYJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTENEGROMONTSERRAT

Page 520: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARRÉUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT BARTHÉLEMYSAINT HELENA, ASCENSION AND TRISTAN DA CUNHASAINT KITTS AND NEVISSAINT LUCIASAINT MARTIN (FRENCH PART)SAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIASEYCHELLESSIERRA LEONESINGAPORESINT MAARTEN (DUTCH PART)

Page 521: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED KINGDOM (GIBRALTAR)UNITED STATESUNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELA, BOLIVARIAN REPUBLIC OFVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWESOUTH SUDAN

s2c CYAFGHANISTAN

Page 522: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ÅLAND ISLANDSALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIA, PLURINATIONAL STATE OFBONAIRE, SINT EUSTATIUS AND SABABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THE

Page 523: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

COOK ISLANDSCOSTA RICACÔTE D'IVOIRECROATIACUBACURAÇAOCYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAUNITED KINGDOM (GIBRALTAR)GREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUERNSEYGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIA

Page 524: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

INDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISLE OF MANISRAELITALYJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTENEGROMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIA

Page 525: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

NAURUNEPALNETHERLANDSNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARRÉUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT BARTHÉLEMYSAINT HELENA, ASCENSION AND TRISTAN DA CUNHASAINT KITTS AND NEVISSAINT LUCIASAINT MARTIN (FRENCH PART)SAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIASEYCHELLESSIERRA LEONESINGAPORESINT MAARTEN (DUTCH PART)SLOVAKIASLOVENIASOLOMON ISLANDSSOMALIA

Page 526: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESUNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELA, BOLIVARIAN REPUBLIC OFVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWEEuropean Union institutionsSupranational IssuersSOUTH SUDAN

s2c LA, CYNot applicable/All geographical areas =Euro area = +Home country +Euro area other than home country +

Page 527: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Non-euro area +s2c LX

Not applicable/All geographical areas =35 countries for health catastrophe risk = +AUSTRIA +BELGIUM +BULGARIA +CROATIA +CYPRUS +CZECH REPUBLIC +DENMARK +ESTONIA +FINLAND +FRANCE; MONACO; ANDORRA = +FRANCE +MONACO +ANDORRA +GREECE +GERMANY +HUNGARY +ICELAND +IRELAND +ITALY; SAN MARINO; HOLY SEE (VATICAN = +ITALY +SAN MARINO +HOLY SEE (VATICAN CITY STATE) +LATVIA +LITHUANIA +LUXEMBOURG +MALTA +NETHERLANDS +NORWAY +POLAND +PORTUGAL +ROMANIA +SLOVAKIA +SLOVENIA +SPAIN +SWEDEN +SWITZERLAND +UNITED KINGDOM +Other than 35 countries for health catastrophe risk +

s2c LXNot applicable/All geographical areas =EEA = +AUSTRIA +BELGIUM +BULGARIA +CROATIA +CYPRUS +CZECH REPUBLIC +

Page 528: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

DENMARK +ESTONIA +FINLAND +SWITZERLAND; LIECHTENSTEIN = +SWITZERLAND +LIECHTENSTEIN +FRANCE; MONACO; ANDORRA = +FRANCE +MONACO +ANDORRA +GERMANY +GREECE +HUNGARY +ICELAND +IRELAND +ITALY; SAN MARINO; HOLY SEE (VATICAN = +ITALY +SAN MARINO +HOLY SEE (VATICAN CITY STATE) +LATVIA +LITHUANIA +LUXEMBOURG +MALTA +NETHERLANDS +NORWAY +POLAND +PORTUGAL +ROMANIA +SLOVAKIA +SLOVENIA +SPAIN +SWEDEN +UNITED KINGDOM +GUADELOUPE +MARTINIQUE +SAINT MARTIN (FRENCH PART) +RÉUNION +Non-EEA = +Central and Western Asia +Eastern Asia +South and South-Eastern Asia +Oceania +Northern Africa +Southern Africa +Northern America excluding the United States of Am+Caribbean and Central America +Eastern South America +Northern, southern and western South America +North-east United States of America +South-east United States of America +Mid-west United States of America +

Page 529: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Western United States of America +s2c CY

AFGHANISTANÅLAND ISLANDSALBANIAALGERIAAMERICAN SAMOAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELIZEBENINBERMUDABHUTANBOLIVIA, PLURINATIONAL STATE OFBONAIRE, SINT EUSTATIUS AND SABABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDS

Page 530: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

COSTA RICACÔTE D'IVOIRECUBACURAÇAODJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGHANAUNITED KINGDOM (GIBRALTAR)GREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUERNSEYGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHONDURASHONG KONGINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQISLE OF MANISRAELJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF

Page 531: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

KOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLEBANONLESOTHOLIBERIALIBYALIECHTENSTEINMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONGOLIAMONTENEGROMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRN

Page 532: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

PUERTO RICOQATARRÉUNIONRUSSIAN FEDERATIONRWANDASAINT BARTHÉLEMYSAINT HELENA, ASCENSION AND TRISTAN DA CUNHASAINT KITTS AND NEVISSAINT LUCIASAINT MARTIN (FRENCH PART)SAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIASEYCHELLESSIERRA LEONESINGAPORESINT MAARTEN (DUTCH PART)SOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSOUTH SUDANSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED STATES

Page 533: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

UNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELA, BOLIVARIAN REPUBLIC OFVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWE

s2c LXEEANorthern EuropeWestern EuropeEastern EuropeSouthern EuropeNon-EEA

s2c LXNot applicable/All geographical areas noAFGHANISTANÅLAND ISLANDSALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELIZEBENINBERMUDABHUTANBOLIVIA, PLURINATIONAL STATE OFBONAIRE, SINT EUSTATIUS AND SABABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLAND

Page 534: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

BRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACÔTE D'IVOIRECUBACURAÇAODJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGHANAUNITED KINGDOM (GIBRALTAR)GREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUERNSEY

Page 535: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

GUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQISLE OF MANISRAELJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLEBANONLESOTHOLIBERIALIBYALIECHTENSTEINMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTENEGROMONTSERRATMOROCCO

Page 536: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

MOZAMBIQUEMYANMARNAMIBIANAURUNEPALNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPUERTO RICOQATARRÉUNIONRUSSIAN FEDERATIONRWANDASAINT BARTHÉLEMYSAINT HELENA, ASCENSION AND TRISTAN DA CUNHASAINT KITTS AND NEVISSAINT LUCIASAINT MARTIN (FRENCH PART)SAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIASEYCHELLESSIERRA LEONESINGAPORESINT MAARTEN (DUTCH PART)SOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSOUTH SUDANSRI LANKA

Page 537: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED STATESUNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELA, BOLIVARIAN REPUBLIC OFVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWE

s2c CYNot applicable/All geographical areas =AFGHANISTAN +ÅLAND ISLANDS +ALBANIA +ALGERIA +AMERICAN SAMOA +ANDORRA +ANGOLA +ANGUILLA +ANTARCTICA +ANTIGUA AND BARBUDA +ARGENTINA +ARMENIA +ARUBA +

Page 538: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

AUSTRALIA +AUSTRIA +AZERBAIJAN +BAHAMAS +BAHRAIN +BANGLADESH +BARBADOS +BELARUS +BELGIUM +BELIZE +BENIN +BERMUDA +BHUTAN +BOLIVIA, PLURINATIONAL STATE OF +BONAIRE, SINT EUSTATIUS AND SABA +BOSNIA AND HERZEGOVINA +BOTSWANA +BOUVET ISLAND +BRAZIL +BRITISH INDIAN OCEAN TERRITORY +BRUNEI DARUSSALAM +BULGARIA +BURKINA FASO +BURUNDI +CAMBODIA +CAMEROON +CANADA +CAPE VERDE +CAYMAN ISLANDS +CENTRAL AFRICAN REPUBLIC +CHAD +CHILE +CHINA +CHRISTMAS ISLAND +COCOS (KEELING) ISLANDS +COLOMBIA +COMOROS +CONGO +CONGO, THE DEMOCRATIC REPUBLIC OF THE +COOK ISLANDS +COSTA RICA +CÔTE D'IVOIRE +CROATIA +CUBA +CURAÇAO +CYPRUS +CZECH REPUBLIC +DENMARK +DJIBOUTI +DOMINICA +DOMINICAN REPUBLIC +

Page 539: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

ECUADOR +EGYPT +EL SALVADOR +EQUATORIAL GUINEA +ERITREA +ESTONIA +ETHIOPIA +FALKLAND ISLANDS (MALVINAS) +FAROE ISLANDS +FIJI +FINLAND +FRANCE +FRENCH GUIANA +FRENCH POLYNESIA +FRENCH SOUTHERN TERRITORIES +GABON +GAMBIA +GEORGIA +GERMANY +GHANA +UNITED KINGDOM (GIBRALTAR) +GREECE +GREENLAND +GRENADA +GUADELOUPE +GUAM +GUATEMALA +GUERNSEY +GUINEA +GUINEA-BISSAU +GUYANA +HAITI +HEARD ISLAND AND MCDONALD ISLANDS +HOLY SEE (VATICAN CITY STATE) +HONDURAS +HONG KONG +HUNGARY +ICELAND +INDIA +INDONESIA +IRAN, ISLAMIC REPUBLIC OF +IRAQ +IRELAND +ISLE OF MAN +ISRAEL +ITALY +JAMAICA +JAPAN +JERSEY +JORDAN +KAZAKHSTAN +

Page 540: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

KENYA +KIRIBATI +KOREA, DEMOCRATIC PEOPLE'S REPUBLIC OF +KOREA, REPUBLIC OF +KUWAIT +KYRGYZSTAN +LAO PEOPLE'S DEMOCRATIC REPUBLIC +LATVIA +LEBANON +LESOTHO +LIBERIA +LIBYA +LIECHTENSTEIN +LITHUANIA +LUXEMBOURG +MACAO +MACEDONIA, THE FORMER YUGOSLAV REPUBLIC OF+MADAGASCAR +MALAWI +MALAYSIA +MALDIVES +MALI +MALTA +MARSHALL ISLANDS +MARTINIQUE +MAURITANIA +MAURITIUS +MAYOTTE +MEXICO +MICRONESIA, FEDERATED STATES OF +MOLDOVA, REPUBLIC OF +MONACO +MONGOLIA +MONTENEGRO +MONTSERRAT +MOROCCO +MOZAMBIQUE +MYANMAR +NAMIBIA +NAURU +NEPAL +NETHERLANDS +NEW CALEDONIA +NEW ZEALAND +NICARAGUA +NIGER +NIGERIA +NIUE +NORFOLK ISLAND +NORTHERN MARIANA ISLANDS +NORWAY +

Page 541: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

OMAN +PAKISTAN +PALAU +PALESTINIAN TERRITORY, OCCUPIED +PANAMA +PAPUA NEW GUINEA +PARAGUAY +PERU +PHILIPPINES +PITCAIRN +POLAND +PORTUGAL +PUERTO RICO +QATAR +RÉUNION +ROMANIA +RUSSIAN FEDERATION +RWANDA +SAINT BARTHÉLEMY +SAINT HELENA, ASCENSION AND TRISTAN DA CUNH +SAINT KITTS AND NEVIS +SAINT LUCIA +SAINT MARTIN (FRENCH PART) +SAINT PIERRE AND MIQUELON +SAINT VINCENT AND THE GRENADINES +SAMOA +SAN MARINO +SAO TOME AND PRINCIPE +SAUDI ARABIA +SENEGAL +SERBIA +SEYCHELLES +SIERRA LEONE +SINGAPORE +SINT MAARTEN (DUTCH PART) +SLOVAKIA +SLOVENIA +SOLOMON ISLANDS +SOMALIA +SOUTH AFRICA +SOUTH GEORGIA AND THE SOUTH SANDWICH ISLAN+SPAIN +SRI LANKA +SUDAN +SURINAME +SVALBARD AND JAN MAYEN +SWAZILAND +SWEDEN +SWITZERLAND +SYRIAN ARAB REPUBLIC +TAIWAN, PROVINCE OF CHINA +

Page 542: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

TAJIKISTAN +TANZANIA, UNITED REPUBLIC OF +THAILAND +TIMOR-LESTE +TOGO +TOKELAU +TONGA +TRINIDAD AND TOBAGO +TUNISIA +TURKEY +TURKMENISTAN +TURKS AND CAICOS ISLANDS +TUVALU +UGANDA +UKRAINE +UNITED ARAB EMIRATES +UNITED KINGDOM +UNITED STATES +UNITED STATES MINOR OUTLYING ISLANDS +URUGUAY +UZBEKISTAN +VANUATU +VENEZUELA, BOLIVARIAN REPUBLIC OF +VIET NAM +VIRGIN ISLANDS, BRITISH +VIRGIN ISLANDS, U.S. +WALLIS AND FUTUNA +WESTERN SAHARA +YEMEN +ZAMBIA +ZIMBABWE +European Union institutions +Supranational Issuers +SOUTH SUDAN +Aggregated countries due to application of threshol +

s2c LXNot applicable/All geographical areas =Specified Regions explicitly subject to wi = +AUSTRIA +BELGIUM +CZECH REPUBLIC +SWITZERLAND; LIECHTENSTEIN +DENMARK +FRANCE; MONACO; ANDORRA +GERMANY +ICELAND +IRELAND +LUXEMBOURG +NETHERLANDS +NORWAY +POLAND +

Page 543: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SPAIN +SWEDEN +UNITED KINGDOM +GUADELOUPE +MARTINIQUE +SAINT MARTIN (FRENCH PART) +RÉUNION +Other Regions subject to windstorm risk = +Other Northern Europe Regions subject to windstorm+Other Western European Regions subject to windsto+Other Eastern European Regions subject to windstor+Other Southern European Regions subject to windst+Central and Western Asia +Eastern Asia +South and South-Eastern Asia +Oceania +Northern Africa +Southern Africa +Northern America excluding the United States of Am+Caribbean and Central America +Eastern South America +Northern, southern and western South America +North-east United States of America +South-east United States of America +Mid-west United States of America +Western United States of America +

s2c LXNot applicable/All geographical areas =Specified Regions explicitly subject to ea = +AUSTRIA +BELGIUM +BULGARIA +CROATIA +CYPRUS +CZECH REPUBLIC +SWITZERLAND; LIECHTENSTEIN +FRANCE; MONACO; ANDORRA +GERMANY +GREECE +HUNGARY +ITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE+MALTA +PORTUGAL +ROMANIA +SLOVAKIA +SLOVENIA +GUADELOUPE +MARTINIQUE +SAINT MARTIN (FRENCH PART) +Other Regions subject to earthquake risk = +Other Northern Europe Regions subject to earthquak+

Page 544: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other Western European Regions subject to earthqu+Other Eastern European Regions subject to earthqua+Other Southern European Regions subject to earthqu+Central and Western Asia +Eastern Asia +South and South-Eastern Asia +Oceania +Northern Africa +Southern Africa +Northern America excluding the United States of Am+Caribbean and Central America +Eastern South America +Northern, southern and western South America +North-east United States of America +South-east United States of America +Mid-west United States of America +Western United States of America +

s2c LXNot applicable/All geographical areas =Specified Regions explicitly subject to flo = +AUSTRIA +BELGIUM +BULGARIA +CZECH REPUBLIC +SWITZERLAND; LIECHTENSTEIN +FRANCE; MONACO; ANDORRA +GERMANY +HUNGARY +ITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE+POLAND +ROMANIA +SLOVAKIA +SLOVENIA +UNITED KINGDOM +Other Regions subject to flood risk charge= +Other Northern Europe Regions subject to flood risk+Other Western European Regions subject to flood ri +Other Eastern European Regions subject to flood ris +Other Southern European Regions subject to flood ri+Central and Western Asia +Eastern Asia +South and South-Eastern Asia +Oceania +Northern Africa +Southern Africa +Northern America excluding the United States of Am+Caribbean and Central America +Eastern South America +Northern, southern and western South America +North-east United States of America +South-east United States of America +

Page 545: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Mid-west United States of America +Western United States of America +

s2c LXNot applicable/All geographical areas =Specified Regions explicitly subject to hail= +AUSTRIA +BELGIUM +SWITZERLAND; LIECHTENSTEIN +FRANCE; MONACO; ANDORRA +GERMANY +ITALY; SAN MARINO; HOLY SEE (VATICAN CITY STATE+LUXEMBOURG +NETHERLANDS +SPAIN +Other Regions subject to hail risk charge = +Other Northern Europe Regions subject to hail risk +Other Western European Regions subject to hail risk+Other Eastern European Regions subject to hail risk +Other Southern European Regions subject to hail ris +Central and Western Asia +Eastern Asia +South and South-Eastern Asia +Oceania +Northern Africa +Southern Africa +Northern America excluding the United States of Am+Caribbean and Central America +Eastern South America +Northern, southern and western South America +North-east United States of America +South-east United States of America +Mid-west United States of America +Western United States of America +

Page 546: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable sheets for Creation date Validity date Last modified dateS.06.02 (201), SE.06.02 7/7/2014 7/15/2016

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 547: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 548: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 549: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 550: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 551: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 9/30/2015

S.06.02 (201), SE.06.02 7/7/2014 7/15/20177/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 552: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/2014

Page 553: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 554: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 555: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 556: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/2017

S.01.02 (201), SPV.01.0 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 557: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/2014

Page 558: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 559: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 560: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 561: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014

Page 562: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/2014

Page 563: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/2015 9/30/20157/7/20147/7/20147/7/20147/7/2014

Page 564: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/2014

S.01.02 (201), S.04.02 7/7/2014 7/15/20177/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 565: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/2016

S.04.01 (201) 9/30/2015 7/15/20177/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 566: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 567: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 568: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 569: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

9/30/2015 9/30/20159/30/2015

7/7/20147/7/2014

9/30/20157/7/20147/7/2014

9/30/20157/7/2014

9/30/2015

Page 570: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/2015

S.05.02 (201), SE.06.02 9/30/2015 7/15/20177/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 571: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 572: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 573: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 574: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/2015 7/15/20177/7/2014

Page 575: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 576: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 577: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 578: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 579: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20177/7/2014

9/30/20157/7/2014

9/30/2015 9/30/20157/7/2014

9/30/2015

Page 580: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/2015

7/7/20149/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/2015 12/31/2013

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 581: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 582: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20149/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 583: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 584: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 585: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 586: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/2015 12/31/20137/7/2014

9/30/20159/30/20159/30/20159/30/2015

7/7/2014S.27.01 (201), SR.27.01 9/30/2015 7/15/2017

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 587: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 588: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 589: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 590: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

S.06.03 (201) 7/7/2014 7/15/20177/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 591: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 592: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 593: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 594: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 595: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20177/7/2014

9/30/20159/30/2015

7/7/20149/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 596: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/2015

Page 597: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 598: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/2014

9/30/20157/7/2014

9/30/20157/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 599: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Comment

Page 600: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerTotal/NA x0 yes s2cAfar aa s2cAbkhazian ab s2cAvestan ae s2cAfrikaans af s2cAkan ak s2cAmharic am s2cAragonese an s2cArabic ar s2cAssamese as s2cAvaric av s2cAymara ay s2cAzerbaijani az s2cBashkir ba s2cBelarusian be s2cBulgarian bg s2cBihari languages bh s2cBislama bi s2cBambara bm s2cBengali bn s2cTibetan bo s2cBreton br s2cBosnian bs s2cCatalan ca s2cChechen ce s2cChamorro ch s2cCorsican co s2cCree cr s2cCzech cs s2cChurch Slavic cu s2cChuvash cv s2cWelsh cy s2cDanish da s2cGerman de s2cDhivehi dv s2cDzongkha dz s2cEwe ee s2cModern Greek (1453-) el s2cEnglish en s2cEsperanto eo s2cSpanish es s2cEstonian et s2cBasque eu s2cPersian fa s2cFulah ff s2cFinnish fi s2cFijian fj s2cFaroese fo s2cFrench fr s2cWestern Frisian fy s2c

Page 601: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Irish ga s2cScottish Gaelic gd s2cGalician gl s2cGuarani gn s2cGujarati gu s2cManx gv s2cHausa ha s2cHebrew he s2cHindi hi s2cHiri Motu ho s2cCroatian hr s2cHaitian ht s2cHungarian hu s2cArmenian hy s2cHerero hz s2cInterlingua (International Auxiliary Language Association) ia s2cIndonesian id s2cInterlingue ie s2cIgbo ig s2cSichuan Yi ii s2cInupiaq ik s2cIdo io s2cIcelandic is s2cItalian it s2cInuktitut iu s2cJapanese ja s2cJavanese jv s2cGeorgian ka s2cKongo kg s2cKikuyu ki s2cKuanyama kj s2cKazakh kk s2cKalaallisut kl s2cCentral Khmer km s2cKannada kn s2cKorean ko s2cKanuri kr s2cKashmiri ks s2cKurdish ku s2cKomi kv s2cCornish kw s2cKirghiz ky s2cLuxembourgish lb s2cGanda lg s2cLimburgan li s2cLingala ln s2cLao lo s2cLithuanian lt s2cLuba-Katanga lu s2cLatvian lv s2cMalagasy mg s2c

Page 602: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Marshallese mh s2cMaori mi s2cMacedonian mk s2cMalayalam ml s2cMongolian mn s2cMarathi mr s2cMalay (macrolanguage) ms s2cMaltese mt s2cBurmese my s2cNauru na s2cNorwegian Bokmål nb s2cNorth Ndebele nd s2cNepali (macrolanguage) ne s2cNdonga ng s2cDutch nl s2cNorwegian Nynorsk nn s2cNorwegian no s2cSouth Ndebele nr s2cNavajo nv s2cNyanja ny s2cOccitan (post 1500) oc s2cOjibwa oj s2cOromo om s2cOriya (macrolanguage) or s2cOssetian os s2cPanjabi pa s2cPali pi s2cPolish pl s2cPushto ps s2cPortuguese pt s2cQuechua qu s2cRomansh rm s2cRundi rn s2cRomanian ro s2cRussian ru s2cKinyarwanda rw s2cSardinian sc s2cSindhi sd s2cNorthern Sami se s2cSango sg s2cSerbo-Croatian sh s2cSinhala si s2cSlovak sk s2cSlovenian sl s2cSamoan sm s2cShona sn s2cSomali so s2cAlbanian sq s2cSerbian sr s2cSwati ss s2cSouthern Sotho st s2c

Page 603: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Sundanese su s2cSwedish sv s2cSwahili (macrolanguage) sw s2cTamil ta s2cTelugu te s2cTajik tg s2cThai th s2cTigrinya ti s2cTurkmen tk s2cTagalog tl s2cTswana tn s2cTonga (Tonga Islands) to s2cTurkish tr s2cTsonga ts s2cTatar tt s2cTwi tw s2cTahitian ty s2cUighur ug s2cUkrainian uk s2cUrdu ur s2cUzbek uz s2cVenda ve s2cVietnamese vi s2cVolapük vo s2cWalloon wa s2cWolof wo s2cXhosa xh s2cYiddish yi s2cYoruba yo s2cZhuang za s2cStandard Moroccan Tamazight zg s2cChinese zh s2cZulu zu s2c

Page 604: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity datLast modifi Count Comment Hierarchy Name9/30/2015 1 1: Language of reporting9/30/2015 1 Total/NA x09/30/2015 1 Afar aa9/30/2015 1 Abkhazian ab9/30/2015 1 Avestan ae9/30/2015 1 Afrikaans af9/30/2015 1 Akan ak9/30/2015 1 Amharic am9/30/2015 1 Aragonese an9/30/2015 1 Arabic ar9/30/2015 1 Assamese as9/30/2015 1 Avaric av9/30/2015 1 Aymara ay9/30/2015 1 Azerbaijani az9/30/2015 1 Bashkir ba9/30/2015 1 Belarusian be9/30/2015 1 Bulgarian bg9/30/2015 1 Bihari languages bh9/30/2015 1 Bislama bi9/30/2015 1 Bambara bm9/30/2015 1 Bengali bn9/30/2015 1 Tibetan bo9/30/2015 1 Breton br9/30/2015 1 Bosnian bs9/30/2015 1 Catalan ca9/30/2015 1 Chechen ce9/30/2015 1 Chamorro ch9/30/2015 1 Corsican co9/30/2015 1 Cree cr9/30/2015 1 Czech cs9/30/2015 1 Church Slavic cu9/30/2015 1 Chuvash cv9/30/2015 1 Welsh cy9/30/2015 1 Danish da9/30/2015 1 German de9/30/2015 1 Dhivehi dv9/30/2015 1 Dzongkha dz9/30/2015 1 Ewe ee9/30/2015 1 Modern Greek (1453-) el9/30/2015 1 English en9/30/2015 1 Esperanto eo9/30/2015 1 Spanish es9/30/2015 1 Estonian et9/30/2015 1 Basque eu9/30/2015 1 Persian fa9/30/2015 1 Fulah ff9/30/2015 1 Finnish fi9/30/2015 1 Fijian fj9/30/2015 1 Faroese fo9/30/2015 1 French fr

Page 605: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015 1 Western Frisian fy9/30/2015 1 Irish ga9/30/2015 1 Scottish Gaelic gd9/30/2015 1 Galician gl9/30/2015 1 Guarani gn9/30/2015 1 Gujarati gu9/30/2015 1 Manx gv9/30/2015 1 Hausa ha9/30/2015 1 Hebrew he9/30/2015 1 Hindi hi9/30/2015 1 Hiri Motu ho9/30/2015 1 Croatian hr9/30/2015 1 Haitian ht9/30/2015 1 Hungarian hu9/30/2015 1 Armenian hy9/30/2015 1 Herero hz9/30/2015 1 Interlingua (International Aia9/30/2015 1 Indonesian id9/30/2015 1 Interlingue ie9/30/2015 1 Igbo ig9/30/2015 1 Sichuan Yi ii9/30/2015 1 Inupiaq ik9/30/2015 1 Ido io9/30/2015 1 Icelandic is9/30/2015 1 Italian it9/30/2015 1 Inuktitut iu9/30/2015 1 Japanese ja9/30/2015 1 Javanese jv9/30/2015 1 Georgian ka9/30/2015 1 Kongo kg9/30/2015 1 Kikuyu ki9/30/2015 1 Kuanyama kj9/30/2015 1 Kazakh kk9/30/2015 1 Kalaallisut kl9/30/2015 1 Central Khmer km9/30/2015 1 Kannada kn9/30/2015 1 Korean ko9/30/2015 1 Kanuri kr9/30/2015 1 Kashmiri ks9/30/2015 1 Kurdish ku9/30/2015 1 Komi kv9/30/2015 1 Cornish kw9/30/2015 1 Kirghiz ky9/30/2015 1 Luxembourgish lb9/30/2015 1 Ganda lg9/30/2015 1 Limburgan li9/30/2015 1 Lingala ln9/30/2015 1 Lao lo9/30/2015 1 Lithuanian lt9/30/2015 1 Luba-Katanga lu9/30/2015 1 Latvian lv

Page 606: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015 1 Malagasy mg9/30/2015 1 Marshallese mh9/30/2015 1 Maori mi9/30/2015 1 Macedonian mk9/30/2015 1 Malayalam ml9/30/2015 1 Mongolian mn9/30/2015 1 Marathi mr9/30/2015 1 Malay (macrolanguage) ms9/30/2015 1 Maltese mt9/30/2015 1 Burmese my9/30/2015 1 Nauru na9/30/2015 1 Norwegian Bokmål nb9/30/2015 1 North Ndebele nd9/30/2015 1 Nepali (macrolanguage) ne9/30/2015 1 Ndonga ng9/30/2015 1 Dutch nl9/30/2015 1 Norwegian Nynorsk nn9/30/2015 1 Norwegian no9/30/2015 1 South Ndebele nr9/30/2015 1 Navajo nv9/30/2015 1 Nyanja ny9/30/2015 1 Occitan (post 1500) oc9/30/2015 1 Ojibwa oj9/30/2015 1 Oromo om9/30/2015 1 Oriya (macrolanguage) or9/30/2015 1 Ossetian os9/30/2015 1 Panjabi pa9/30/2015 1 Pali pi9/30/2015 1 Polish pl9/30/2015 1 Pushto ps9/30/2015 1 Portuguese pt9/30/2015 1 Quechua qu9/30/2015 1 Romansh rm9/30/2015 1 Rundi rn9/30/2015 1 Romanian ro9/30/2015 1 Russian ru9/30/2015 1 Kinyarwanda rw9/30/2015 1 Sardinian sc9/30/2015 1 Sindhi sd9/30/2015 1 Northern Sami se9/30/2015 1 Sango sg9/30/2015 1 Serbo-Croatian sh9/30/2015 1 Sinhala si9/30/2015 1 Slovak sk9/30/2015 1 Slovenian sl9/30/2015 1 Samoan sm9/30/2015 1 Shona sn9/30/2015 1 Somali so9/30/2015 1 Albanian sq9/30/2015 1 Serbian sr9/30/2015 1 Swati ss

Page 607: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015 1 Southern Sotho st9/30/2015 1 Sundanese su9/30/2015 1 Swedish sv9/30/2015 1 Swahili (macrolanguage) sw9/30/2015 1 Tamil ta9/30/2015 1 Telugu te9/30/2015 1 Tajik tg9/30/2015 1 Thai th9/30/2015 1 Tigrinya ti9/30/2015 1 Turkmen tk9/30/2015 1 Tagalog tl9/30/2015 1 Tswana tn9/30/2015 1 Tonga (Tonga Islands) to9/30/2015 1 Turkish tr9/30/2015 1 Tsonga ts9/30/2015 1 Tatar tt9/30/2015 1 Twi tw9/30/2015 1 Tahitian ty9/30/2015 1 Uighur ug9/30/2015 1 Ukrainian uk9/30/2015 1 Urdu ur9/30/2015 1 Uzbek uz9/30/2015 1 Venda ve9/30/2015 1 Vietnamese vi9/30/2015 1 Volapük vo9/30/2015 1 Walloon wa9/30/2015 1 Wolof wo9/30/2015 1 Xhosa xh9/30/2015 1 Yiddish yi9/30/2015 1 Yoruba yo9/30/2015 1 Zhuang za9/30/2015 1 Standard Moroccan Tamazizg9/30/2015 1 Chinese zh

Zulu zu

Page 608: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy nSign Weight Owner Usable Applicable dim Applicable sheets for drops2c N/A S.01.02 (201)

Total/NA = noAfar +Abkhazian +Avestan +Afrikaans +Akan +Amharic +Aragonese +Arabic +Assamese +Avaric +Aymara +Azerbaijani +Bashkir +Belarusian +Bulgarian +Bihari languages +Bislama +Bambara +Bengali +Tibetan +Breton +Bosnian +Catalan +Chechen +Chamorro +Corsican +Cree +Czech +Church Slavic +Chuvash +Welsh +Danish +German +Dhivehi +Dzongkha +Ewe +Modern Greek (1453-)+English +Esperanto +Spanish +Estonian +Basque +Persian +Fulah +Finnish +Fijian +Faroese +French +

Page 609: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Western Frisian +Irish +Scottish Gaelic +Galician +Guarani +Gujarati +Manx +Hausa +Hebrew +Hindi +Hiri Motu +Croatian +Haitian +Hungarian +Armenian +Herero +Interlingua (Internati +Indonesian +Interlingue +Igbo +Sichuan Yi +Inupiaq +Ido +Icelandic +Italian +Inuktitut +Japanese +Javanese +Georgian +Kongo +Kikuyu +Kuanyama +Kazakh +Kalaallisut +Central Khmer +Kannada +Korean +Kanuri +Kashmiri +Kurdish +Komi +Cornish +Kirghiz +Luxembourgish +Ganda +Limburgan +Lingala +Lao +Lithuanian +Luba-Katanga +Latvian +

Page 610: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Malagasy +Marshallese +Maori +Macedonian +Malayalam +Mongolian +Marathi +Malay (macrolanguage+Maltese +Burmese +Nauru +Norwegian Bokmål +North Ndebele +Nepali (macrolanguag+Ndonga +Dutch +Norwegian Nynorsk +Norwegian +South Ndebele +Navajo +Nyanja +Occitan (post 1500) +Ojibwa +Oromo +Oriya (macrolanguage+Ossetian +Panjabi +Pali +Polish +Pushto +Portuguese +Quechua +Romansh +Rundi +Romanian +Russian +Kinyarwanda +Sardinian +Sindhi +Northern Sami +Sango +Serbo-Croatian +Sinhala +Slovak +Slovenian +Samoan +Shona +Somali +Albanian +Serbian +Swati +

Page 611: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Southern Sotho +Sundanese +Swedish +Swahili (macrolanguag+Tamil +Telugu +Tajik +Thai +Tigrinya +Turkmen +Tagalog +Tswana +Tonga (Tonga Islands) +Turkish +Tsonga +Tatar +Twi +Tahitian +Uighur +Ukrainian +Urdu +Uzbek +Venda +Vietnamese +Volapük +Walloon +Wolof +Xhosa +Yiddish +Yoruba +Zhuang +Standard Moroccan Ta+Chinese +Zulu +

Page 612: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modified date Comment9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 613: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 614: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 615: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 616: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name DefaultTotal/NA x0 yesAccident and sickness x1Motor x2Fire and other damage to property x3Aviation, marine and transport x4General liability x5Credit and suretyship x6Non-life other than accident and sickness, motor, fire and other damage to property, aviatx7ABS [asset backed securities] x8Annuities stemming from non-life insurance contracts x9Annuities stemming from non-life insurance contracts and relating to health insurance obx10Annuities stemming from non-life insurance contracts and relating to insurance obligatio x11Assistance [direct business and accepted proportional reinsurance] x12Branch x13Casualty [accepted non-proportional reinsurance] x14CDO [collateralised debt obligations] x15CDOp [credit default options] x16CDS [credit default swaps] x17CLN [credit linked notes and deposits] x18CLO [collateralised loan obligations] x19CMBS [commercial mortgage backed securities] x20CMO [collateralised mortgage obligations] x21CMS [constant maturity swaps] x22Still comercialised x23Common to other products x24Contracts with options and guarantees x25Contracts without options and guarantees x26Credit and suretyship insurance [direct business and accepted proportional reinsurance] x27Direct Business x28Direct Business and proportional reinsurance accepted x29ELN [Equity-linked and Equity Index Linked notes and deposits] x30Fire and other damage to property insurance [direct business and accepted proportional x31Freedom to provide services by undertaking x32FXCLN [FX and commodity-linked notes and deposits] x33General liability insurance [direct business and accepted proportional reinsurance] x34Health x35Health - collective [HC] x36Health - hybrid [HH] x37Health - join life [HJ] x38Health - other [HO] x39Health - pension funds [HP] x40Health - single life [HS] x41Health [accepted non-proportional reinsurance] x42Health non-SLT x43Health non-SLT [direct business and accepted proportional reinsurance] x44Health SLT x45Health SLT and annuities stemming from non-life insurance contracts and relating to healx46HLN [Hybrid linked notes and deposits - includes Real Estate and equity securities] x47The life insurance referred to in points [a][i], [ii] and [iii] of Article 2[3] excluding those refx48Marriage assurance, birth assurance x49

Page 617: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

The insurance referred to in points [a][i] and [ii] of Article 2[3], which are linked to inve x50ILN [Insurance-linked Notes and deposits, including Catastrophe and Weather Risk as wellx51Income protection insurance [direct business and accepted proportional reinsurance] x52Insurance with profit participation x53Insurance with profit participation [future discretionary benefits] x54Insurance with profit participation [guaranteed benefits] x55IRLN [Interest rate-linked notes and deposits] x56Permanent health insurance, referred to in point [a][iv] of Article 2[3] x57The operations referred to in Article 2[3][c] x58Legal expenses insurance [direct business and accepted proportional reinsurance] x59Life x60Life [other than annuities stemming from non-life insurance contracts and relating to heax61Life [other than health] x62Life [other than Index-linked and unit-linked insurance and Health SLT] x63Life [other than unit-linked or index-linked] x64Life and Health SLT x65Marine, aviation and transport insurance [direct business and accepted proportional rei x66Marine, aviation, transport [accepted non-proportional reinsurance] x67MBS [mortgage backed securities] x68Medical expense insurance [direct business and accepted proportional reinsurance] x69Miscellaneous financial loss [direct business and accepted proportional reinsurance] x70MLN [Market-linked notes and deposits] x71Motor other than motor vehicle liability insurance [except carrier's liability] x72Motor vehicle liability insurance [direct business and accepted proportional reinsurance] x73Motor vehicle liability insurance [except carrier's liability] x74Non-life x75Non-life [accepted non-proportional reinsurance] x76Non-life [direct business and accepted proportional reinsurance] x77Non-life [other than health non-SLT] x78Non-life and Health non-SLT x79Non-life and Health non-SLT [accepted non-proportional reinsurance] x80Non-life and Health non-SLT [direct business and accepted proportional reinsurance] x81Non-life annuities - collective [AC] x82Non-life annuities - hybrid [AH] x83Non-life annuities - join life [AJ] x84Non-life annuities - other [AO] x85Non-life annuities - pension funds [AP] x86Non-life annuities - single life [AS] x87Non-proportional reinsurance accepted x88In run-off x89Not common to other products x90Neither unit-linked nor index-linked x91Other [O] x92Other life x93Other life - collective [OC] x94Other life - hybrid [OH] x95Other life - join life [OJ] x96Other life - other [OO] x97Other life - pension funds [OP] x98Other life - single life [OS] x99Other life, annuities and Health SLT x100

Page 618: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other motor insurance [direct business and accepted proportional reinsurance] x101Product is considered replicable by a financial instrument x102Product is not considered replicable by a financial instrument x103Product with surrender option x104Product without surrender option x105Property [accepted non-proportional reinsurance] x106Proportional reinsurance accepted x107Regular premium [R] x108Reinsurance accepted x109Single premium paid under a pre-determined schedule without pre-determined amounts ax110Single premium without any pre-determined schedule with additional guarantee accordi x111Single premium without possibility to pay an additional premium in the future [NF] x112Unit-linked - collective [UC] x113Unit-linked - hybrid [UH] x114Unit-linked - join life [UJ] x115Unit-linked - other [UO] x116Unit-linked - pension funds [UP] x117Unit-linked - single life [US] x118Unit-linked or index-linked x119Unit-linked or index-linked other than variable annuities x120Tontines, referred to in point [b][i] of Article 2[3] x121Variable annuities x122Capital redemption operations, referred to in point [b][ii] of Article 2[3] x123Management of group pension funds, referred to in point [b][iii] and [iv] of Article 2[3] x124The operations referred to in point [b][v] of Article 2[3] x125With-profit - collective [PC] x126With-profit - hybrid [PH] x127With-profit - join life [PJ] x128With-profit - other [PO] x129With-profit - pension funds [PP] x130With-profit - single life [PS] x131Workers' compensation insurance [direct business and accepted proportional reinsurancx132Product is considered partially replicable by a financial instrument x133Non-life and Health non-SLT [direct business] x134Medical expense insurance [direct business] x135Income protection insurance [direct business] x136Workers' compensation insurance [direct business] x137Motor vehicle liability insurance [direct business] x138Other motor insurance [direct business] x139Marine, aviation and transport insurance [direct business] x140Fire and other damage to property insurance [direct business] x141General liability insurance [direct business] x142Credit and suretyship insurance [direct business] x143Legal expenses insurance [direct business] x144Assistance [direct business] x145Miscellaneous financial loss [direct business] x146Non-life and Health non-SLT [accepted proportional reinsurance] x147Medical expense insurance [accepted proportional reinsurance] x148Income protection insurance [accepted proportional reinsurance] x149Workers' compensation insurance [accepted proportional reinsurance] x150Motor vehicle liability insurance [accepted proportional reinsurance] x151

Page 619: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other motor insurance [accepted proportional reinsurance] x152Marine, aviation and transport insurance [accepted proportional reinsurance] x153Fire and other damage to property insurance [accepted proportional reinsurance] x154General liability insurance [accepted proportional reinsurance] x155Credit and suretyship insurance [accepted proportional reinsurance] x156Legal expenses insurance [accepted proportional reinsurance] x157Assistance [accepted proportional reinsurance] x158Miscellaneous financial loss [accepted proportional reinsurance] x159Health reinsurance x160Life reinsurance x161Freedom to provide services by the branch x162Freedom to provide services [FPS] and Freedom to provide services by the branches x163Health - pension entitlements [HE] x164Single premium with possibility of additional premiums with additional guarantee accor x165Contracts linked to inflation x166Health insurance x167Multiline x168Typical branch activity x169Total amount of LoB for all currencies x170By currency x171Life and annuities stemming from non-life insurance contracts and relating to insurance ox172Life and annuities stemming from non-life insurance contracts and relating to insurance ox173Undertaking x174Typical undertaking activity x175Life and Health SLT [other than unit-linked or index-linked] x176Pillar II pension entitlements x177Pillar II defined benefit pension entitlements x178Pillar II defined contribution pension entitlements x179Pillar II hybrid pension entitlements x180Non-life and Health non-SLT [accepted reinsurance] x181Pension entitlements x182Medical expense insurance x183Income protection insurance x184Workers' compensation insurance x185Motor vehicle liability insurance x186Other motor insurance x187Marine, aviation and transport insurance x188Fire and other damage to property insurance x189General liability insurance x190Credit and suretyship insurance x191Legal expenses insurance x192Assistance x193Miscellaneous financial loss x194Casualty x195Marine, aviation, transport x196Property x197Single life x198Joint life x199Collective x200Other x201Structured products other than CLN, CMS, ABS, MBS, CMBS, CDO, CLO, CMO, IRLN, ELN, x202

Page 620: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Life underwriting risk / revision risk x203Health SLT underwriting risk / revision risk x204Health NSLT premium and reserve risk x205Non Life premium and reserve risk x206Market risk / spread risk (bonds and loans) x207Market risk / interest rate risk (captives) x208Market risk / spread risk (bonds and loans) (captives) x209Market risk / market risk concentration (captives) x210Counterparty default risk x211Life underwriting risk / mortality risk x212Life underwriting risk / longevity risk x213Life underwriting risk / disability-morbidity risk x214Life underwriting risk / lapse risk x215Life underwriting risk / life expense risk x216Life underwriting risk / life catastrophe risk x217Health underwriting risk / mortality risk x218Health underwriting risk / longevity risk x219Health underwriting risk / disability-morbidity risk (medical expenses) x220Health underwriting risk / disability-morbidity risk (income protection) x221Health SLT underwriting risk / lapse risk x222Health underwriting risk / life expense risk x223Non-Life underwriting risk / premium and reserve risk (captives) x224

Page 621: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Owner Creation date Validity date Last modified date Count Comments2c 7/7/2014 42s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 3s2c 7/7/2014 3s2c 7/7/2014 20s2c 7/7/2014 20s2c 7/7/2014 13s2c 7/7/2014 2s2c 7/7/2014 20s2c 7/7/2014 3s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 0s2c 7/7/2014 3s2c 7/7/2014 3s2c 7/7/2014 3s2c 7/7/2014 3s2c 7/7/2014 3s2c 7/7/2014 9/30/2015 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 13s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 3s2c 7/7/2014 13s2c 7/7/2014 9/30/2015 3s2c 7/7/2014 3s2c 7/7/2014 13s2c 7/7/2014 12/31/2013 3s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 20s2c 7/7/2014 9s2c 7/7/2014 12/31/2013 9s2c 7/7/2014 21s2c 7/7/2014 4s2c 7/7/2014 9/30/2015 3s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 2

Page 622: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 3s2c 7/7/2014 13s2c 7/7/2014 21s2c 7/7/2014 7s2c 7/7/2014 7s2c 7/7/2014 3s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 13s2c 7/7/2014 5s2c 7/7/2014 9/30/2015 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 12s2c 7/7/2014 13s2c 7/7/2014 20s2c 7/7/2014 3s2c 7/7/2014 13s2c 7/7/2014 13s2c 7/7/2014 3s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 13s2c 7/7/2014 1s2c 7/7/2014 9s2c 7/7/2014 12/31/2013 7s2c 7/7/2014 12/31/2013 9s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 12s2c 7/7/2014 4s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 9/30/2015 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 4s2c 7/7/2014 21s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1

Page 623: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c 7/7/2014 13s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 20s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 22s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 13s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 8s2c 7/7/2014 8s2c 7/7/2014 8s2c 7/7/2014 8s2c 7/7/2014 8s2c 7/7/2014 8s2c 7/7/2014 8s2c 7/7/2014 8s2c 7/7/2014 8s2c 7/7/2014 8s2c 7/7/2014 8s2c 7/7/2014 8s2c 7/7/2014 2s2c 7/7/2014 7s2c 7/7/2014 7s2c 7/7/2014 7s2c 7/7/2014 7

Page 624: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c 7/7/2014 7s2c 7/7/2014 7s2c 7/7/2014 7s2c 7/7/2014 7s2c 7/7/2014 7s2c 7/7/2014 7s2c 7/7/2014 7s2c 7/7/2014 7s2c 7/7/2014 9s2c 7/7/2014 9s2c 9/30/2015 3s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 3s2c 9/30/2015 2s2c 9/30/2015 2s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 2s2c 9/30/2015 2s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 3s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1

Page 625: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1

Page 626: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy1: Insurance classes

Total/NANon-life

Accident and sicknessMotor

Motor vehicle liability insurance [except carrier's liability]Motor other than motor vehicle liability insurance [except carrier's liability]

Fire and other damage to propertyAviation, marine and transportGeneral liabilityCredit and suretyshipNon-life other than accident and sickness, motor, fire and other damage to property, aviation, marine an

LifeThe life insurance referred to in points [a][i], [ii] and [iii] of Article 2[3] excluding those referred to in II Marriage assurance, birth assuranceThe insurance referred to in points [a][i] and [ii] of Article 2[3], which are linked to investment fundsPermanent health insurance, referred to in point [a][iv] of Article 2[3]Tontines, referred to in point [b][i] of Article 2[3]Capital redemption operations, referred to in point [b][ii] of Article 2[3]Management of group pension funds, referred to in point [b][iii] and [iv] of Article 2[3]The operations referred to in point [b][v] of Article 2[3]The operations referred to in Article 2[3][c]

2: Insurance classesTotal/NA

Accident and sicknessMotorFire and other damage to propertyAviation, marine and transportGeneral liabilityCredit and suretyshipNon-life other than accident and sickness, motor, fire and other damage to property, aviation, marine and The life insurance referred to in points [a][i], [ii] and [iii] of Article 2[3] excluding those referred to in II anMarriage assurance, birth assuranceThe insurance referred to in points [a][i] and [ii] of Article 2[3], which are linked to investment fundsPermanent health insurance, referred to in point [a][iv] of Article 2[3]Tontines, referred to in point [b][i] of Article 2[3]Capital redemption operations, referred to in point [b][ii] of Article 2[3]Management of group pension funds, referred to in point [b][iii] and [iv] of Article 2[3]The operations referred to in point [b][v] of Article 2[3]The operations referred to in Article 2[3][c]

3: Line of business [general]Total/NA

Non-life and Health non-SLTNon-life and Health non-SLT [direct business and accepted proportional reinsurance]

Non-life [direct business and accepted proportional reinsurance]Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]Fire and other damage to property insurance [direct business and accepted proportional reinsurancGeneral liability insurance [direct business and accepted proportional reinsurance]

Page 627: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]

Health non-SLT [direct business and accepted proportional reinsurance]Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]

Non-life and Health non-SLT [accepted non-proportional reinsurance]Health [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]

Life and Health SLTLife

Life [other than Index-linked and unit-linked insurance and Health SLT]Insurance with profit participationOther lifeAnnuities stemming from non-life insurance contracts

Annuities stemming from non-life insurance contracts and relating to insurance obligations other Annuities stemming from non-life insurance contracts and relating to health insurance obligations

Unit-linked or index-linkedVariable annuitiesUnit-linked or index-linked other than variable annuities

Health SLT4: Line of business [general]

Total/NAUnit-linked or index-linkedNeither unit-linked nor index-linked

5: Line of business [general]Total/NA

Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]Fire and other damage to property insurance [direct business and accepted proportional reinsurance]General liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]Health [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]Insurance with profit participationOther lifeAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than hAnnuities stemming from non-life insurance contracts and relating to health insurance obligations

Page 628: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Unit-linked or index-linkedHealth SLT

6: Line of business [general]Total/NA

Non-life and Health non-SLTNon-life and Health non-SLT [direct business]

Medical expense insurance [direct business]Income protection insurance [direct business]Workers' compensation insurance [direct business]Motor vehicle liability insurance [direct business]Other motor insurance [direct business]Marine, aviation and transport insurance [direct business]Fire and other damage to property insurance [direct business]General liability insurance [direct business]Credit and suretyship insurance [direct business]Legal expenses insurance [direct business]Assistance [direct business]Miscellaneous financial loss [direct business]

Non-life and Health non-SLT [accepted proportional reinsurance]Medical expense insurance [accepted proportional reinsurance]Income protection insurance [accepted proportional reinsurance]Workers' compensation insurance [accepted proportional reinsurance]Motor vehicle liability insurance [accepted proportional reinsurance]Other motor insurance [accepted proportional reinsurance]Marine, aviation and transport insurance [accepted proportional reinsurance]Fire and other damage to property insurance [accepted proportional reinsurance]General liability insurance [accepted proportional reinsurance]Credit and suretyship insurance [accepted proportional reinsurance]Legal expenses insurance [accepted proportional reinsurance]Assistance [accepted proportional reinsurance]Miscellaneous financial loss [accepted proportional reinsurance]

Non-life and Health non-SLT [accepted non-proportional reinsurance]Health [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]

Life and Health SLTHealth SLTInsurance with profit participationUnit-linked or index-linkedOther lifeAnnuities stemming from non-life insurance contracts and relating to health insurance obligationsAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than Health reinsuranceLife reinsurance

7: Related line of businessTotal/NA

Non-life and Health non-SLTMotor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]

Page 629: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Fire and other damage to property insurance [direct business and accepted proportional reinsurance]General liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]Health [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]

Life and Health SLTInsurance with profit participationOther lifeAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than Annuities stemming from non-life insurance contracts and relating to health insurance obligationsUnit-linked or index-linkedHealth SLT

8: Line of business [general]Total/NA

Non-lifeHealth non-SLTLifeHealth SLT

9: Line of business [general]Total/NA

Non-life and Health non-SLTNon-life

Non-life [direct business and accepted proportional reinsurance]Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]Fire and other damage to property insurance [direct business and accepted proportional reinsurancGeneral liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]

Non-life [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]

Health non-SLTHealth non-SLT [direct business and accepted proportional reinsurance]

Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]

Health [accepted non-proportional reinsurance]Life and Health SLT

Page 630: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Life [other than unit-linked or index-linked]Life [other than Index-linked and unit-linked insurance and Health SLT]

Insurance with profit participationInsurance with profit participation [guaranteed benefits]Insurance with profit participation [future discretionary benefits]

Other lifeAnnuities stemming from non-life insurance contracts and relating to insurance obligations other tAnnuities stemming from non-life insurance contracts and relating to health insurance obligations

Health SLTUnit-linked or index-linked

10: Line of business [general]Total/NA

Non-life and Health non-SLTNon-life

Non-life [direct business and accepted proportional reinsurance]Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]Fire and other damage to property insurance [direct business and accepted proportional reinsurancGeneral liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]

Non-life [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]

Health non-SLTHealth non-SLT [direct business and accepted proportional reinsurance]

Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]

Health [accepted non-proportional reinsurance]Life and Health SLT

Insurance with profit participationInsurance with profit participation [guaranteed benefits]Insurance with profit participation [future discretionary benefits]

Unit-linked or index-linkedOther life, annuities and Health SLT

Other lifeAnnuities stemming from non-life insurance contracts and relating to insurance obligations other thaAnnuities stemming from non-life insurance contracts and relating to health insurance obligationsHealth SLT

11: Line of business [general]Total/NA

Non-lifeNon-life [direct business and accepted proportional reinsurance]

Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]

Page 631: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Fire and other damage to property insurance [direct business and accepted proportional reinsuranceGeneral liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]

Non-life [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]

LifeInsurance with profit participation

Insurance with profit participation [guaranteed benefits]Insurance with profit participation [future discretionary benefits]

Unit-linked or index-linkedOther lifeAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than Annuities stemming from non-life insurance contracts and relating to health insurance obligations

HealthHealth non-SLT

Health non-SLT [direct business and accepted proportional reinsurance]Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]

Health [accepted non-proportional reinsurance]Health SLT

12: Line of business [general]Total/NA

Non-life and Health non-SLTNon-life

Non-life [direct business and accepted proportional reinsurance]Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]Fire and other damage to property insurance [direct business and accepted proportional reinsurancGeneral liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]

Non-life [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]

Health non-SLTHealth non-SLT [direct business and accepted proportional reinsurance]

Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]

Health [accepted non-proportional reinsurance]Life and Health SLT

Page 632: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Life [other than annuities stemming from non-life insurance contracts and relating to health insurance Insurance with profit participation

Insurance with profit participation [guaranteed benefits]Insurance with profit participation [future discretionary benefits]

Unit-linked or index-linkedOther lifeAnnuities stemming from non-life insurance contracts and relating to insurance obligations other tha

Health SLT and annuities stemming from non-life insurance contracts and relating to health insurance oAnnuities stemming from non-life insurance contracts and relating to health insurance obligationsHealth SLT

13: Insurance/reinsurance businessTotal/NA

Direct BusinessReinsurance accepted

Proportional reinsurance acceptedNon-proportional reinsurance accepted

14: Insurance/reinsurance businessTotal/NA

Direct Business and proportional reinsurance acceptedNon-proportional reinsurance accepted

15: Homogenous risk groupsTotal/NA

Common to other productsNot common to other products

16: Type of activityTotal/NA

BranchTypical branch activityFreedom to provide services by the branch

Freedom to provide services by undertaking17: Product with surrender option or not

Total/NAProduct with surrender optionProduct without surrender option

18: Types of contractsTotal/NA

Contracts without options and guaranteesContracts with options and guarantees

19: Products commercialized or notTotal/NA

Still comercialisedIn run-off

20: Line of business [general]Total/NA

Non-life and Health non-SLTLife and Health SLT

Insurance with profit participationWith-profit - single life [PS]With-profit - join life [PJ]With-profit - collective [PC]With-profit - pension funds [PP]

Page 633: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

With-profit - hybrid [PH]With-profit - other [PO]

Unit-linked or index-linkedUnit-linked - single life [US]Unit-linked - join life [UJ]Unit-linked - collective [UC]Unit-linked - pension funds [UP]Unit-linked - hybrid [UH]Unit-linked - other [UO]

Other lifeOther life - single life [OS]Other life - join life [OJ]Other life - collective [OC]Other life - pension funds [OP]Other life - hybrid [OH]Other life - other [OO]

Annuities stemming from non-life insurance contractsNon-life annuities - single life [AS]Non-life annuities - join life [AJ]Non-life annuities - collective [AC]Non-life annuities - pension funds [AP]Non-life annuities - hybrid [AH]Non-life annuities - other [AO]

Health SLTHealth - single life [HS]Health - join life [HJ]Health - collective [HC]Health - pension funds [HP]Health - hybrid [HH]Health - other [HO]

21: Type of premium (Preparatory scope)Total/NA

Regular premium [R]Single premium paid under a pre-determined schedule without pre-determined amounts and with additiSingle premium without any pre-determined schedule with additional guarantee according to amount paSingle premium without possibility to pay an additional premium in the future [NF]Other [O]

22: Replication of product by a financial instrumentTotal/NA

Product is considered replicable by a financial instrumentProduct is not considered replicable by a financial instrumentProduct is considered partially replicable by a financial instrument

23: Line of business [general]Total/NA

Non-life [other than health non-SLT]Health non-SLTLife [other than health]Health SLT

24: Type of structured productsTotal/NA

CLN [credit linked notes and deposits]

Page 634: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

CMS [constant maturity swaps]CDOp [credit default options]ABS [asset backed securities]MBS [mortgage backed securities]CMBS [commercial mortgage backed securities]CDO [collateralised debt obligations]CLO [collateralised loan obligations]CMO [collateralised mortgage obligations]IRLN [Interest rate-linked notes and deposits]ELN [Equity-linked and Equity Index Linked notes and deposits]FXCLN [FX and commodity-linked notes and deposits]HLN [Hybrid linked notes and deposits - includes Real Estate and equity securities]MLN [Market-linked notes and deposits]ILN [Insurance-linked Notes and deposits, including Catastrophe and Weather Risk as well as Mortality RiOther [O]

25: Freedom to provide servicesFreedom to provide services [FPS] and Freedom to provide services by the branches

Freedom to provide services by undertakingFreedom to provide services by the branch

26: Type of structured productsCLN [credit linked notes and deposits]CMS [constant maturity swaps]ABS [asset backed securities]MBS [mortgage backed securities]CMBS [commercial mortgage backed securities]CDO [collateralised debt obligations]CLO [collateralised loan obligations]CMO [collateralised mortgage obligations]IRLN [Interest rate-linked notes and deposits]ELN [Equity-linked and Equity Index Linked notes and deposits]FXCLN [FX and commodity-linked notes and deposits]HLN [Hybrid linked notes and deposits - includes Real Estate and equity securities]MLN [Market-linked notes and deposits]ILN [Insurance-linked Notes and deposits, including Catastrophe and Weather Risk as well as Mortality RisOther [O]

27: Product classificationHealth - single life [HS]Health - join life [HJ]Health - collective [HC]Health - pension entitlements [HE]Health - other [HO]

28: Type of premium (Full scope)Regular premium [R]Single premium with possibility of additional premiums with additional guarantee according to amount paSingle premium without possibility to pay an additional premium in the future [NF]Other [O]

29: Life and Health SLTTotal/NA

Health insuranceInsurance with profit participationUnit-linked or index-linked

Page 635: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other lifeAnnuities stemming from non-life insurance contracts and relating to health insurance obligationsAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than hHealth reinsuranceLife reinsurance

30: Identification of the line of businessTotal/NA

Medical expense insurance [direct business]Income protection insurance [direct business]Workers' compensation insurance [direct business]Motor vehicle liability insurance [direct business]Other motor insurance [direct business]Marine, aviation and transport insurance [direct business]Fire and other damage to property insurance [direct business]General liability insurance [direct business]Credit and suretyship insurance [direct business]Legal expenses insurance [direct business]Assistance [direct business]Miscellaneous financial loss [direct business]

31: Line of businessTotal/NA

Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]Fire and other damage to property insurance [direct business and accepted proportional reinsurance]General liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]Health [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]

32: Line of business [general]Total/NA

Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]Fire and other damage to property insurance [direct business and accepted proportional reinsurance]General liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]

Page 636: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Health [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]LifeHealth SLT

33: Line of business [general]Total/NA

Medical expense insurance [direct business]Income protection insurance [direct business]Workers' compensation insurance [direct business]Motor vehicle liability insurance [direct business]Other motor insurance [direct business]Marine, aviation and transport insurance [direct business]Fire and other damage to property insurance [direct business]General liability insurance [direct business]Credit and suretyship insurance [direct business]Legal expenses insurance [direct business]Assistance [direct business]Miscellaneous financial loss [direct business]Medical expense insurance [accepted proportional reinsurance]Income protection insurance [accepted proportional reinsurance]Workers' compensation insurance [accepted proportional reinsurance]Motor vehicle liability insurance [accepted proportional reinsurance]Other motor insurance [accepted proportional reinsurance]Marine, aviation and transport insurance [accepted proportional reinsurance]Fire and other damage to property insurance [accepted proportional reinsurance]General liability insurance [accepted proportional reinsurance]Credit and suretyship insurance [accepted proportional reinsurance]Legal expenses insurance [accepted proportional reinsurance]Assistance [accepted proportional reinsurance]Miscellaneous financial loss [accepted proportional reinsurance]Health [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]

34: Types of contractsTotal/NA

Contracts with options and guaranteesContracts linked to inflation

35: Line of business [general]Total/NA

Medical expense insurance [direct business]Income protection insurance [direct business]Workers' compensation insurance [direct business]Motor vehicle liability insurance [direct business]Other motor insurance [direct business]Marine, aviation and transport insurance [direct business]Fire and other damage to property insurance [direct business]General liability insurance [direct business]Credit and suretyship insurance [direct business]

Page 637: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Legal expenses insurance [direct business]Assistance [direct business]Miscellaneous financial loss [direct business]Medical expense insurance [accepted proportional reinsurance]Income protection insurance [accepted proportional reinsurance]Workers' compensation insurance [accepted proportional reinsurance]Motor vehicle liability insurance [accepted proportional reinsurance]Other motor insurance [accepted proportional reinsurance]Marine, aviation and transport insurance [accepted proportional reinsurance]Fire and other damage to property insurance [accepted proportional reinsurance]General liability insurance [accepted proportional reinsurance]Credit and suretyship insurance [accepted proportional reinsurance]Legal expenses insurance [accepted proportional reinsurance]Assistance [accepted proportional reinsurance]Miscellaneous financial loss [accepted proportional reinsurance]Health [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Health insuranceInsurance with profit participationUnit-linked or index-linkedOther lifeAnnuities stemming from non-life insurance contracts and relating to health insurance obligationsAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than hHealth reinsuranceLife reinsuranceMultiline

36: Line of business [general]Medical expense insuranceIncome protection insuranceWorkers' compensation insuranceMotor vehicle liability insuranceOther motor insuranceMarine, aviation and transport insuranceFire and other damage to property insuranceGeneral liability insuranceCredit and suretyship insuranceLegal expenses insuranceAssistanceMiscellaneous financial lossHealthCasualtyMarine, aviation, transportPropertyInsurance with profit participationUnit-linked or index-linkedOther lifeAnnuities stemming from non-life insurance contracts and relating to health insurance obligationsAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than heaHealth insurance

Page 638: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Health reinsuranceLife reinsurance

37: Total line of business or by currencyTotal amount of LoB for all currenciesBy currency

38: Line of business [general]Total/NA

Non-life and Health non-SLTNon-life and Health non-SLT [direct business and accepted proportional reinsurance]

Non-life [direct business and accepted proportional reinsurance]Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]Fire and other damage to property insurance [direct business and accepted proportional reinsurancGeneral liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]

Health non-SLT [direct business and accepted proportional reinsurance]Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]

Non-life and Health non-SLT [accepted non-proportional reinsurance]Health [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]

Life and Health SLTLife and annuities stemming from non-life insurance contracts and relating to insurance obligations ot

Life and annuities stemming from non-life insurance contracts and relating to insurance obligations otInsurance with profit participationOther lifeAnnuities stemming from non-life insurance contracts and relating to insurance obligations other t

Unit-linked or index-linkedVariable annuitiesUnit-linked or index-linked other than variable annuities

Health SLT and annuities stemming from non-life insurance contracts and relating to health insurance oHealth SLTAnnuities stemming from non-life insurance contracts and relating to health insurance obligations

39: Line of business [general]Total/NA

Non-life and Health non-SLTNon-life

Non-life [direct business and accepted proportional reinsurance]Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]Fire and other damage to property insurance [direct business and accepted proportional reinsurancGeneral liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]

Page 639: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]

Non-life [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]

Health non-SLTHealth non-SLT [direct business and accepted proportional reinsurance]

Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]

Health [accepted non-proportional reinsurance]Life and Health SLT

Life and annuities stemming from non-life insurance contracts and relating to insurance obligations othInsurance with profit participation

Insurance with profit participation [guaranteed benefits]Insurance with profit participation [future discretionary benefits]

Other lifeAnnuities stemming from non-life insurance contracts and relating to insurance obligations other tha

Health SLT and annuities stemming from non-life insurance contracts and relating to health insurance oHealth SLTAnnuities stemming from non-life insurance contracts and relating to health insurance obligations

Unit-linked or index-linked40: Line of business [general]

Total/NANon-life

Non-life [direct business and accepted proportional reinsurance]Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]Fire and other damage to property insurance [direct business and accepted proportional reinsuranceGeneral liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]

Non-life [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]

Life and annuities stemming from non-life insurance contracts and relating to insurance obligations otheInsurance with profit participation

Insurance with profit participation [guaranteed benefits]Insurance with profit participation [future discretionary benefits]

Unit-linked or index-linkedOther lifeAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than

HealthHealth non-SLT

Health non-SLT [direct business and accepted proportional reinsurance]

Page 640: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]

Health [accepted non-proportional reinsurance]Health SLT and annuities stemming from non-life insurance contracts and relating to health insurance o

Health SLTAnnuities stemming from non-life insurance contracts and relating to health insurance obligations

41: Line of business [general]Total/NA

Non-life and Health non-SLTNon-life

Non-life [direct business and accepted proportional reinsurance]Motor vehicle liability insurance [direct business and accepted proportional reinsurance]Other motor insurance [direct business and accepted proportional reinsurance]Marine, aviation and transport insurance [direct business and accepted proportional reinsurance]Fire and other damage to property insurance [direct business and accepted proportional reinsurancGeneral liability insurance [direct business and accepted proportional reinsurance]Credit and suretyship insurance [direct business and accepted proportional reinsurance]Legal expenses insurance [direct business and accepted proportional reinsurance]Assistance [direct business and accepted proportional reinsurance]Miscellaneous financial loss [direct business and accepted proportional reinsurance]

Non-life [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]

Health non-SLTHealth non-SLT [direct business and accepted proportional reinsurance]

Medical expense insurance [direct business and accepted proportional reinsurance]Income protection insurance [direct business and accepted proportional reinsurance]Workers' compensation insurance [direct business and accepted proportional reinsurance]

Health [accepted non-proportional reinsurance]Life and Health SLT

Unit-linked or index-linkedLife and Health SLT [other than unit-linked or index-linked]

Insurance with profit participationInsurance with profit participation [guaranteed benefits]Insurance with profit participation [future discretionary benefits]

Other lifeAnnuities stemming from non-life insurance contracts

Annuities stemming from non-life insurance contracts and relating to insurance obligations other tAnnuities stemming from non-life insurance contracts and relating to health insurance obligations

Health SLT42: Type of activity

Total/NABranch

Typical branch activityFreedom to provide services by the branch

UndertakingTypical undertaking activityFreedom to provide services by undertaking

43: Line of business [general]

Page 641: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Total/NAMedical expense insurance [direct business]Income protection insurance [direct business]Workers' compensation insurance [direct business]Motor vehicle liability insurance [direct business]Other motor insurance [direct business]Marine, aviation and transport insurance [direct business]Fire and other damage to property insurance [direct business]General liability insurance [direct business]Credit and suretyship insurance [direct business]Legal expenses insurance [direct business]Assistance [direct business]Miscellaneous financial loss [direct business]Medical expense insurance [accepted proportional reinsurance]Income protection insurance [accepted proportional reinsurance]Workers' compensation insurance [accepted proportional reinsurance]Motor vehicle liability insurance [accepted proportional reinsurance]Other motor insurance [accepted proportional reinsurance]Marine, aviation and transport insurance [accepted proportional reinsurance]Fire and other damage to property insurance [accepted proportional reinsurance]General liability insurance [accepted proportional reinsurance]Credit and suretyship insurance [accepted proportional reinsurance]Legal expenses insurance [accepted proportional reinsurance]Assistance [accepted proportional reinsurance]Miscellaneous financial loss [accepted proportional reinsurance]Health [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Insurance with profit participationUnit-linked or index-linkedOther lifeAnnuities stemming from non-life insurance contracts and relating to health insurance obligationsAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than hLife reinsuranceHealth reinsuranceHealth SLT

44: Product classificationPension entitlements

Pillar II pension entitlements45: Product classification

Pension entitlementsPillar II defined benefit pension entitlementsPillar II defined contribution pension entitlementsPillar II hybrid pension entitlements

46: Line of business [general]Total/NA

Non-life and Health non-SLTNon-life and Health non-SLT [direct business]

Medical expense insurance [direct business]Income protection insurance [direct business]

Page 642: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Workers' compensation insurance [direct business]Motor vehicle liability insurance [direct business]Other motor insurance [direct business]Marine, aviation and transport insurance [direct business]Fire and other damage to property insurance [direct business]General liability insurance [direct business]Credit and suretyship insurance [direct business]Legal expenses insurance [direct business]Assistance [direct business]Miscellaneous financial loss [direct business]

Non-life and Health non-SLT [accepted reinsurance]Non-life and Health non-SLT [accepted proportional reinsurance]

Medical expense insurance [accepted proportional reinsurance]Income protection insurance [accepted proportional reinsurance]Workers' compensation insurance [accepted proportional reinsurance]Motor vehicle liability insurance [accepted proportional reinsurance]Other motor insurance [accepted proportional reinsurance]Marine, aviation and transport insurance [accepted proportional reinsurance]Fire and other damage to property insurance [accepted proportional reinsurance]General liability insurance [accepted proportional reinsurance]Credit and suretyship insurance [accepted proportional reinsurance]Legal expenses insurance [accepted proportional reinsurance]Assistance [accepted proportional reinsurance]Miscellaneous financial loss [accepted proportional reinsurance]

Non-life and Health non-SLT [accepted non-proportional reinsurance]Health [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]

Life and Health SLTHealth SLTInsurance with profit participationUnit-linked or index-linkedOther lifeAnnuities stemming from non-life insurance contracts and relating to health insurance obligationsAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than Health reinsuranceLife reinsurance

47: Line of business [general]Total/NA

Life and Health SLTNon-life and Health non-SLT

48: Product classification [210]Single lifeJoint lifeCollectivePension entitlementsOther

49: Line of business (general)[210]Total/NA

Medical expense insurance [direct business]

Page 643: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Income protection insurance [direct business]Workers' compensation insurance [direct business]Motor vehicle liability insurance [direct business]Other motor insurance [direct business]Marine, aviation and transport insurance [direct business]Fire and other damage to property insurance [direct business]General liability insurance [direct business]Credit and suretyship insurance [direct business]Legal expenses insurance [direct business]Assistance [direct business]Miscellaneous financial loss [direct business]Medical expense insurance [accepted proportional reinsurance]Income protection insurance [accepted proportional reinsurance]Workers' compensation insurance [accepted proportional reinsurance]Motor vehicle liability insurance [accepted proportional reinsurance]Other motor insurance [accepted proportional reinsurance]Marine, aviation and transport insurance [accepted proportional reinsurance]Fire and other damage to property insurance [accepted proportional reinsurance]General liability insurance [accepted proportional reinsurance]Credit and suretyship insurance [accepted proportional reinsurance]Legal expenses insurance [accepted proportional reinsurance]Assistance [accepted proportional reinsurance]Miscellaneous financial loss [accepted proportional reinsurance]Health [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Health SLTInsurance with profit participationUnit-linked or index-linkedOther lifeAnnuities stemming from non-life insurance contracts and relating to health insurance obligationsAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than hHealth reinsuranceLife reinsuranceMultiline

50: Life and Health SLT [210]Total/NA

Health SLTInsurance with profit participationUnit-linked or index-linkedOther lifeAnnuities stemming from non-life insurance contracts and relating to health insurance obligationsAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than hHealth reinsuranceLife reinsurance

51: Type of structured products [210]CLN [credit linked notes and deposits]CMS [constant maturity swaps]ABS [asset backed securities]MBS [mortgage backed securities]

Page 644: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

CMBS [commercial mortgage backed securities]CDO [collateralised debt obligations]CLO [collateralised loan obligations]CMO [collateralised mortgage obligations]IRLN [Interest rate-linked notes and deposits]ELN [Equity-linked and Equity Index Linked notes and deposits]FXCLN [FX and commodity-linked notes and deposits]HLN [Hybrid linked notes and deposits - includes Real Estate and equity securities]MLN [Market-linked notes and deposits]ILN [Insurance-linked Notes and deposits, including Catastrophe and Weather Risk as well as Mortality RisStructured products other than CLN, CMS, ABS, MBS, CMBS, CDO, CLO, CMO, IRLN, ELN, FXCLN, HLN, MLN

52: Line of business (general)[210]Total/NA

Medical expense insurance [direct business]Income protection insurance [direct business]Workers' compensation insurance [direct business]Motor vehicle liability insurance [direct business]Other motor insurance [direct business]Marine, aviation and transport insurance [direct business]Fire and other damage to property insurance [direct business]General liability insurance [direct business]Credit and suretyship insurance [direct business]Legal expenses insurance [direct business]Assistance [direct business]Miscellaneous financial loss [direct business]Medical expense insurance [accepted proportional reinsurance]Income protection insurance [accepted proportional reinsurance]Workers' compensation insurance [accepted proportional reinsurance]Motor vehicle liability insurance [accepted proportional reinsurance]Other motor insurance [accepted proportional reinsurance]Marine, aviation and transport insurance [accepted proportional reinsurance]Fire and other damage to property insurance [accepted proportional reinsurance]General liability insurance [accepted proportional reinsurance]Credit and suretyship insurance [accepted proportional reinsurance]Legal expenses insurance [accepted proportional reinsurance]Assistance [accepted proportional reinsurance]Miscellaneous financial loss [accepted proportional reinsurance]Health [accepted non-proportional reinsurance]Casualty [accepted non-proportional reinsurance]Marine, aviation, transport [accepted non-proportional reinsurance]Property [accepted non-proportional reinsurance]Health SLTInsurance with profit participationUnit-linked or index-linkedOther lifeAnnuities stemming from non-life insurance contracts and relating to health insurance obligationsAnnuities stemming from non-life insurance contracts and relating to insurance obligations other than hHealth reinsuranceLife reinsurance

53: Use of undertaking specific parametersLife underwriting risk / revision risk

Page 645: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Health SLT underwriting risk / revision riskHealth NSLT premium and reserve riskNon Life premium and reserve risk

54: Use of simplificationsMarket risk / spread risk (bonds and loans)Market risk / interest rate risk (captives)Market risk / spread risk (bonds and loans) (captives)Market risk / market risk concentration (captives)Counterparty default riskLife underwriting risk / mortality riskLife underwriting risk / longevity riskLife underwriting risk / disability-morbidity riskLife underwriting risk / lapse riskLife underwriting risk / life expense riskLife underwriting risk / life catastrophe riskHealth underwriting risk / mortality riskHealth underwriting risk / longevity riskHealth underwriting risk / disability-morbidity risk (medical expenses)Health underwriting risk / disability-morbidity risk (income protection)Health SLT underwriting risk / lapse riskHealth underwriting risk / life expense riskNon-Life underwriting risk / premium and reserve risk (captives)

Page 646: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Hierarchy node label Sign Weight Owners2c

x0 Total/NA =x75 Non-life = +x1 Accident and sickness +x2 Motor = +x74 Motor vehicle liability insurance [except carrier's liability] +x72 Motor other than motor vehicle liability insurance [except carrier's liabil+x3 Fire and other damage to property +x4 Aviation, marine and transport +x5 General liability +x6 Credit and suretyship +x7 Non-life other than accident and sickness, motor, fire and other damage +x60 Life = +x48 The life insurance referred to in points [a][i], [ii] and [iii] of Article 2[3] +x49 Marriage assurance, birth assurance +x50 The insurance referred to in points [a][i] and [ii] of Article 2[3], which +x57 Permanent health insurance, referred to in point [a][iv] of Article 2[3] +x121 Tontines, referred to in point [b][i] of Article 2[3] +x123 Capital redemption operations, referred to in point [b][ii] of Article 2[3]+x124 Management of group pension funds, referred to in point [b][iii] and [iv]+x125 The operations referred to in point [b][v] of Article 2[3] +x58 The operations referred to in Article 2[3][c] +

s2cx0 Total/NA =x1 Accident and sickness +x2 Motor +x3 Fire and other damage to property +x4 Aviation, marine and transport +x5 General liability +x6 Credit and suretyship +x7 Non-life other than accident and sickness, motor, fire and other damage +x48 The life insurance referred to in points [a][i], [ii] and [iii] of Article 2[3] +x49 Marriage assurance, birth assurance +x50 The insurance referred to in points [a][i] and [ii] of Article 2[3], which +x57 Permanent health insurance, referred to in point [a][iv] of Article 2[3] +x121 Tontines, referred to in point [b][i] of Article 2[3] +x123 Capital redemption operations, referred to in point [b][ii] of Article 2[3]+x124 Management of group pension funds, referred to in point [b][iii] and [iv]+x125 The operations referred to in point [b][v] of Article 2[3] +x58 The operations referred to in Article 2[3][c] +

s2cx0 Total/NA =x79 Non-life and Health non-SLT = +x81 Non-life and Health non-SLT [direct business and accepted p= +x77 Non-life [direct business and accepted proportional reinsur = +x73 Motor vehicle liability insurance [direct business and accepted proporti+x101 Other motor insurance [direct business and accepted proportional rein +x66 Marine, aviation and transport insurance [direct business and accepted+x31 Fire and other damage to property insurance [direct business and acce +x34 General liability insurance [direct business and accepted proportional r +

Page 647: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x27 Credit and suretyship insurance [direct business and accepted proporti +x59 Legal expenses insurance [direct business and accepted proportional re+x12 Assistance [direct business and accepted proportional reinsurance] +x70 Miscellaneous financial loss [direct business and accepted proportional +x44 Health non-SLT [direct business and accepted proportional r= +x69 Medical expense insurance [direct business and accepted proportional +x52 Income protection insurance [direct business and accepted proportiona+x132 Workers' compensation insurance [direct business and accepted propor+x80 Non-life and Health non-SLT [accepted non-proportional rei = +x42 Health [accepted non-proportional reinsurance] +x106 Property [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x65 Life and Health SLT = +x60 Life = +x63 Life [other than Index-linked and unit-linked insurance and = +x53 Insurance with profit participation +x93 Other life +x9 Annuities stemming from non-life insurance contracts = +x11 Annuities stemming from non-life insurance contracts and relating to in+x10 Annuities stemming from non-life insurance contracts and relating to he+x119 Unit-linked or index-linked = +x122 Variable annuities +x120 Unit-linked or index-linked other than variable annuities +x45 Health SLT +

s2cx0 Total/NA =x119 1 - Unit-linked or index-linked +x91 2 - Neither unit-linked nor index-linked +

s2cx0 Total/NA =x73 Motor vehicle liability insurance [direct business and accepted proporti+x101 Other motor insurance [direct business and accepted proportional rein +x66 Marine, aviation and transport insurance [direct business and accepted+x31 Fire and other damage to property insurance [direct business and acce +x34 General liability insurance [direct business and accepted proportional r +x27 Credit and suretyship insurance [direct business and accepted proporti +x59 Legal expenses insurance [direct business and accepted proportional re+x12 Assistance [direct business and accepted proportional reinsurance] +x70 Miscellaneous financial loss [direct business and accepted proportional +x69 Medical expense insurance [direct business and accepted proportional +x52 Income protection insurance [direct business and accepted proportiona+x132 Workers' compensation insurance [direct business and accepted propor+x42 Health [accepted non-proportional reinsurance] +x106 Property [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x53 Insurance with profit participation +x93 Other life +x11 Annuities stemming from non-life insurance contracts and relating to in+x10 Annuities stemming from non-life insurance contracts and relating to he+

Page 648: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x119 Unit-linked or index-linked +x45 Health SLT +

s2cx0 Total/NA =x79 Non-life and Health non-SLT = +x134 Non-life and Health non-SLT [direct business] = +x135 Medical expense insurance [direct business] +x136 Income protection insurance [direct business] +x137 Workers' compensation insurance [direct business] +x138 Motor vehicle liability insurance [direct business] +x139 Other motor insurance [direct business] +x140 Marine, aviation and transport insurance [direct business] +x141 Fire and other damage to property insurance [direct business] +x142 General liability insurance [direct business] +x143 Credit and suretyship insurance [direct business] +x144 Legal expenses insurance [direct business] +x145 Assistance [direct business] +x146 Miscellaneous financial loss [direct business] +x147 Non-life and Health non-SLT [accepted proportional reinsur = +x148 Medical expense insurance [accepted proportional reinsurance] +x149 Income protection insurance [accepted proportional reinsurance] +x150 Workers' compensation insurance [accepted proportional reinsurance] +x151 Motor vehicle liability insurance [accepted proportional reinsurance] +x152 Other motor insurance [accepted proportional reinsurance] +x153 Marine, aviation and transport insurance [accepted proportional reinsu+x154 Fire and other damage to property insurance [accepted proportional re+x155 General liability insurance [accepted proportional reinsurance] +x156 Credit and suretyship insurance [accepted proportional reinsurance] +x157 Legal expenses insurance [accepted proportional reinsurance] +x158 Assistance [accepted proportional reinsurance] +x159 Miscellaneous financial loss [accepted proportional reinsurance] +x80 Non-life and Health non-SLT [accepted non-proportional rei = +x42 Health [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x106 Property [accepted non-proportional reinsurance] +x65 Life and Health SLT = +x45 Health SLT +x53 Insurance with profit participation +x119 Unit-linked or index-linked +x93 Other life +x10 Annuities stemming from non-life insurance contracts and relating to he+x11 Annuities stemming from non-life insurance contracts and relating to in+x160 Health reinsurance +x161 Life reinsurance +

s2cx0 Total/NA =x79 Non-life and Health non-SLT = +x73 Motor vehicle liability insurance [direct business and accepted proporti+x101 Other motor insurance [direct business and accepted proportional rein +x66 Marine, aviation and transport insurance [direct business and accepted+

Page 649: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x31 Fire and other damage to property insurance [direct business and acce +x34 General liability insurance [direct business and accepted proportional r +x27 Credit and suretyship insurance [direct business and accepted proporti +x59 Legal expenses insurance [direct business and accepted proportional re+x12 Assistance [direct business and accepted proportional reinsurance] +x70 Miscellaneous financial loss [direct business and accepted proportional +x69 Medical expense insurance [direct business and accepted proportional +x52 Income protection insurance [direct business and accepted proportiona+x132 Workers' compensation insurance [direct business and accepted propor+x42 Health [accepted non-proportional reinsurance] +x106 Property [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x65 Life and Health SLT = +x53 Insurance with profit participation +x93 Other life +x11 Annuities stemming from non-life insurance contracts and relating to in+x10 Annuities stemming from non-life insurance contracts and relating to he+x119 Unit-linked or index-linked +x45 Health SLT +

s2cx0 Total/NA =x75 Non-life +x43 Health non-SLT +x60 Life +x45 Health SLT +

s2cx0 Total/NA =x79 Non-life and Health non-SLT = +x75 Non-life = +x77 Non-life [direct business and accepted proportional reinsur = +x73 Motor vehicle liability insurance [direct business and accepted proporti+x101 Other motor insurance [direct business and accepted proportional rein +x66 Marine, aviation and transport insurance [direct business and accepted+x31 Fire and other damage to property insurance [direct business and acce +x34 General liability insurance [direct business and accepted proportional r +x27 Credit and suretyship insurance [direct business and accepted proporti +x59 Legal expenses insurance [direct business and accepted proportional re+x12 Assistance [direct business and accepted proportional reinsurance] +x70 Miscellaneous financial loss [direct business and accepted proportional +x76 Non-life [accepted non-proportional reinsurance] = +x106 Property [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x43 Health non-SLT = +x44 Health non-SLT [direct business and accepted proportional r= +x69 Medical expense insurance [direct business and accepted proportional +x52 Income protection insurance [direct business and accepted proportiona+x132 Workers' compensation insurance [direct business and accepted propor+x42 Health [accepted non-proportional reinsurance] +x65 Life and Health SLT = +

Page 650: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x64 Life [other than unit-linked or index-linked] = +x63 Life [other than Index-linked and unit-linked insurance and = +x53 Insurance with profit participation = +x55 Insurance with profit participation [guaranteed benefits] +x54 Insurance with profit participation [future discretionary benefits] +x93 Other life +x11 Annuities stemming from non-life insurance contracts and relating to in+x10 Annuities stemming from non-life insurance contracts and relating to he+x45 Health SLT +x119 Unit-linked or index-linked +

s2cx0 Total/NA =x79 Non-life and Health non-SLT = +x75 Non-life = +x77 Non-life [direct business and accepted proportional reinsur = +x73 Motor vehicle liability insurance [direct business and accepted proporti+x101 Other motor insurance [direct business and accepted proportional rein +x66 Marine, aviation and transport insurance [direct business and accepted+x31 Fire and other damage to property insurance [direct business and acce +x34 General liability insurance [direct business and accepted proportional r +x27 Credit and suretyship insurance [direct business and accepted proporti +x59 Legal expenses insurance [direct business and accepted proportional re+x12 Assistance [direct business and accepted proportional reinsurance] +x70 Miscellaneous financial loss [direct business and accepted proportional +x76 Non-life [accepted non-proportional reinsurance] = +x106 Property [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x43 Health non-SLT = +x44 Health non-SLT [direct business and accepted proportional r= +x69 Medical expense insurance [direct business and accepted proportional +x52 Income protection insurance [direct business and accepted proportiona+x132 Workers' compensation insurance [direct business and accepted propor+x42 Health [accepted non-proportional reinsurance] +x65 Life and Health SLT = +x53 Insurance with profit participation = +x55 Insurance with profit participation [guaranteed benefits] +x54 Insurance with profit participation [future discretionary benefits] +x119 Unit-linked or index-linked +x100 Other life, annuities and Health SLT = +x93 Other life +x11 Annuities stemming from non-life insurance contracts and relating to in+x10 Annuities stemming from non-life insurance contracts and relating to he+x45 Health SLT +

s2cx0 Total/NA =x75 Non-life = +x77 Non-life [direct business and accepted proportional reinsur = +x73 Motor vehicle liability insurance [direct business and accepted proporti+x101 Other motor insurance [direct business and accepted proportional rein +x66 Marine, aviation and transport insurance [direct business and accepted+

Page 651: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x31 Fire and other damage to property insurance [direct business and acce +x34 General liability insurance [direct business and accepted proportional r +x27 Credit and suretyship insurance [direct business and accepted proporti +x59 Legal expenses insurance [direct business and accepted proportional re+x12 Assistance [direct business and accepted proportional reinsurance] +x70 Miscellaneous financial loss [direct business and accepted proportional +x76 Non-life [accepted non-proportional reinsurance] = +x106 Property [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x60 Life = +x53 Insurance with profit participation = +x55 Insurance with profit participation [guaranteed benefits] +x54 Insurance with profit participation [future discretionary benefits] +x119 Unit-linked or index-linked +x93 Other life +x11 Annuities stemming from non-life insurance contracts and relating to in+x10 Annuities stemming from non-life insurance contracts and relating to he+x35 Health = +x43 Health non-SLT = +x44 Health non-SLT [direct business and accepted proportional r= +x69 Medical expense insurance [direct business and accepted proportional +x52 Income protection insurance [direct business and accepted proportiona+x132 Workers' compensation insurance [direct business and accepted propor+x42 Health [accepted non-proportional reinsurance] +x45 Health SLT +

s2cx0 Total/NA =x79 Non-life and Health non-SLT = +x75 Non-life = +x77 Non-life [direct business and accepted proportional reinsur = +x73 Motor vehicle liability insurance [direct business and accepted proporti+x101 Other motor insurance [direct business and accepted proportional rein +x66 Marine, aviation and transport insurance [direct business and accepted+x31 Fire and other damage to property insurance [direct business and acce +x34 General liability insurance [direct business and accepted proportional r +x27 Credit and suretyship insurance [direct business and accepted proporti +x59 Legal expenses insurance [direct business and accepted proportional re+x12 Assistance [direct business and accepted proportional reinsurance] +x70 Miscellaneous financial loss [direct business and accepted proportional +x76 Non-life [accepted non-proportional reinsurance] = +x106 Property [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x43 Health non-SLT = +x44 Health non-SLT [direct business and accepted proportional r= +x69 Medical expense insurance [direct business and accepted proportional +x52 Income protection insurance [direct business and accepted proportiona+x132 Workers' compensation insurance [direct business and accepted propor+x42 Health [accepted non-proportional reinsurance] +x65 Life and Health SLT = +

Page 652: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x61 Life [other than annuities stemming from non-life insurance = +x53 Insurance with profit participation = +x55 Insurance with profit participation [guaranteed benefits] +x54 Insurance with profit participation [future discretionary benefits] +x119 Unit-linked or index-linked +x93 Other life +x11 Annuities stemming from non-life insurance contracts and relating to in+x46 Health SLT and annuities stemming from non-life insurance c= +x10 Annuities stemming from non-life insurance contracts and relating to he+x45 Health SLT +

s2cx0 Total/NA =x28 Direct Business +x109 Reinsurance accepted = +x107 Proportional reinsurance accepted +x88 Non-proportional reinsurance accepted +

s2cx0 Total/NA =x29 Direct Business and proportional reinsurance accepted +x88 Non-proportional reinsurance accepted +

s2cx0 Total/NA =x24 Common to other products +x90 Not common to other products +

s2cx0 Total/NA =x13 Branch = +x169 Typical branch activity +x162 Freedom to provide services by the branch +x32 Freedom to provide services by undertaking +

s2cx0 Total/NA =x104 Product with surrender option +x105 Product without surrender option +

s2cx0 Total/NA =x26 Contracts without options and guarantees +x25 Contracts with options and guarantees +

s2cx0 Total/NA =x23 1 – Still comercialised +x89 2 – In run-off +

s2cx0 Total/NA =x79 Non-life and Health non-SLT +x65 Life and Health SLT = +x53 Insurance with profit participation = +x131 With-profit - single life [PS] +x128 With-profit - join life [PJ] +x126 With-profit - collective [PC] +x130 With-profit - pension funds [PP] +

Page 653: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x127 With-profit - hybrid [PH] +x129 With-profit - other [PO] +x119 Unit-linked or index-linked = +x118 Unit-linked - single life [US] +x115 Unit-linked - join life [UJ] +x113 Unit-linked - collective [UC] +x117 Unit-linked - pension funds [UP] +x114 Unit-linked - hybrid [UH] +x116 Unit-linked - other [UO] +x93 Other life = +x99 Other life - single life [OS] +x96 Other life - join life [OJ] +x94 Other life - collective [OC] +x98 Other life - pension funds [OP] +x95 Other life - hybrid [OH] +x97 Other life - other [OO] +x9 Annuities stemming from non-life insurance contracts = +x87 Non-life annuities - single life [AS] +x84 Non-life annuities - join life [AJ] +x82 Non-life annuities - collective [AC] +x86 Non-life annuities - pension funds [AP] +x83 Non-life annuities - hybrid [AH] +x85 Non-life annuities - other [AO] +x45 Health SLT = +x41 Health - single life [HS] +x38 Health - join life [HJ] +x36 Health - collective [HC] +x40 Health - pension funds [HP] +x37 Health - hybrid [HH] +x39 Health - other [HO] +

s2cx0 Total/NA =x108 Regular premium [R] +x110 Single premium paid under a pre-determined schedule without pre-det+x111 Single premium without any pre-determined schedule with additional g+x112 Single premium without possibility to pay an additional premium in the +x92 Other [O] +

s2cx0 Total/NA =x102 1 - Replicable by financial instrument +x103 2 – Not replicable by financial instrument +x133 3 - Partially replicable by financial instrument +

s2cx0 Total/NA =x78 Non-life [other than health non-SLT] +x43 Health non-SLT +x62 Life [other than health] +x45 Health SLT +

s2cx0 Total/NAx18 CLN [credit linked notes and deposits]

Page 654: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x22 CMS [constant maturity swaps]x16 CDOp [credit default options]x8 ABS [asset backed securities]x68 MBS [mortgage backed securities]x20 CMBS [commercial mortgage backed securities]x15 CDO [collateralised debt obligations]x19 CLO [collateralised loan obligations]x21 CMO [collateralised mortgage obligations]x56 IRLN [Interest rate-linked notes and deposits]x30 ELN [Equity-linked and Equity Index Linked notes and deposits]x33 FXCLN [FX and commodity-linked notes and deposits]x47 HLN [Hybrid linked notes and deposits - includes Real Estate and equity securities]x71 MLN [Market-linked notes and deposits]x51 ILN [Insurance-linked Notes and deposits, including Catastrophe and Weather Risk as well as Mortality Risk]x92 Other [O]

s2cx163 Freedom to provide services [FPS] and Freedom to provide services by the branchesx32 Freedom to provide services by undertakingx162 Freedom to provide services by the branch

s2cx18 1 – Credit linked notesx22 2 - Constant maturity swapsx8 3 - Asset backed securitiesx68 4 - Mortgage backed securitiesx20 5 - Commercial mortgage backed securitiesx15 6 - Collateralised debt obligationsx19 7 - Collateralised loan obligationsx21 8 - Collateralised mortgage obligationsx56 9 - Interest rate-linked notes and depositsx30 10 - Equity-linked and Equity Index Linked notes and depositsx33 11 - FX and commodity-linked notes and depositsx47 12 - Hybrid linked notes and depositsx71 13 - Market-linked notes and depositsx51 14 - Insurance-linked notes and deposits, including notes covering Catastrophe and Weather Risk as well as Mortality Riskx92 99 - Others not covered by the previous options

s2cx41 1 - single lifex38 2 - joint lifex36 3 - collectivex164 4 - pension entitlementsx39 5 - other

s2cx108 1 - Regular premiumx165 2 - Single premium with possibility of additional premiums with additional guarantee according to amount paidx112 3 - Single premium without possibility to pay an additional premium in the futurex92 4 - Other

s2cx0 Total/NAx167 29 - Health insurancex53 30 - Insurance with profit participationx119 31 - Index-linked and unit-linked insurance

Page 655: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x93 32 - Other life insurancex10 33 - Annuities stemming from non-life insurance contracts and relating to health insurance obligationsx11 34 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligationsx160 35 - Health reinsurancex161 36 - Life reinsurance

s2cx0 Total/NAx135 1 - Medical expense insurancex136 2 - Income protection insurancex137 3 - Workers' compensation insurancex138 4 - Motor vehicle liability insurancex139 5 - Other motor insurancex140 6 - Marine, aviation and transport insurancex141 7 - Fire and other damage to property insurancex142 8 - General liability insurancex143 9 - Credit and suretyship insurancex144 10 - Legal expenses insurancex145 11 - Assistancex146 12 - Miscellaneous financial loss

s2cx0 Total/NAx69 1 – 1 and 13 Medical expense insurancex52 2 – 2 and 14 Income protection insurancex132 3 – 3 and 15 Workers' compensation insurancex73 4 – 4 and 16 Motor vehicle liability insurancex101 5 – 5 and 17 Other motor insurancex66 6 – 6 and 18 Marine, aviation and transport insurancex31 7 – 7 and 19 Fire and other damage to property insurancex34 8 – 8 and 20 General liability insurancex27 9 – 9 and 21 Credit and suretyship insurancex59 10 – 10 and 22 Legal expenses insurancex12 11 – 11 and 23 Assistancex70 12 – 12 and 24 Miscellaneous financial lossx42 25 – Non-proportional health reinsurancex14 26 – Non-proportional casualty reinsurancex106 28 – Non-proportional property reinsurancex67 27 – Non-proportional marine, aviation and transport reinsurance

s2cx0 Total/NAx69 1 – 1 and 13 Medical expense insurancex52 2 – 2 and 14 Income protection insurancex132 3 – 3 and 15 Workers' compensation insurancex73 4 – 4 and 16 Motor vehicle liability insurancex101 5 – 5 and 17 Other motor insurancex66 6 – 6 and 18 Marine, aviation and transport insurancex31 7 – 7 and 19 Fire and other damage to property insurancex34 8 – 8 and 20 General liability insurancex27 9 – 9 and 21 Credit and suretyship insurancex59 10 – 10 and 22 Legal expenses insurancex12 11 – 11 and 23 Assistancex70 12 – 12 and 24 Miscellaneous financial loss

Page 656: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x42 25 - Non-proportional health reinsurancex106 28 - Non-proportional property reinsurancex67 27 - Non-proportional marine, aviation and transport reinsurancex14 26 - Non-proportional casualty reinsurancex60 37 – Lifex45 38 - Health SLT

s2cx0 Total/NAx135 1 - Medical expense insurancex136 2 - Income protection insurancex137 3 - Workers' compensation insurancex138 4 - Motor vehicle liability insurancex139 5 - Other motor insurancex140 6 - Marine, aviation and transport insurancex141 7 - Fire and other damage to property insurancex142 8 - General liability insurancex143 9 - Credit and suretyship insurancex144 10 - Legal expenses insurancex145 11 - Assistancex146 12 - Miscellaneous financial lossx148 13 - Proportional medical expense reinsurancex149 14 - Proportional income protection reinsurancex150 15 - Proportional workers' compensation reinsurancex151 16 - Proportional motor vehicle liability reinsurancex152 17 - Proportional other motor reinsurancex153 18 - Proportional marine, aviation and transport reinsurancex154 19 - Proportional fire and other damage to property reinsurancex155 20 - Proportional general liability reinsurancex156 21 - Proportional credit and suretyship reinsurancex157 22 - Proportional legal expenses reinsurancex158 23 - Proportional assistance reinsurancex159 24 - Proportional miscellaneous financial loss reinsurancex42 25 - Non-proportional health reinsurancex14 26 - Non-proportional casualty reinsurancex67 27 - Non-proportional marine, aviation and transport reinsurancex106 28 - Non-proportional property reinsurance

s2cx0 Total/NAx25 Contracts with options and guaranteesx166 Contracts linked to inflation

s2cx0 Total/NAx135 1 - Medical expense insurancex136 2 - Income protection insurancex137 3 - Workers' compensation insurancex138 4 - Motor vehicle liability insurancex139 5 - Other motor insurancex140 6 - Marine, aviation and transport insurancex141 7 - Fire and other damage to property insurancex142 8 - General liability insurancex143 9 - Credit and suretyship insurance

Page 657: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x144 10 - Legal expenses insurancex145 11 - Assistancex146 12 - Miscellaneous financial lossx148 13 - Proportional medical expense reinsurancex149 14 - Proportional income protection reinsurancex150 15 - Proportional workers' compensation reinsurancex151 16 - Proportional motor vehicle liability reinsurancex152 17 - Proportional other motor reinsurancex153 18 - Proportional marine, aviation and transport reinsurancex154 19 - Proportional fire and other damage to property reinsurancex155 20 - Proportional general liability reinsurancex156 21 - Proportional credit and suretyship reinsurancex157 22 - Proportional legal expenses reinsurancex158 23 - Proportional assistance reinsurancex159 24 - Proportional miscellaneous financial loss reinsurancex42 25 - Non-proportional health reinsurancex14 26 - Non-proportional casualty reinsurancex67 27 - Non-proportional marine, aviation and transport reinsurancex106 28 - Non-proportional property reinsurancex167 29 - Health insurancex53 30 - Insurance with profit participationx119 31 - Index-linked and unit-linked insurancex93 32 - Other life insurancex10 33 - Annuities stemming from non-life insurance contracts and relating to health insurance obligationsx11 34 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligationsx160 35 - Health reinsurancex161 36 - Life reinsurancex168 37 - Multiline

s2cx183 Medical expense insurancex184 Income protection insurancex185 Workers' compensation insurancex186 Motor vehicle liability insurancex187 Other motor insurancex188 Marine, aviation and transport insurancex189 Fire and other damage to property insurancex190 General liability insurancex191 Credit and suretyship insurancex192 Legal expenses insurancex193 Assistancex194 Miscellaneous financial lossx35 Healthx195 Casualtyx196 Marine, aviation, transportx197 Propertyx53 Insurance with profit participationx119 Unit-linked or index-linkedx93 Other lifex10 Annuities stemming from non-life insurance contracts and relating to health insurance obligationsx11 Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligationsx167 Health insurance

Page 658: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x160 Health reinsurancex161 Life reinsurance

s2cx170 Total amount of LoB for all currenciesx171 By currency

s2cx0 Total/NA =x79 Non-life and Health non-SLT = +x81 Non-life and Health non-SLT [direct business and accepted p= +x77 Non-life [direct business and accepted proportional reinsur = +x73 Motor vehicle liability insurance [direct business and accepted proporti+x101 Other motor insurance [direct business and accepted proportional rein +x66 Marine, aviation and transport insurance [direct business and accepted+x31 Fire and other damage to property insurance [direct business and acce +x34 General liability insurance [direct business and accepted proportional r +x27 Credit and suretyship insurance [direct business and accepted proporti +x59 Legal expenses insurance [direct business and accepted proportional re+x12 Assistance [direct business and accepted proportional reinsurance] +x70 Miscellaneous financial loss [direct business and accepted proportional +x44 Health non-SLT [direct business and accepted proportional r= +x69 Medical expense insurance [direct business and accepted proportional +x52 Income protection insurance [direct business and accepted proportiona+x132 Workers' compensation insurance [direct business and accepted propor+x80 Non-life and Health non-SLT [accepted non-proportional rei = +x42 Health [accepted non-proportional reinsurance] +x106 Property [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x65 Life and Health SLT = +x172 Life and annuities stemming from non-life insurance contract= +x173 Life and annuities stemming from non-life insurance contract= +x53 Insurance with profit participation +x93 Other life +x11 Annuities stemming from non-life insurance contracts and relating to in+x119 Unit-linked or index-linked = +x122 Variable annuities +x120 Unit-linked or index-linked other than variable annuities +x46 Health SLT and annuities stemming from non-life insurance c= +x45 Health SLT +x10 Annuities stemming from non-life insurance contracts and relating to he+

s2cx0 Total/NA =x79 Non-life and Health non-SLT = +x75 Non-life = +x77 Non-life [direct business and accepted proportional reinsur = +x73 Motor vehicle liability insurance [direct business and accepted proporti+x101 Other motor insurance [direct business and accepted proportional rein +x66 Marine, aviation and transport insurance [direct business and accepted+x31 Fire and other damage to property insurance [direct business and acce +x34 General liability insurance [direct business and accepted proportional r +x27 Credit and suretyship insurance [direct business and accepted proporti +

Page 659: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x59 Legal expenses insurance [direct business and accepted proportional re+x12 Assistance [direct business and accepted proportional reinsurance] +x70 Miscellaneous financial loss [direct business and accepted proportional +x76 Non-life [accepted non-proportional reinsurance] = +x106 Property [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x43 Health non-SLT = +x44 Health non-SLT [direct business and accepted proportional r= +x69 Medical expense insurance [direct business and accepted proportional +x52 Income protection insurance [direct business and accepted proportiona+x132 Workers' compensation insurance [direct business and accepted propor+x42 Health [accepted non-proportional reinsurance] +x65 Life and Health SLT = +x173 Life and annuities stemming from non-life insurance contract= +x53 Insurance with profit participation = +x55 Insurance with profit participation [guaranteed benefits] +x54 Insurance with profit participation [future discretionary benefits] +x93 Other life +x11 Annuities stemming from non-life insurance contracts and relating to in+x46 Health SLT and annuities stemming from non-life insurance c= +x45 Health SLT +x10 Annuities stemming from non-life insurance contracts and relating to he+x119 Unit-linked or index-linked +

s2cx0 Total/NA =x75 Non-life = +x77 Non-life [direct business and accepted proportional reinsur = +x73 Motor vehicle liability insurance [direct business and accepted proporti+x101 Other motor insurance [direct business and accepted proportional rein +x66 Marine, aviation and transport insurance [direct business and accepted+x31 Fire and other damage to property insurance [direct business and acce +x34 General liability insurance [direct business and accepted proportional r +x27 Credit and suretyship insurance [direct business and accepted proporti +x59 Legal expenses insurance [direct business and accepted proportional re+x12 Assistance [direct business and accepted proportional reinsurance] +x70 Miscellaneous financial loss [direct business and accepted proportional +x76 Non-life [accepted non-proportional reinsurance] = +x106 Property [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x172 Life and annuities stemming from non-life insurance contract= +x53 Insurance with profit participation = +x55 Insurance with profit participation [guaranteed benefits] +x54 Insurance with profit participation [future discretionary benefits] +x119 Unit-linked or index-linked +x93 Other life +x11 Annuities stemming from non-life insurance contracts and relating to in+x35 Health = +x43 Health non-SLT = +x44 Health non-SLT [direct business and accepted proportional r= +

Page 660: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x69 Medical expense insurance [direct business and accepted proportional +x52 Income protection insurance [direct business and accepted proportiona+x132 Workers' compensation insurance [direct business and accepted propor+x42 Health [accepted non-proportional reinsurance] +x46 Health SLT and annuities stemming from non-life insurance c= +x45 Health SLT +x10 Annuities stemming from non-life insurance contracts and relating to he+

s2cx0 Total/NA =x79 Non-life and Health non-SLT = +x75 Non-life = +x77 Non-life [direct business and accepted proportional reinsur = +x73 Motor vehicle liability insurance [direct business and accepted proporti+x101 Other motor insurance [direct business and accepted proportional rein +x66 Marine, aviation and transport insurance [direct business and accepted+x31 Fire and other damage to property insurance [direct business and acce +x34 General liability insurance [direct business and accepted proportional r +x27 Credit and suretyship insurance [direct business and accepted proporti +x59 Legal expenses insurance [direct business and accepted proportional re+x12 Assistance [direct business and accepted proportional reinsurance] +x70 Miscellaneous financial loss [direct business and accepted proportional +x76 Non-life [accepted non-proportional reinsurance] = +x106 Property [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x43 Health non-SLT = +x44 Health non-SLT [direct business and accepted proportional r= +x69 Medical expense insurance [direct business and accepted proportional +x52 Income protection insurance [direct business and accepted proportiona+x132 Workers' compensation insurance [direct business and accepted propor+x42 Health [accepted non-proportional reinsurance] +x65 Life and Health SLT = +x119 Unit-linked or index-linked +x176 Life and Health SLT [other than unit-linked or index-linked] = +x53 Insurance with profit participation = +x55 Insurance with profit participation [guaranteed benefits] +x54 Insurance with profit participation [future discretionary benefits] +x93 Other life +x9 Annuities stemming from non-life insurance contracts = +x11 Annuities stemming from non-life insurance contracts and relating to in+x10 Annuities stemming from non-life insurance contracts and relating to he+x45 Health SLT +

s2cx0 Total/NA =x13 Branch = +x169 Typical branch activity +x162 Freedom to provide services by the branch +x174 Undertaking = +x175 Typical undertaking activity +x32 Freedom to provide services by undertaking +

s2c

Page 661: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x0 Total/NAx135 1 - Medical expense insurancex136 2 - Income protection insurancex137 3 - Workers' compensation insurancex138 4 - Motor vehicle liability insurancex139 5 - Other motor insurancex140 6 - Marine, aviation and transport insurancex141 7 - Fire and other damage to property insurancex142 8 - General liability insurancex143 9 - Credit and suretyship insurancex144 10 - Legal expenses insurancex145 11 - Assistancex146 12 - Miscellaneous financial lossx148 13 - Proportional medical expense reinsurancex149 14 - Proportional income protection reinsurancex150 15 - Proportional workers' compensation reinsurancex151 16 - Proportional motor vehicle liability reinsurancex152 17 - Proportional other motor reinsurancex153 18 - Proportional marine, aviation and transport reinsurancex154 19 - Proportional fire and other damage to property reinsurancex155 20 - Proportional general liability reinsurancex156 21 - Proportional credit and suretyship reinsurancex157 22 - Proportional legal expenses reinsurancex158 23 - Proportional assistance reinsurancex159 24 - Proportional miscellaneous financial loss reinsurancex42 25 - Non-proportional health reinsurancex14 26 - Non-proportional casualty reinsurancex67 27 - Non-proportional marine, aviation and transport reinsurancex106 28 - Non-proportional property reinsurancex53 30 - Insurance with profit participationx119 31 - Index-linked and unit-linked insurancex93 32 - Other life insurancex10 33 - Annuities stemming from non-life insurance contracts and relating to health insurance obligationsx11 34 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligationsx161 36 - Life reinsurancex160 35 - Health reinsurancex45 29 - Health insurance

s2cx182 Pension entitlements >=x177 Pillar II pension entitlements +

s2cx182 Pension entitlements =x178 Pillar II defined benefit pension entitlements +x179 Pillar II defined contribution pension entitlements +x180 Pillar II hybrid pension entitlements +

s2cx0 Total/NA =x79 Non-life and Health non-SLT = +x134 Non-life and Health non-SLT [direct business] = +x135 Medical expense insurance [direct business] +x136 Income protection insurance [direct business] +

Page 662: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x137 Workers' compensation insurance [direct business] +x138 Motor vehicle liability insurance [direct business] +x139 Other motor insurance [direct business] +x140 Marine, aviation and transport insurance [direct business] +x141 Fire and other damage to property insurance [direct business] +x142 General liability insurance [direct business] +x143 Credit and suretyship insurance [direct business] +x144 Legal expenses insurance [direct business] +x145 Assistance [direct business] +x146 Miscellaneous financial loss [direct business] +x181 Non-life and Health non-SLT [accepted reinsurance] = +x147 Non-life and Health non-SLT [accepted proportional reinsur = +x148 Medical expense insurance [accepted proportional reinsurance] +x149 Income protection insurance [accepted proportional reinsurance] +x150 Workers' compensation insurance [accepted proportional reinsurance] +x151 Motor vehicle liability insurance [accepted proportional reinsurance] +x152 Other motor insurance [accepted proportional reinsurance] +x153 Marine, aviation and transport insurance [accepted proportional reinsu+x154 Fire and other damage to property insurance [accepted proportional re+x155 General liability insurance [accepted proportional reinsurance] +x156 Credit and suretyship insurance [accepted proportional reinsurance] +x157 Legal expenses insurance [accepted proportional reinsurance] +x158 Assistance [accepted proportional reinsurance] +x159 Miscellaneous financial loss [accepted proportional reinsurance] +x80 Non-life and Health non-SLT [accepted non-proportional rei = +x42 Health [accepted non-proportional reinsurance] +x14 Casualty [accepted non-proportional reinsurance] +x67 Marine, aviation, transport [accepted non-proportional reinsurance] +x106 Property [accepted non-proportional reinsurance] +x65 Life and Health SLT = +x45 Health SLT +x53 Insurance with profit participation +x119 Unit-linked or index-linked +x93 Other life +x10 Annuities stemming from non-life insurance contracts and relating to he+x11 Annuities stemming from non-life insurance contracts and relating to in+x160 Health reinsurance +x161 Life reinsurance +

s2cx0 Total/NAx65 1 - Life and health SLTx79 2 - Non-life and health NSLT

s2cx198 1 - single lifex199 2 - joint lifex200 3 - collectivex182 4 - pension entitlementsx201 5 - other

s2cx0 Total/NAx135 1 - Medical expense insurance

Page 663: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x136 2 - Income protection insurancex137 3 - Workers' compensation insurancex138 4 - Motor vehicle liability insurancex139 5 - Other motor insurancex140 6 - Marine, aviation and transport insurancex141 7 - Fire and other damage to property insurancex142 8 - General liability insurancex143 9 - Credit and suretyship insurancex144 10 - Legal expenses insurancex145 11 - Assistancex146 12 - Miscellaneous financial lossx148 13 - Proportional medical expense reinsurancex149 14 - Proportional income protection reinsurancex150 15 - Proportional workers' compensation reinsurancex151 16 - Proportional motor vehicle liability reinsurancex152 17 - Proportional other motor reinsurancex153 18 - Proportional marine, aviation and transport reinsurancex154 19 - Proportional fire and other damage to property reinsurancex155 20 - Proportional general liability reinsurancex156 21 - Proportional credit and suretyship reinsurancex157 22 - Proportional legal expenses reinsurancex158 23 - Proportional assistance reinsurancex159 24 - Proportional miscellaneous financial loss reinsurancex42 25 - Non-proportional health reinsurancex14 26 - Non-proportional casualty reinsurancex67 27 - Non-proportional marine, aviation and transport reinsurancex106 28 - Non-proportional property reinsurancex45 29 - Health insurancex53 30 - Insurance with profit participationx119 31 - Index-linked and unit-linked insurancex93 32 - Other life insurancex10 33 - Annuities stemming from non-life insurance contracts and relating to health insurance obligationsx11 34 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligationsx160 35 - Health reinsurancex161 36 - Life reinsurancex168 37 - Multiline

s2cx0 Total/NAx45 29 - Health insurancex53 30 - Insurance with profit participationx119 31 - Index-linked and unit-linked insurancex93 32 - Other life insurancex10 33 - Annuities stemming from non-life insurance contracts and relating to health insurance obligationsx11 34 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligationsx160 35 - Health reinsurancex161 36 - Life reinsurance

s2cx18 1 – Credit linked notesx22 2 - Constant maturity swapsx8 3 - Asset backed securitiesx68 4 - Mortgage backed securities

Page 664: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x20 5 - Commercial mortgage backed securitiesx15 6 - Collateralised debt obligationsx19 7 - Collateralised loan obligationsx21 8 - Collateralised mortgage obligationsx56 9 - Interest rate-linked notes and depositsx30 10 - Equity-linked and Equity Index Linked notes and depositsx33 11 - FX and commodity-linked notes and depositsx47 12 - Hybrid linked notes and depositsx71 13 - Market-linked notes and depositsx51 14 - Insurance-linked notes and deposits, including notes covering Catastrophe and Weather Risk as well as Mortality Riskx202 99 - Others not covered by the previous options

s2cx0 Total/NAx135 1 - Medical expense insurancex136 2 - Income protection insurancex137 3 - Workers' compensation insurancex138 4 - Motor vehicle liability insurancex139 5 - Other motor insurancex140 6 - Marine, aviation and transport insurancex141 7 - Fire and other damage to property insurancex142 8 - General liability insurancex143 9 - Credit and suretyship insurancex144 10 - Legal expenses insurancex145 11 - Assistancex146 12 - Miscellaneous financial lossx148 13 - Proportional medical expense reinsurancex149 14 - Proportional income protection reinsurancex150 15 - Proportional workers' compensation reinsurancex151 16 - Proportional motor vehicle liability reinsurancex152 17 - Proportional other motor reinsurancex153 18 - Proportional marine, aviation and transport reinsurancex154 19 - Proportional fire and other damage to property reinsurancex155 20 - Proportional general liability reinsurancex156 21 - Proportional credit and suretyship reinsurancex157 22 - Proportional legal expenses reinsurancex158 23 - Proportional assistance reinsurancex159 24 - Proportional miscellaneous financial loss reinsurancex42 25 - Non-proportional health reinsurancex14 26 - Non-proportional casualty reinsurancex67 27 - Non-proportional marine, aviation and transport reinsurancex106 28 - Non-proportional property reinsurancex45 29 - Health insurancex53 30 - Insurance with profit participationx119 31 - Index-linked and unit-linked insurancex93 32 - Other life insurancex10 33 - Annuities stemming from non-life insurance contracts and relating to health insurance obligationsx11 34 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligationsx160 35 - Health reinsurancex161 36 - Life reinsurance

s2cx203 1 - Life underwriting risk / revision risk

Page 665: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x204 2 - Health SLT underwriting risk / revision riskx205 3 - Health NSLT premium and reserve riskx206 4 - Non Life premium and reserve risk

s2cx207 1 - Market risk / spread risk (bonds and loans)x208 2 - Market risk / interest rate risk (captives)x209 3 - Market risk / spread risk (bonds and loans) (captives)x210 4 - Market risk / market risk concentration (captives)x211 5 - Counterparty default riskx212 6 - Life underwriting risk / mortality riskx213 7 - Life underwriting risk / longevity riskx214 8 - Life underwriting risk / disability-morbidity riskx215 9 - Life underwriting risk / lapse riskx216 10 - Life underwriting risk / life expense riskx217 11 - Life underwriting risk / life catastrophe riskx218 12 - Health underwriting risk / mortality riskx219 13 - Health underwriting risk / longevity riskx220 14 - Health underwriting risk / disability-morbidity risk (medical expenses)x221 15 - Health underwriting risk / disability-morbidity risk (income protection)x222 16 - Health SLT underwriting risk / lapse riskx223 17 - Health underwriting risk / life expense riskx224 18 - Non-Life underwriting risk / premium and reserve risk (captives)

Page 666: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Usable Applicable Applicable sheets for dropdowns Creation date Validity dateCB 7/7/2014 7/15/2016

7/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

CB 7/7/2014 7/15/20167/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

BL 7/7/2014 7/15/20167/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014

Page 667: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014

BL S.06.02 (201), S.08.01 (201), S.08.02 7/7/20147/7/20147/7/20147/7/2014

BL 7/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

T81
Michal Skopowski: Correct but not necessary as we have LB_41
Page 668: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/2014

BL 7/7/2014 9/30/20157/7/2014

no 7/7/2014no 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

no 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

no 7/7/20147/7/20147/7/20147/7/20147/7/2014

no 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

RB 7/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/2014

T148
Michal Skopowski: Replaced with LB_30
Page 669: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

BL 7/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014

BL 7/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014

T180
Michal Skopowski: MUST STAY (due to Life [other than Index-linked and unit-linked insurance and Health SLT])
Page 670: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

BL 7/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

BL 7/7/2014 7/15/20167/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014

Page 671: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014

BL 7/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014

Page 672: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

TB 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

TB 7/7/20147/7/20147/7/2014 12/31/20137/7/2014

N/A 7/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/2013

TZ 7/7/2014 7/15/20167/7/20147/7/2014

9/30/20159/30/2015

7/7/2014SX 7/7/2014

7/7/20147/7/20147/7/2014 12/31/2013

RZ 7/7/20147/7/20147/7/20147/7/2014

N/A S.14.01 (201) 7/7/20147/7/20147/7/20147/7/2014

BL 7/7/2014 7/15/20167/7/20147/7/20147/7/2014

no 7/7/20147/7/20147/7/20147/7/20147/7/2014

Page 673: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/2014

no 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

no 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

no 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

no 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

N/A 7/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

N/A S.14.01 (201) 7/7/20147/7/20147/7/20147/7/20147/7/2014

BL 7/7/2014 7/15/20167/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/2014

N/A 7/7/2014 7/15/20167/7/20147/7/2014

Page 674: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

ILN [Insurance-linked Notes and deposits, including Catastrophe and Weather Risk as well as Mortality Risk] 7/7/20147/7/2014

TZ 9/30/20159/30/2015

7/7/20149/30/2015

N/A S.07.01 (201) 9/30/2015 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

14 - Insurance-linked notes and deposits, including notes covering Catastrophe and Weather Risk as well as Mortality Risk 7/7/20147/7/2014

RZ S.14.01 (201) 9/30/2015 7/15/20167/7/20147/7/20147/7/2014

9/30/20157/7/2014

N/A S.14.01 (201) 9/30/20157/7/2014

2 - Single premium with possibility of additional premiums with additional guarantee according to amount paid 9/30/20157/7/20147/7/2014

BL S.14.01 (201), S.30.01 (201), S.30.02 9/30/2015 7/15/2016no 7/7/2014

9/30/20157/7/20147/7/2014

Page 675: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/201433 - Annuities stemming from non-life insurance contracts and relating to health insurance obligations 7/7/201434 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligations 7/7/2014

7/7/20147/7/2014

BL, RB S.16.01 (201), S.20.01 (201), S.21.01 9/30/2015no 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

BL S.19.01 (201) 9/30/2015no 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

BL S.29.04 (201) 9/30/2015no 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 676: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

BL S.30.01 (201), S.30.02 (201) 9/30/2015no 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

RZ 9/30/20157/7/20147/7/2014

9/30/2015BL S.30.03 (201), S.31.02 (201) 9/30/2015 7/15/2016

no 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 677: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/2014

33 - Annuities stemming from non-life insurance contracts and relating to health insurance obligations 7/7/201434 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligations 7/7/2014

7/7/20147/7/2014

9/30/2015BL 9/30/2015 7/15/2016

9/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/2013

7/7/2014 12/31/20139/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/2013

7/7/20147/7/20147/7/2014

Annuities stemming from non-life insurance contracts and relating to health insurance obligations 7/7/2014Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligations 7/7/2014

9/30/2015

Page 678: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/2014

N/A 9/30/20159/30/2015 12/31/20139/30/2015 12/31/2013

BL 9/30/20157/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014

BL 9/30/20157/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

T618
Michal Skopowski: MUST STAY (due to Variable annuities)
Page 679: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

BL 9/30/20157/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/2013

Page 680: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

BL 9/30/20157/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

TZ 9/30/20157/7/20147/7/2014

9/30/20159/30/20159/30/2015 12/31/20139/30/2015

7/7/2014BL S.04.01 (201), S.36.03 (201) 9/30/2015

T722
Michal Skopowski: MUST STAY (due to Annuities stemming from non-life insurance contracts)
Page 681: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

no 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

33 - Annuities stemming from non-life insurance contracts and relating to health insurance obligations 7/7/201434 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligations 7/7/2014

7/7/20147/7/20147/7/2014

RZ 9/30/20159/30/20159/30/2015

RZ 9/30/20159/30/20159/30/20159/30/20159/30/2015

BL 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014

Page 682: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

BL S.22.06 (201) 9/30/2015no 7/7/2014

7/7/20147/7/2014

N/A S.14.01 (210) 7/15/20167/15/20167/15/20167/15/20169/30/20157/15/2016

BL S.30.03 (210), S.31.02 (210) 7/15/2016no 7/7/2014

7/7/2014

Page 683: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

33 - Annuities stemming from non-life insurance contracts and relating to health insurance obligations 7/7/201434 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligations 7/7/2014

7/7/20147/7/2014

9/30/2015BL S.14.01 (210), S.30.01 (210), S.30.02 7/15/2016

no 7/7/20147/7/20147/7/20147/7/20147/7/2014

33 - Annuities stemming from non-life insurance contracts and relating to health insurance obligations 7/7/201434 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligations 7/7/2014

7/7/20147/7/2014

N/A S.07.01 (210) 9/30/20157/7/20147/7/20147/7/20147/7/2014

Page 684: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

14 - Insurance-linked notes and deposits, including notes covering Catastrophe and Weather Risk as well as Mortality Risk 7/7/20147/15/2016

BL S.04.01 (210) 7/15/2016no 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

33 - Annuities stemming from non-life insurance contracts and relating to health insurance obligations 7/7/201434 - Annuities stemming from non-life insurance contracts and relating to insurance obligations other than health insurance obligations 7/7/2014

7/7/20147/7/2014

N/A S.33.01 (210) 7/15/20167/15/2016

Page 685: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/20167/15/20167/15/2016

N/A S.33.01 (210) 7/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/20167/15/2016

Page 686: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modified dat Comment

Page 687: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 688: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 689: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 690: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 691: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 692: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/20159/30/2015

Page 693: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 694: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

9/30/2015

7/15/2017

Page 695: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2017

7/15/2017

7/15/2017

Page 696: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2017

7/15/2017

Page 697: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 698: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 699: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 700: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20157/15/2017

Page 701: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 702: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2017

7/15/2017

Page 703: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2017

7/15/2017

Page 704: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

7/15/2017

Page 705: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerTotal/NA x0 yes s2cAdverse change in credit rating of the underlying assets or entx1 s2cAdverse fall in value of the underlying reference asset [F] x2 s2cBankruptcy filing ISDA credit event x3 s2cBankruptcy of the underlying or reference entity [B] x4 s2cBreach of contractual obligation linked with the acquisition ofx5 s2cBreach of contractual obligation linked with the disposal of asx6 s2cBreach of MCR x7 s2cBreach of SCR x8 s2cDowngrading by a rating agency x9 s2cFall of SCR below a threshold but higher than 100 % x10 s2cFraud x11 s2cHybird (including componets from above techniques) x12 s2cIndemnity x13 s2cIndex or Parametric x14 s2cModel Loss x15 s2cMultiple events or a combination of events [M] x16 s2cNon-payment of a contractual obligation x17 s2cNovation [N] x18 s2cOther events [O] x19 s2cOther than bankruptcy filing ISDA credit event, downgrading byx20 s2cOther than in underlying portfolio x21 s2cOther than indemnity, Model Loss, Index or Parametric and Hx22 s2cThe same as in underlying portfolio x23 s2cFall of MCR below a threshold but higher than 100 % x24 s2cNo unwind trigger x25 s2c

Page 706: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modified Count Comment7/7/2014 07/7/2014 27/7/2014 27/7/2014 17/7/2014 27/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 7/15/2017 17/7/2014 17/7/2014 17/7/2014 17/7/2014 27/7/2014 17/7/2014 27/7/2014 27/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

9/30/2015 1

Page 707: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name1: Types of triggering events of guarantee

Bankruptcy filing ISDA credit event x3Downgrading by a rating agency x9Fall of SCR below a threshold but higher than 100 % x10Fall of MCR below a threshold but higher than 100 % x24Breach of SCR x8Breach of MCR x7Non-payment of a contractual obligation x17Fraud x11Breach of contractual obligation linked with the disposal of assets x6Breach of contractual obligation linked with the acquisition of assets x5Other than bankruptcy filing ISDA credit event, downgrading by a rating agency, fall of SCR / x20

2: Types of triggering events for derivatives (Preparatory scope)Bankruptcy of the underlying or reference entity [B] x4Adverse fall in value of the underlying reference asset [F] x2Adverse change in credit rating of the underlying assets or entity [R] x1Novation [N] x18Multiple events or a combination of events [M] x16Other events [O] x19

3: Types of triggering events for SPVIndemnity x13Model Loss x15Index or Parametric x14Hybird (including componets from above techniques) x12Other than indemnity, Model Loss, Index or Parametric and Hybrids x22

4: Types of triggersThe same as in underlying portfolio x23Other than in underlying portfolio x21

5: Types of triggering events for derivatives (Full scope)Bankruptcy of the underlying or reference entity [B] x4Adverse fall in value of the underlying reference asset [F] x2Adverse change in credit rating of the underlying assets or entity [R] x1Novation [N] x18Multiple events or a combination of events [M] x16Other events [O] x19No unwind trigger x25

Page 708: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy nSign Weight Owner Usable Applicable Applicable Creation date Validity dates2c N/A S.03.02 (201 7/7/2014

1 - Bankruptcy filing ISDA credit event 7/7/20142 - Downgrading by a rating agency 7/7/20143 - Fall of SCR below a threshold but higher than 100 % 7/7/20144 - Fall of MCR below a threshold but higher than 100 % 7/7/20145 - Breach of SCR 7/7/20146 - Breach of MCR 7/7/20147 - Non-payment of a contractual obligation 7/7/20148 - Fraud 7/7/20149 - Breach of contractual obligation linked with the disposal of assets 7/7/201410 - Breach of contractual obligation linked with the acquisition of assets 7/7/20140 - Other 7/7/2014

s2c N/A S.08.01 (201 7/7/2014 9/30/2015Bankruptcy of the underlying or reference entity [B] 7/7/2014Adverse fall in value of the underlying reference asset [F] 7/7/2014Adverse change in credit rating of the underlying assets or entity [R] 7/7/2014Novation [N] 7/7/2014Multiple events or a combination of events [M] 7/7/2014Other events [O] 7/7/2014

s2c N/A S.31.02 (20 7/7/20141 - Indemnity 7/7/20142 - Model Loss 7/7/20143 - Index or Parametric 7/7/20144 - Hybrids (including components from the above-mentioned techniques) 7/7/20145 - Other 7/7/2014

s2c N/A S.31.02 (20 7/7/20141 - Same trigger 7/7/20142 - Different trigger 7/7/2014

s2c N/A S.08.01 (201 7/7/20141 - Bankruptcy of the underlying or reference entity 7/7/20142 - Adverse fall in value of the underlying reference asset 7/7/20143 - Adverse change in credit rating of the underlying assets or entity 7/7/20144 - Novation, i.e. the act of replacing an obligation under the derivative with 7/7/20145 - Multiple events or a combination of events 7/7/20146 - Other events not covered by the previous options 7/7/20149 - No unwind trigger 9/30/2015

Page 709: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modified date Comment

7/15/2017

9/30/2015

Page 710: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerTotal/NA x0 yes s2cArticle 223 deduction x1 s2cArticle 228 deduction x2 s2cArticle 229 deduction x3 s2cArticle 68 [1] deduction x4 s2cArticle 68 [1] [2] deduction x5 s2cArticle 68 [2] deduction x6 s2cBonds x7 s2cBonds/Debt - collateralised x8 s2cBonds/Debt - uncollateralised x9 s2cBonds securities other than structured notes and collateralised securities x10 s2cCash x11 s2cClaim provisions [other than local GAAP specific] x12 s2cClaim provisions other than new [other than local GAAP specific] x13 s2cClaims recoverables x14 s2cClosed x15 s2cCollateral held x16 s2cCollateral pledged x17 s2cCollateralised securities x18 s2cContingent x19 s2cContingent liabilities x20 s2cContingent liabilities and collateral pledged x21 s2cContingent liabilities other than guarantees and letters of credit given x22 s2cCost sharing x23 s2cCost sharing, contingent liabilities [other than derivatives] and off-balance x24 s2cCredit derivatives x25 s2cCredit protection derivatives x26 s2cDebt instruments [not subordinated] x27 s2cDeductions x28 s2cDeferred acquisition costs x29 s2cDeferred tax x30 s2cDeposits other than reinsurance deposits x31 s2cDerivatives x32 s2cForwards x33 s2cFutures x34 s2cDerivatives - options x35 s2cDerivatives - others x36 s2cDerivatives other than credit derivatives x37 s2cDue in respect of own fund items or initial fund called up but not yet paid i x38 s2cEquity instruments x39 s2cListed equity x40 s2cUnlisted equity x41 s2cEquity instruments other than shares x42 s2cEquity instruments, loans and bonds x43 s2cEquity type - dividends x44 s2cEquity type - others x45 s2cEquity type - shares/participations x46 s2cEquity-type, debt and asset transfer x47 s2cFinancial [other than contingent and receivables/payables] x48 s2cFinancial [other than receivables/payables and recoverables] x49 s2c

Page 711: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Financial [other than subordinated, contingent and receivables/payables] x50 s2cFinancial guarantees x51 s2cFinancial other than receivables/payables, recoverables, cash, derivatives, x52 s2cFL-FL [closed] x53 s2cFL-FL [open] x54 s2cFL-FX [closed] x55 s2cFL-FX [open] x56 s2cFutures, forwards, options and other derivatives x57 s2cFX-FL [closed] x58 s2cFX-FL [open] x59 s2cFX-FX [closed] x60 s2cFX-FX [open] x61 s2cGoodwill x62 s2cGross technical provisions [local GAAP specific] x63 s2cGross technical provisions [other than local GAAP specific] x64 s2cGuarantees - credit protection x65 s2cGuarantees - others x66 s2cGuarantees and letters of credit given x67 s2cGuarantees and letters of credit received x68 s2cGuarantees received and collateral held x69 s2cInitial funds [members' contributions or the equivalent basic own fund it x70 s2cIntangible x71 s2cIntangible other than goodwill and deferred acquisition costs x72 s2cInvestment x73 s2cLegally binding commitment to subscribe and pay for subordinated liabiliti x74 s2cLetters of credit and guarantees other than under Article 96[2] of the Framx75 s2cLetters of credit and guarantees under Article 96[2] of the Framework Direcx76 s2cLimited guarantees and letters of credit received x77 s2cLimited guarantees and letters of credit given x78 s2cLimited guarantees and letters of credit received directly x79 s2cLimited guarantees and letters of credit received for assets held x80 s2cMortgages and loans x81 s2cLoans and bonds x82 s2cLoans and bonds other than structured notes and collateralised securities x83 s2cNew claim provisions [other than local GAAP specific] x84 s2cOff balance sheet items x85 s2cOpen x86 s2cOrdinary shares x87 s2cOrdinary shares, preference shares and initial funds [members' contributi x88 s2cOther asset transfer - others x89 s2cOther asset transfer - properties x90 s2cOther items approved by supervisory authority x91 s2cOther items of own funds x92 s2cOther than debt instruments [not subordinated], derivatives and reinsuranx93 s2cOther than debt instruments [not subordinated], derivatives, reinsurance x94 s2cOther than derivatives, equity instruments and loans and bonds x95 s2cOther than derivatives, equity instruments, loans, bonds and deferred tax x96 s2cOther than intangible, deferred tax, pension benefit, property, plant and eqx97 s2cOther than loans, bonds, derivatives and reinsurance deposits x98 s2cOther than loans, bonds, equity instruments and derivatives x99 s2cOther than property, plant and equipment, financial [other than receivabl x100 s2c

Page 712: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other than property, plant and equipment, financial [other than receivabl x101 s2cOther than provisions, pension benefit, contingent, deferred tax, reinsuranx102 s2cOther than reserves and retained earnings x103 s2cOther than retained by policyholder x104 s2cOther than technical provisions, contingent, financial [receivables/payable x105 s2cOthers x106 s2cOwn funds [before deductions] x107 s2cOwn funds [before deductions] other than other items of own funds x108 s2cOwn funds [before deductions] other than reconciliation reserve x109 s2cOwn funds equivalent to the value of net deferred tax assets x110 s2cPension benefit x111 s2cPreference shares x112 s2cPremium provisions [other than local GAAP specific] x113 s2cPremium recoverables x114 s2cProperties x115 s2cProperty, plant and equipment and financial [other than receivables/payabx116 s2cProperty, plant and equipment, financial [other than receivables/payables x117 s2cProvisions other than technical provisions x118 s2cReceivables/payables [insurance/reinsurance accepted] x119 s2cReceivables/payables [insurance/reinsurance related] x120 s2cReceivables/payables [reinsurance ceded] x121 s2cReceivables/payables [trade] x122 s2cReconciliation reserve x123 s2cRecoverables x124 s2cReinsurance contracts x125 s2cReinsurance deposits x126 s2cReinsurance deposits and receivables/payables [insurance/reinsurance relax127 s2cReserves and retained earnings x128 s2cRetained by policyholder x129 s2cS [closed] x130 s2cS [open] x131 s2cShare premium related to preference shares x132 s2cShare premium related to ordinary shares x133 s2cShare premiums x134 s2cShares x135 s2cStructured notes x136 s2cStructured notes and collateralised securities x137 s2cStructured notes and collateralised securities [other than tradable that ar x138 s2cStructured notes and collateralised securities [synthetic] x139 s2cStructured notes and collateralised securities [tradable that are based on x140 s2cStructured notes and collateralised securities [traditional] x141 s2cSubordinated x142 s2cSubordinated debt instruments x143 s2cSubordinated mutual member accounts x144 s2cSum insured by the reporting entity not including technical provisions [othex145 s2cSupplementary members calls x146 s2cSupplementary members calls - other than under Article 96[3] of the Fram x147 s2cSupplementary members calls under Article 96[3] of the Framework Direct x148 s2cSurplus funds x149 s2cSwaps x150 s2cSwaps - credit default x151 s2c

Page 713: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Swaps - currency x152 s2cSwaps - interest rate x153 s2cSwaps - others x154 s2cTechnical provisions x155 s2cTechnical provisions [other than local GAAP specific] x156 s2cUnderwriting x157 s2cUnlimited guarantees and letters of credit given x158 s2cUnlimited guarantees and letters of credit received x159 s2cPreference shares and share premium related to preference shares x160 s2cOther than technical provisions x161 s2cL [closed] x162 s2cL [open] x163 s2cCash or equivalent in Trust x164 s2cCash or Funds Withheld x165 s2cLetter of Credit x166 s2cOther than Cash or equivalent in Trust, Cash or Funds Withheld and Letter ox167 s2cAssets other than derivatives and Assets held as collateral x168 s2cDerivatives - Open x169 s2cDerivatives - Transactions x170 s2cAssets held as collateral x171 s2cProperty (other than for own use) x172 s2cParticipations x173 s2cEquities x174 s2cGovernment Bonds x175 s2cCorporate Bonds x176 s2cCollective investments undertakings x177 s2cDeposits other than cash equivalents x178 s2cOther investments x179 s2cLoans & mortgages x180 s2cLoans and mortgages to individuals x181 s2cOther loans and mortgages x182 s2cLoans on policies x183 s2cRecoverables recognised for TP calculation x184 s2cRecoverables not recognised for TP calculation x185 s2cCash and deposits x186 s2cAssets [listed] x187 s2cAssets that are not listed in a stock exchange x188 s2cAssets that are not exchange tradable x189 s2cProperty, plant and equipment, Cash, Derivatives, Bonds, Equity instrumentx190 s2cCash, Derivatives, Bonds, Equity instruments, Participations and related u x191 s2cParticipations and related undertakings x192 s2cLiabilities x195 s2cGovernment Guarantee x196 s2cGovernment Supported including Public Finance initiative (PFI) x197 s2cSupranational Guarantee/Supported x198 s2cOther infrastructure loans or investments x199 s2cNot an infrastructure investment x200 s2cCall Options x201 s2cPut Options x202 s2cStructured product without any transfer of asset x203 s2cStructured product with transfer of asset x204 s2c

Page 714: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other than technical provisions, contingent, derivatives, debt instruments x205 s2cPremium recoverables recognised for TP calculation x206 s2cClaims recoverables recognised for TP calculation x207 s2cLoans x208 s2cMortgages x209 s2cAssets where third party can change the cash flows x210 s2cAssets linked to inflation x211 s2cProperty, plant and equipment, Cash, Derivatives, Bonds, Equity instrumentx212 s2cDebt instruments [not subordinated]. Debts owed to credit institutions x213 s2cDebt instruments [not subordinated]. Financial liabilities other than debts ox214 s2cDebt instruments [not subordinated]. Debts owed to non-credit institution x215 s2cDebt instruments [not subordinated]. Financial liabilities other than debts x216 s2cBorrower's notes, non-negotiable debt securities and nonnegotiable moneyx217 s2cRegistered bonds, registered participation certificates and subscription righx218 s2cOther than borrower's notes, non-negotiable debt securities, nonnegotiable x219 s2cDeposits and loans claims x220 s2cSecuritised loans x221 s2cDebt securities x222 s2cOther securitised assets x223 s2cEquity and collective investment units x224 s2cNon-financial assets (including fixed assets) x225 s2cTotal of other material classes of assets x226 s2cRemaining assets x227 s2cLoans and deposits received x228 s2cDebt securities issued x229 s2cTotal of other material classes of liabilities x230 s2cRemaining liabilities x231 s2cGuarantees received x232 s2cLetters of credit received x233 s2cBorrower's notes, registered bonds, registered participation certificates andx234 s2cOther than borrower's notes, registered bonds, registered participation certx235 s2cOff-balance sheet items x236 s2cOff-balance sheet items other than guarantees received and collateral heldx237 s2cOff-balance sheet obligations x238 s2cOff-balance sheet obligations other than collateral pledged x239 s2cNo collateral x240 s2cOther than property, plant and equipment, financial [other than receivablex241 s2cOther than intangible, deferred tax, pension benefit, property, plant and eqx242 s2cArticle 228 (paragraphs 2) deduction x243 s2cBorrower's notes, non-negotiable debt securities and non-negotiable monex244 s2cRegistered bonds x245 s2cRegistered participation certificates and subscription rights x246 s2cOther than borrower's notes, non-negotiable debt securities, non-negotiablex247 s2cContingent [for which maximum value is identified] x248 s2cContingent [for which maximum value is not identified] x249 s2cEquity-type transactions, debt and asset transfer x250 s2cInternal Reinsurance x251 s2cCost Sharing, contingent liabilities, off BS and other items x252 s2cInfrastructure non-qualifying: Government Guarantee [Government, Centralx253 s2cInfrastructure qualifying: Government Guarantee [Government, Central banx254 s2cInfrastructure non-qualifying: Government Supported including Public Finanx255 s2c

Page 715: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Infrastructure qualifying: Government Supported including Public Finance ix256 s2cInfrastructure non-qualifying: Supranational Guarantee/Supported [ECB, Mux257 s2cInfrastructure qualifying: Supranational Guarantee/Supported [ECB, Multil x258 s2cInfrastructure non-qualifying: Other non-qualifying infrastructure loans or x259 s2cInfrastructure qualifying: Other qualifying infrastructure investments, not cx260 s2cCash deposits x261 s2cEuropean Long-Term Investment Fund x262 s2c

Page 716: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modified date Count Comment7/7/2014 317/7/2014 27/7/2014 27/7/2014 27/7/2014 9/30/2015 27/7/2014 9/30/2015 27/7/2014 9/30/2015 27/7/2014 87/7/2014 37/7/2014 37/7/2014 87/7/2014 87/7/2014 27/7/2014 12/31/2013 27/7/2014 37/7/2014 17/7/2014 57/7/2014 37/7/2014 107/7/2014 27/7/2014 47/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 27/7/2014 27/7/2014 37/7/2014 17/7/2014 37/7/2014 27/7/2014 87/7/2014 117/7/2014 9/30/2015 87/7/2014 207/7/2014 57/7/2014 57/7/2014 37/7/2014 37/7/2014 12/31/2013 17/7/2014 87/7/2014 137/7/2014 97/7/2014 97/7/2014 12/31/2013 27/7/2014 17/7/2014 27/7/2014 37/7/2014 37/7/2014 27/7/2014 12/31/2013 17/7/2014 5

Page 717: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 12/31/2013 17/7/2014 27/7/2014 57/7/2014 27/7/2014 27/7/2014 27/7/2014 27/7/2014 17/7/2014 27/7/2014 27/7/2014 27/7/2014 27/7/2014 87/7/2014 27/7/2014 27/7/2014 37/7/2014 37/7/2014 27/7/2014 37/7/2014 12/31/2013 27/7/2014 27/7/2014 87/7/2014 87/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 27/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 9/30/2015 147/7/2014 87/7/2014 17/7/2014 27/7/2014 27/7/2014 17/7/2014 47/7/2014 12/31/2013 17/7/2014 37/7/2014 37/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 57/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 2

Page 718: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 57/7/2014 27/7/2014 17/7/2014 17/7/2014 9/30/2015 17/7/2014 27/7/2014 27/7/2014 17/7/2014 27/7/2014 27/7/2014 107/7/2014 47/7/2014 27/7/2014 37/7/2014 127/7/2014 57/7/2014 12/31/2013 27/7/2014 27/7/2014 107/7/2014 107/7/2014 107/7/2014 107/7/2014 27/7/2014 47/7/2014 27/7/2014 137/7/2014 87/7/2014 17/7/2014 17/7/2014 27/7/2014 27/7/2014 27/7/2014 27/7/2014 12/31/2013 17/7/2014 27/7/2014 107/7/2014 77/7/2014 12/31/2013 17/7/2014 47/7/2014 17/7/2014 47/7/2014 12/31/2013 17/7/2014 47/7/2014 27/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 27/7/2014 37/7/2014 3

Page 719: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 37/7/2014 37/7/2014 37/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 27/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 27/7/2014 27/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 27/7/2014 27/7/2014 27/7/2014 27/7/2014 17/7/2014 17/7/2014 27/7/2014 87/7/2014 87/7/2014 87/7/2014 17/7/2014 87/7/2014 9/30/2015 07/7/2014 37/7/2014 37/7/2014 3

9/30/2015 59/30/2015 12/31/2013 29/30/2015 69/30/2015 19/30/2015 19/30/2015 19/30/2015 29/30/2015 12/31/2013 29/30/2015 39/30/2015 19/30/2015 29/30/2015 29/30/2015 29/30/2015 29/30/2015 29/30/2015 49/30/2015 49/30/2015 19/30/2015 1

Page 720: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015 19/30/2015 49/30/2015 49/30/2015 12/31/2013 29/30/2015 29/30/2015 19/30/2015 19/30/2015 29/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 29/30/2015 12/31/2013 19/30/2015 9/30/2015 19/30/2015 9/30/2015 19/30/2015 12/31/2013 19/30/2015 19/30/2015 12/31/2013 19/30/2015 19/30/2015 7/15/2017 19/30/2015 39/30/2015 39/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 17/15/2016 17/15/2016 17/15/2016 1

Page 721: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2016 17/15/2016 17/15/2016 17/15/2016 17/15/2016 17/15/2016 17/15/2016 1

Page 722: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy1: Type of assets and/or liabilities

Total/NADerivatives

Credit derivativesDerivatives other than credit derivatives

Equity instruments, loans and bondsEquity instrumentsLoans and bonds

Loans and bonds other than structured notes and collateralised securitiesStructured notes and collateralised securities [other than tradable that are based on repackaged loans]Structured notes and collateralised securities [tradable that are based on repackaged loans]

Other than derivatives, equity instruments and loans and bondsDeferred taxOther than derivatives, equity instruments, loans, bonds and deferred tax

2: Type of transactionTotal/NA

DerivativesFuturesForwardsDerivatives - options

Call OptionsPut Options

Derivatives - othersGuarantees - credit protectionGuarantees - othersSwaps - credit defaultSwaps - interest rateSwaps - currencySwaps - others

Equity-type, debt and asset transferBonds/Debt - collateralisedBonds/Debt - uncollateralisedEquity type - dividendsEquity type - shares/participationsEquity type - othersOther asset transfer - propertiesOther asset transfer - others

Reinsurance contractsCost sharing, contingent liabilities [other than derivatives] and off-balance sheet items and other

Contingent liabilitiesOff balance sheet itemsCost sharingOthers

3: Type of transactionTotal/NA

DerivativesFutures, forwards, options and other derivatives

FuturesForwardsDerivatives - options

Page 723: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Call OptionsPut Options

Derivatives - othersCredit protection derivatives

Guarantees - credit protectionGuarantees - others

SwapsSwaps - credit defaultSwaps - interest rateSwaps - currencySwaps - others

Equity-type, debt and asset transferBonds/Debt - collateralisedBonds/Debt - uncollateralisedEquity type - dividendsEquity type - shares/participationsEquity type - othersOther asset transfer - propertiesOther asset transfer - others

Reinsurance contractsCost sharing, contingent liabilities [other than derivatives] and off-balance sheet items and other

4: Types of guarantees received [on- and off-balance]Total/NA

Collateral heldFinancial guaranteesReinsurance deposits

5: Type of assetsTotal/NA

Property, plant and equipment and financial [other than receivables/payables and recoverables]PropertiesFinancial [other than receivables/payables and recoverables]

CashDerivativesDeposits other than reinsurance depositsLoans and bonds

Mortgages and loansBonds

Structured notes and collateralised securitiesStructured notes and collateralised securities [synthetic]Structured notes and collateralised securities [traditional]

Bonds securities other than structured notes and collateralised securitiesEquity instruments

Listed equityUnlisted equity

Financial other than receivables/payables, recoverables, cash, derivatives, deposits, loans, bonds and equity instrumeReinsurance deposits and receivables/payables [insurance/reinsurance related]

Reinsurance depositsReceivables/payables [insurance/reinsurance related]

Receivables/payables [insurance/reinsurance accepted]Receivables/payables [reinsurance ceded]

Recoverables

Page 724: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Premium recoverablesClaims recoverables

Other than property, plant and equipment, financial [other than receivables/payables insurance/reinsurance related andIntangible

GoodwillDeferred acquisition costsIntangible other than goodwill and deferred acquisition costs

Deferred taxReceivables/payables [trade]Pension benefitDue in respect of own fund items or initial fund called up but not yet paid inOther than intangible, deferred tax, pension benefit, property, plant and equipment, financial, reinsurance deposits, rec

6: Type of assetsTotal/NA

Property, plant and equipment, financial [other than receivables/payables and recoverables] and reinsurance depositsProperty, plant and equipment and financial [other than receivables/payables and recoverables]

PropertiesFinancial [other than receivables/payables and recoverables]

CashDerivativesDeposits other than reinsurance depositsLoans and bonds

Mortgages and loansBonds

Structured notesCollateralised securitiesBonds securities other than structured notes and collateralised securities

Equity instrumentsListed equityUnlisted equity

Financial other than receivables/payables, recoverables, cash, derivatives, deposits, loans, bonds and equity instruReinsurance deposits

Other than property, plant and equipment, financial [other than receivables/payables and recoverables] and reinsuranceReceivables/payables [insurance/reinsurance related]

Receivables/payables [insurance/reinsurance accepted]Receivables/payables [reinsurance ceded]

RecoverablesPremium recoverablesClaims recoverables

Other than property, plant and equipment, financial [other than receivables/payables insurance/reinsurance related anIntangible

GoodwillDeferred acquisition costsIntangible other than goodwill and deferred acquisition costs

Deferred taxReceivables/payables [trade]Pension benefitDue in respect of own fund items or initial fund called up but not yet paid inOther than intangible, deferred tax, pension benefit, property, plant and equipment, financial, reinsurance deposits, r

7: Type of assetsTotal/NA

Page 725: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Loans and bondsMortgages and loansBonds

Structured notesCollateralised securitiesBonds securities other than structured notes and collateralised securities

DerivativesReinsurance depositsOther than loans, bonds, derivatives and reinsurance deposits

Equity instrumentsShares

Ordinary sharesPreference shares

Equity instruments other than sharesOther than loans, bonds, equity instruments and derivatives

8: Type of liabilitiesTotal/NA

Technical provisionsGross technical provisions [local GAAP specific]Gross technical provisions [other than local GAAP specific]

Premium provisions [other than local GAAP specific]Claim provisions [other than local GAAP specific]

New claim provisions [other than local GAAP specific]Claim provisions other than new [other than local GAAP specific]

Other than technical provisionsContingentFinancial [other than contingent and receivables/payables]

Financial [other than subordinated, contingent and receivables/payables]DerivativesDebt instruments [not subordinated]

Subordinated debt instrumentsReinsurance deposits and receivables/payables [insurance/reinsurance related]

Reinsurance depositsReceivables/payables [insurance/reinsurance related]

Receivables/payables [insurance/reinsurance accepted]Receivables/payables [reinsurance ceded]

Other than technical provisions, contingent, financial [receivables/payables [trade]] and reinsurance depositProvisions other than technical provisionsPension benefitDeferred taxReceivables/payables [trade]Other than provisions, pension benefit, contingent, deferred tax, reinsurance deposit and financial

9: Type of liabilitiesTotal/NA

DerivativesDebt instruments [not subordinated]Reinsurance depositsOther than debt instruments [not subordinated], derivatives and reinsurance deposit

Equity instrumentsShares

Ordinary shares

Page 726: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Preference sharesEquity instruments other than shares

Other than debt instruments [not subordinated], derivatives, reinsurance deposit and equity instruments10: Type of liabilities

Total/NAReserves and retained earningsOther than reserves and retained earnings

11: Type of off balance sheet conceptsTotal/NA

Guarantees received and collateral heldGuarantees and letters of credit received

Limited guarantees and letters of credit receivedLimited guarantees and letters of credit received directlyLimited guarantees and letters of credit received for assets held

Unlimited guarantees and letters of credit receivedCollateral held

Contingent liabilities and collateral pledgedContingent liabilities

Guarantees and letters of credit givenUnlimited guarantees and letters of credit givenLimited guarantees and letters of credit given

Contingent liabilities other than guarantees and letters of credit givenCollateral pledged

12: Long or short positionsTotal/NA

OpenL [open]S [open]FX-FL [open]FX-FX [open]FL-FX [open]FL-FL [open]

ClosedL [closed]S [closed]FX-FL [closed]FX-FX [closed]FL-FX [closed]FL-FL [closed]

13: Types of sum insuredTotal/NA

Retained by policyholderOther than retained by policyholder

14: Sum insured by the reporting entity including technical provisions [other than local GAAP specific]Total/NA

Sum insured by the reporting entity not including technical provisions [other than local GAAP specific]Technical provisions [other than local GAAP specific]

15: Own fundsTotal/NA

Own funds [before deductions]Reconciliation reserve

Page 727: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Own funds [before deductions] other than reconciliation reserveOrdinary sharesShare premium related to ordinary sharesInitial funds [members' contributions or the equivalent basic own fund item for mutual and mutual-type undertakingsSubordinated mutual member accountsSurplus fundsPreference shares and share premium related to preference shares

Preference sharesShare premium related to preference shares

Subordinated debt instrumentsOwn funds equivalent to the value of net deferred tax assetsOther items approved by supervisory authority

DeductionsArticle 68 [1] [2] deduction

Article 68 [1] deductionArticle 68 [2] deduction

Article 228 deductionArticle 229 deductionArticle 223 deduction

16: Own fundsTotal/NA

Own funds [before deductions]Own funds [before deductions] other than other items of own funds

Reconciliation reserveOwn funds [before deductions] other than reconciliation reserve

Ordinary shares, preference shares and initial funds [members' contributions or the equivalent basic own fund iteOrdinary sharesPreference sharesInitial funds [members' contributions or the equivalent basic own fund item for mutual and mutual-type undertaki

Share premiumsShare premium related to ordinary sharesShare premium related to preference shares

SubordinatedSubordinated mutual member accountsSubordinated debt instruments

Legally binding commitment to subscribe and pay for subordinated liabilitiesGuarantees and letters of credit received

Letters of credit and guarantees under Article 96[2] of the Framework Directive [received]Letters of credit and guarantees other than under Article 96[2] of the Framework Directive [received]

Supplementary members callsSupplementary members calls under Article 96[3] of the Framework DirectiveSupplementary members calls - other than under Article 96[3] of the Framework Directive

Surplus fundsOwn funds equivalent to the value of net deferred tax assets

Other items of own fundsDeductions

Article 68 [1] [2] deductionArticle 68 [1] deductionArticle 68 [2] deduction

Article 228 deductionArticle 228 (paragraphs 2) deduction

Page 728: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Article 229 deductionArticle 223 deduction

17: Types of performanceTotal/NA

InvestmentUnderwriting

18: Types of CollateralCash or equivalent in TrustCash or Funds WithheldLetter of CreditOther than Cash or equivalent in Trust, Cash or Funds Withheld and Letter of CreditTotal/NA

19: Types of AssetAssets other than derivatives and Assets held as collateralDerivatives - OpenDerivatives - TransactionsAssets held as collateral

20: Types of Asset for which collateral is heldProperty (other than for own use)ParticipationsEquitiesGovernment BondsCorporate BondsStructured notesCollateralised securitiesCollective investments undertakingsDerivativesDeposits other than cash equivalentsOther investmentsMortgages and loansLoans and mortgages to individualsOther loans and mortgagesLoans on policies

21: Type of assets (Full scope)Total/NA

Property, plant and equipment and financial [other than receivables/payables and recoverables]PropertiesFinancial [other than receivables/payables and recoverables]

CashDerivativesDeposits other than reinsurance depositsLoans and bonds

Mortgages and loansBonds

Structured notes and collateralised securitiesStructured notes and collateralised securities [synthetic]Structured notes and collateralised securities [traditional]

Bonds securities other than structured notes and collateralised securitiesEquity instruments

Listed equityUnlisted equity

Page 729: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Financial other than receivables/payables, recoverables, cash, derivatives, deposits, loans, bonds and equity instrumeReinsurance deposits and receivables/payables [insurance/reinsurance related]

Reinsurance depositsReceivables/payables [insurance/reinsurance related]

Receivables/payables [insurance/reinsurance accepted]Receivables/payables [reinsurance ceded]

Recoverables recognised for TP calculationPremium recoverables recognised for TP calculationClaims recoverables recognised for TP calculation

Recoverables not recognised for TP calculationOther than property, plant and equipment, financial [other than receivables/payables insurance/reinsurance related and

IntangibleGoodwillDeferred acquisition costsIntangible other than goodwill and deferred acquisition costs

Deferred taxReceivables/payables [trade]Pension benefitDue in respect of own fund items or initial fund called up but not yet paid inOther than intangible, deferred tax, pension benefit, property, plant and equipment, financial, reinsurance deposits, rec

22: Type of liabilities (by currencies)Total/NA

Gross technical provisions [local GAAP specific]Gross technical provisions [other than local GAAP specific]

Premium provisions [other than local GAAP specific]Claim provisions [other than local GAAP specific]

New claim provisions [other than local GAAP specific]Claim provisions other than new [other than local GAAP specific]

ContingentContingent [for which maximum value is identified]Contingent [for which maximum value is not identified]

DerivativesDebt instruments [not subordinated]

Debt instruments [not subordinated]. Debts owed to credit institutionsDebt instruments [not subordinated]. Financial liabilities other than debts owed to credit institutions

Debt instruments [not subordinated]. Debts owed to non-credit institutionsDebt instruments [not subordinated]. Financial liabilities other than debts

Reinsurance deposits and receivables/payables [insurance/reinsurance related]Reinsurance depositsReceivables/payables [insurance/reinsurance related]

Receivables/payables [insurance/reinsurance accepted]Receivables/payables [reinsurance ceded]

Other than technical provisions, contingent, derivatives, debt instruments [not subordinated], reinsurance deposits and Provisions other than technical provisionsPension benefitDeferred taxReceivables/payables [trade]Subordinated debt instrumentsOther than provisions, pension benefit, contingent, deferred tax, reinsurance deposit and financial

23: Type of assetsTotal/NA

Page 730: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Property, plant and equipment, financial [other than receivables/payables and recoverables] and reinsurance depositsPropertiesCash and deposits

CashDeposits other than reinsurance depositsReinsurance deposits

DerivativesLoans and bonds

Mortgages and loansLoansMortgages

Government BondsCorporate BondsStructured notesCollateralised securities

Equity instrumentsListed equityUnlisted equity

Financial other than receivables/payables, recoverables, cash, derivatives, deposits, loans, bonds and equity instrumentOther than property, plant and equipment, financial [other than receivables/payables and recoverables] and reinsurance

Receivables/payables [insurance/reinsurance related]Receivables/payables [insurance/reinsurance accepted]Receivables/payables [reinsurance ceded]

RecoverablesPremium recoverablesClaims recoverables

Other than property, plant and equipment, financial [other than receivables/payables insurance/reinsurance related anIntangible

GoodwillDeferred acquisition costsIntangible other than goodwill and deferred acquisition costs

Deferred taxReceivables/payables [trade]Pension benefitDue in respect of own fund items or initial fund called up but not yet paid inOther than intangible, deferred tax, pension benefit, property, plant and equipment, financial, reinsurance deposits, r

24: Type of assetsTotal/NA

Assets [listed]Assets that are not listed in a stock exchangeAssets that are not exchange tradable

25: Type of assetsTotal/NA

Property, plant and equipment, Cash, Derivatives, Bonds, Equity instruments, Participations and related undertakings, DProperty, plant and equipment, Cash, Derivatives, Bonds, Equity instruments, Participations and related undertakings,

PropertiesCash, Derivatives, Bonds, Equity instruments, Participations and related undertakings, Deposits other than reinsuranc

CashDerivativesDeposits other than reinsurance depositsBonds

Page 731: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Structured notes and collateralised securitiesStructured notesCollateralised securities

Bonds securities other than structured notes and collateralised securitiesGovernment BondsCorporate Bonds

Participations and related undertakingsEquity instruments

Listed equityUnlisted equity

Other investmentsCollective investments undertakings

Mortgages and loansLoans on policiesLoans and mortgages to individualsOther loans and mortgages

Reinsurance deposits and receivables/payables [insurance/reinsurance related]Reinsurance depositsReceivables/payables [insurance/reinsurance related]

Receivables/payables [insurance/reinsurance accepted]Receivables/payables [reinsurance ceded]

RecoverablesRecoverables recognised for TP calculationRecoverables not recognised for TP calculation

Other than property, plant and equipment, financial [other than receivables/payables insurance/reinsurance related and rIntangible

GoodwillDeferred acquisition costsIntangible other than goodwill and deferred acquisition costs

Deferred taxReceivables/payables [trade]Pension benefitDue in respect of own fund items or initial fund called up but not yet paid inOther than intangible, deferred tax, pension benefit, property, plant and equipment, financial, reinsurance deposits, rece

26: Underlying asset categoryGovernment BondsCorporate BondsListed equityUnlisted equityCollective investments undertakingsStructured notesCollateralised securitiesCash and depositsMortgages and loansPropertiesOther investmentsFuturesCall OptionsPut OptionsSwapsForwards

Page 732: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Credit derivativesLiabilities

27: Infrastructure investmentNot an infrastructure investmentGovernment GuaranteeGovernment Supported including Public Finance initiative (PFI)Supranational Guarantee/SupportedOther infrastructure loans or investments

28: CIC CategoriesGovernment BondsCorporate BondsEquity instrumentsCollective investments undertakingsStructured notesCollateralised securitiesCash and depositsMortgages and loansPropertiesOther investmentsFuturesCall OptionsPut OptionsSwapsForwardsCredit derivatives

29: Type of collateralGovernment BondsCorporate BondsEquity instrumentsCollective investments undertakingsStructured notesCollateralised securitiesCash and depositsMortgages and loansPropertiesOther investmentsNo collateral

30: Type of synthetic structured productStructured product without any transfer of assetStructured product with transfer of asset

31: Types of Asset for which collateral is heldGovernment BondsCorporate BondsEquitiesCollective investments undertakingsStructured notesCollateralised securitiesCash and depositsMortgages and loansPropertiesOther investments

Page 733: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Derivatives32: Long or short position [open]

L [open]S [open]FX-FL [open]FX-FX [open]FL-FX [open]FL-FL [open]

33: Long or short position [closed]L [closed]S [closed]FX-FL [closed]FX-FX [closed]FL-FX [closed]FL-FL [closed]

34: Type of assetsTotal/NA

Assets where third party can change the cash flowsAssets linked to inflation

35: Type of transactionBonds/Debt - collateralisedBonds/Debt - uncollateralisedEquity type - shares/participationsEquity type - othersOther asset transfer - propertiesOther asset transfer - others

36: Type of transactionFuturesForwardsDerivatives - optionsDerivatives - othersGuarantees - credit protectionGuarantees - othersSwaps - credit defaultSwaps - interest rateSwaps - currencySwaps - others

37: Type of transactionContingent liabilitiesOff balance sheet itemsCost sharingOthers

38: Types of AssetAssets other than derivatives and Assets held as collateral

Structured notes and collateralised securitiesDerivatives - OpenDerivatives - TransactionsAssets held as collateral

39: Types of AssetBorrower's notes, non-negotiable debt securities and nonnegotiable money market securitiesRegistered bonds, registered participation certificates and subscription rights

Page 734: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other than borrower's notes, non-negotiable debt securities, nonnegotiable money market securities, registered bonds, regis40: Type of assets

Total/NADeposits and loans claimsSecuritised loansDebt securitiesOther securitised assetsEquity and collective investment unitsDerivativesNon-financial assets (including fixed assets)Total of other material classes of assetsRemaining assets

41: Type of liabilities (by currencies)Total/NA

Loans and deposits receivedDebt securities issuedDerivativesTotal of other material classes of liabilitiesRemaining liabilities

42: Guarantees received and collateral heldGuarantees received and collateral held

Guarantees and letters of credit receivedGuarantees receivedLetters of credit received

Collateral held43: Types of Asset

Borrower's notes, registered bonds, registered participation certificates and subscription rightsOther than borrower's notes, registered bonds, registered participation certificates and subscription rights

44: Off-balance sheet itemsOff-balance sheet items

Guarantees receivedCollateral heldOff-balance sheet items other than guarantees received and collateral held

45: Off-balance sheet obligationsOff-balance sheet obligations

Collateral pledgedOff-balance sheet obligations other than collateral pledged

46: Contingent liabilities and collateral pledgedContingent liabilities and collateral pledged

Contingent liabilitiesGuarantees and letters of credit given

Unlimited guarantees and letters of credit givenLimited guarantees and letters of credit given

Contingent liabilities other than guarantees and letters of credit givenCollateral pledged

47: Type of assets (Full scope)Total/NA

Property, plant and equipment and financial [other than receivables/payables and recoverables]PropertiesFinancial [other than receivables/payables and recoverables]

Cash

Page 735: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

DerivativesDeposits other than reinsurance depositsLoans and bonds

Mortgages and loansBonds

Structured notes and collateralised securitiesStructured notes and collateralised securities [synthetic]Structured notes and collateralised securities [traditional]

Bonds securities other than structured notes and collateralised securitiesEquity instruments

Listed equityUnlisted equity

Financial other than receivables/payables, recoverables, cash, derivatives, deposits, loans, bonds and equity instrumeReinsurance deposits and receivables/payables [insurance/reinsurance related]

Reinsurance depositsReceivables/payables [insurance/reinsurance related]

Receivables/payables [insurance/reinsurance accepted]Receivables/payables [reinsurance ceded]

Recoverables recognised for TP calculationPremium recoverables recognised for TP calculationClaims recoverables recognised for TP calculation

Other than property, plant and equipment, financial [other than receivables/payables insurance/reinsurance related, recIntangible

GoodwillDeferred acquisition costsIntangible other than goodwill and deferred acquisition costs

Deferred taxReceivables/payables [trade]Pension benefitDue in respect of own fund items or initial fund called up but not yet paid inOther than intangible, deferred tax, pension benefit, property, plant and equipment, financial, reinsurance deposits, re

48: Types of AssetBorrower's notes, non-negotiable debt securities and non-negotiable money market securitiesRegistered bondsRegistered participation certificates and subscription rightsOther than borrower's notes, non-negotiable debt securities, non-negotiable money market securities, registered bonds, regi

49: Type of IGT transactionsEquity-type transactions, debt and asset transferDerivativesInternal ReinsuranceCost Sharing, contingent liabilities, off BS and other items

50: Infrastructure investmentTotal/NA

Not an infrastructure investmentGovernment Guarantee

Infrastructure non-qualifying: Government Guarantee [Government, Central bank, Regional government or local authorInfrastructure qualifying: Government Guarantee [Government, Central bank, Regional government or local authority]

Government Supported including Public Finance initiative (PFI)Infrastructure non-qualifying: Government Supported including Public Finance initiative [Government, Central bank, ReInfrastructure qualifying: Government Supported including Public Finance initiative [Government, Central bank, Regiona

Supranational Guarantee/Supported

Page 736: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Infrastructure non-qualifying: Supranational Guarantee/Supported [ECB, Multilateral development bank, International Infrastructure qualifying: Supranational Guarantee/Supported [ECB, Multilateral development bank, International organ

Other infrastructure loans or investmentsInfrastructure non-qualifying: Other non-qualifying infrastructure loans or investments, not classified under the above Infrastructure qualifying: Other qualifying infrastructure investments, not classified in the above categories

European Long-Term Investment Fund51: Type of assets (general)[210]

Total/NAProperty, plant and equipment and financial [other than receivables/payables and recoverables]

PropertiesFinancial [other than receivables/payables and recoverables]

Cash and depositsCashDeposits other than reinsurance deposits

DerivativesParticipations and related undertakingsLoans and bonds

Mortgages and loansMortgagesLoans

BondsStructured notes and collateralised securities

Structured notes and collateralised securities [synthetic]Structured notes and collateralised securities [traditional]

Bonds securities other than structured notes and collateralised securitiesEquity instruments

Listed equityUnlisted equity

Collective investments undertakingsOther investments

Reinsurance deposits and receivables/payables [insurance/reinsurance related]Reinsurance depositsReceivables/payables [insurance/reinsurance related]

Receivables/payables [insurance/reinsurance accepted]Receivables/payables [reinsurance ceded]

Recoverables recognised for TP calculationPremium recoverables recognised for TP calculationClaims recoverables recognised for TP calculation

Other than property, plant and equipment, financial [other than receivables/payables insurance/reinsurance related, recIntangible

GoodwillDeferred acquisition costsIntangible other than goodwill and deferred acquisition costs

Deferred taxReceivables/payables [trade]Pension benefitDue in respect of own fund items or initial fund called up but not yet paid inOther than intangible, deferred tax, pension benefit, property, plant and equipment, financial, reinsurance deposits, re

52: Type of assets [210]Total/NA

Property, plant and equipment, Cash, Derivatives, Bonds, Equity instruments, Participations and related undertakings, D

Page 737: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Property, plant and equipment, Cash, Derivatives, Bonds, Equity instruments, Participations and related undertakings, PropertiesCash, Derivatives, Bonds, Equity instruments, Participations and related undertakings, Deposits other than reinsuranc

CashDerivativesDeposits other than reinsurance depositsBonds

Structured notes and collateralised securitiesStructured notesCollateralised securities

Bonds securities other than structured notes and collateralised securitiesGovernment BondsCorporate Bonds

Participations and related undertakingsEquity instruments

Listed equityUnlisted equity

Other investmentsCollective investments undertakings

Mortgages and loansLoans on policiesLoans and mortgages to individualsOther loans and mortgages

Reinsurance deposits and receivables/payables [insurance/reinsurance related]Reinsurance depositsReceivables/payables [insurance/reinsurance related]

Receivables/payables [insurance/reinsurance accepted]Receivables/payables [reinsurance ceded]

Recoverables recognised for TP calculationPremium recoverables recognised for TP calculationClaims recoverables recognised for TP calculation

Other than property, plant and equipment, financial [other than receivables/payables insurance/reinsurance related, recIntangible

GoodwillDeferred acquisition costsIntangible other than goodwill and deferred acquisition costs

Deferred taxReceivables/payables [trade]Pension benefitDue in respect of own fund items or initial fund called up but not yet paid inOther than intangible, deferred tax, pension benefit, property, plant and equipment, financial, reinsurance deposits, re

53: Types of guarantees received [on- and off-balance] [210]Total/NA

Collateral heldFinancial guaranteesCash deposits

Page 738: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Hierarchy node label Sign Weight Owner Usables2c

x0 Total/NA =x32 Derivatives = +x25 Credit derivatives +x37 Derivatives other than credit derivatives +x43 Equity instruments, loans and bonds = +x39 Equity instruments +x82 Loans and bonds = +x83 Loans and bonds other than structured notes and colla+x138 Structured notes and collateralised securities [other +x140 Structured notes and collateralised securities [trada +x95 Other than derivatives, equity instruments and = +x30 Deferred tax +x96 Other than derivatives, equity instruments, loans, bo+

s2cx0 Total/NA =x32 Derivatives = +x34 Futures +x33 Forwards +x35 Derivatives - options = +x201 Call Options +x202 Put Options +x36 Derivatives - others +x65 Guarantees - credit protection +x66 Guarantees - others +x151 Swaps - credit default +x153 Swaps - interest rate +x152 Swaps - currency +x154 Swaps - others +x47 Equity-type, debt and asset transfer = +x8 Bonds/Debt - collateralised +x9 Bonds/Debt - uncollateralised +x44 Equity type - dividends +x46 Equity type - shares/participations +x45 Equity type - others +x90 Other asset transfer - properties +x89 Other asset transfer - others +x125 Reinsurance contracts +x24 Cost sharing, contingent liabilities [other than = +x20 Contingent liabilities +x85 Off balance sheet items +x23 Cost sharing +x106 Others +

s2cx0 Total/NA =x32 Derivatives = +x57 Futures, forwards, options and other derivative= +x34 Futures +x33 Forwards +x35 Derivatives - options = +

Page 739: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x201 Call Options +x202 Put Options +x36 Derivatives - others +x26 Credit protection derivatives = +x65 Guarantees - credit protection +x66 Guarantees - others +x150 Swaps = +x151 Swaps - credit default +x153 Swaps - interest rate +x152 Swaps - currency +x154 Swaps - others +x47 Equity-type, debt and asset transfer = +x8 Bonds/Debt - collateralised +x9 Bonds/Debt - uncollateralised +x44 Equity type - dividends +x46 Equity type - shares/participations +x45 Equity type - others +x90 Other asset transfer - properties +x89 Other asset transfer - others +x125 Reinsurance contracts +x24 Cost sharing, contingent liabilities [other than deriv +

s2cx0 Total/NA =x16 Collateral held +x51 Financial guarantees +x126 Reinsurance deposits +

s2cx0 Total/NA =x116 Property, plant and equipment and financial [o = +x115 Properties +x49 Financial [other than receivables/payables and = +x11 Cash +x32 Derivatives +x31 Deposits other than reinsurance deposits +x82 Loans and bonds = +x81 Mortgages and loans +x7 Bonds = +x137 Structured notes and collateralised securities = +x139 Structured notes and collateralised securities [synthet+x141 Structured notes and collateralised securities [traditi +x10 Bonds securities other than structured notes and colla+x39 Equity instruments = +x40 Listed equity +x41 Unlisted equity +x52 Financial other than receivables/payables, recoverabl+x127 Reinsurance deposits and receivables/payables = +x126 Reinsurance deposits +x120 Receivables/payables [insurance/reinsurance re= +x119 Receivables/payables [insurance/reinsurance accept +x121 Receivables/payables [reinsurance ceded] +x124 Recoverables = +

Page 740: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x114 Premium recoverables +x14 Claims recoverables +x101 Other than property, plant and equipment, fina= +x71 Intangible = +x62 Goodwill +x29 Deferred acquisition costs +x72 Intangible other than goodwill and deferred acquisiti+x30 Deferred tax +x122 Receivables/payables [trade] +x111 Pension benefit +x38 Due in respect of own fund items or initial fund calle +x97 Other than intangible, deferred tax, pension benefit, +

s2cx0 Total/NA =x117 Property, plant and equipment, financial [othe = +x116 Property, plant and equipment and financial [o = +x115 Properties +x49 Financial [other than receivables/payables and = +x11 Cash +x32 Derivatives +x31 Deposits other than reinsurance deposits +x82 Loans and bonds = +x81 Mortgages and loans +x7 Bonds = +x136 Structured notes +x18 Collateralised securities +x10 Bonds securities other than structured notes and colla+x39 Equity instruments = +x40 Listed equity +x41 Unlisted equity +x52 Financial other than receivables/payables, recoverabl+x126 Reinsurance deposits +x100 Other than property, plant and equipment, fina= +x120 Receivables/payables [insurance/reinsurance re= +x119 Receivables/payables [insurance/reinsurance accept +x121 Receivables/payables [reinsurance ceded] +x124 Recoverables = +x114 Premium recoverables +x14 Claims recoverables +x101 Other than property, plant and equipment, fina= +x71 Intangible = +x62 Goodwill +x29 Deferred acquisition costs +x72 Intangible other than goodwill and deferred acquisiti+x30 Deferred tax +x122 Receivables/payables [trade] +x111 Pension benefit +x38 Due in respect of own fund items or initial fund calle +x97 Other than intangible, deferred tax, pension benefit, +

s2cx0 Total/NA =

Page 741: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x82 Loans and bonds = +x81 Mortgages and loans +x7 Bonds = +x136 Structured notes +x18 Collateralised securities +x10 Bonds securities other than structured notes and colla+x32 Derivatives +x126 Reinsurance deposits +x98 Other than loans, bonds, derivatives and reins = +x39 Equity instruments = +x135 Shares = +x87 Ordinary shares +x112 Preference shares +x42 Equity instruments other than shares +x99 Other than loans, bonds, equity instruments and deri+

s2cx0 Total/NA =x155 Technical provisions = +x63 Gross technical provisions [local GAAP specific] +x64 Gross technical provisions [other than local GAA= +x113 Premium provisions [other than local GAAP specific] +x12 Claim provisions [other than local GAAP specific= +x84 New claim provisions [other than local GAAP specific]+x13 Claim provisions other than new [other than local GA+x161 Other than technical provisions = +x19 Contingent +x48 Financial [other than contingent and receivabl = +x50 Financial [other than subordinated, contingent = +x32 Derivatives +x27 Debt instruments [not subordinated] +x143 Subordinated debt instruments +x127 Reinsurance deposits and receivables/payables = +x126 Reinsurance deposits +x120 Receivables/payables [insurance/reinsurance re= +x119 Receivables/payables [insurance/reinsurance accept +x121 Receivables/payables [reinsurance ceded] +x105 Other than technical provisions, contingent, fin= +x118 Provisions other than technical provisions +x111 Pension benefit +x30 Deferred tax +x122 Receivables/payables [trade] +x102 Other than provisions, pension benefit, contingent, d+

s2cx0 Total/NA =x32 Derivatives +x27 Debt instruments [not subordinated] +x126 Reinsurance deposits +x93 Other than debt instruments [not subordinated]= +x39 Equity instruments = +x135 Shares = +x87 Ordinary shares +

Page 742: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x112 Preference shares +x42 Equity instruments other than shares +x94 Other than debt instruments [not subordinated], deri+

s2cx0 Total/NA =x128 Reserves and retained earnings +x103 Other than reserves and retained earnings +

s2cx0 Total/NAx69 Guarantees received and collateral held =x68 Guarantees and letters of credit received = +x77 Limited guarantees and letters of credit receive= +x79 Limited guarantees and letters of credit received dire+x80 Limited guarantees and letters of credit received for +x159 Unlimited guarantees and letters of credit received +x16 Collateral held +x21 Contingent liabilities and collateral pledged =x20 Contingent liabilities = +x67 Guarantees and letters of credit given = +x158 Unlimited guarantees and letters of credit given +x78 Limited guarantees and letters of credit given +x22 Contingent liabilities other than guarantees and letter+x17 Collateral pledged +

s2cx0 Total/NA =x86 Open = +x163 L [open] +x131 S [open] +x59 FX-FL [open] +x61 FX-FX [open] +x56 FL-FX [open] +x54 FL-FL [open] +x15 Closed = +x162 L [closed] +x130 S [closed] +x58 FX-FL [closed] +x60 FX-FX [closed] +x55 FL-FX [closed] +x53 FL-FL [closed] +

s2cx0 Total/NA =x129 Retained by policyholder +x104 Other than retained by policyholder +

s2cx0 Total/NA =x145 Sum insured by the reporting entity not including tech+x156 Technical provisions [other than local GAAP specific] +

s2cx0 Total/NA =x107 Own funds [before deductions] = +x123 Reconciliation reserve +

Page 743: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x109 Own funds [before deductions] other than recon= +x87 Ordinary shares +x133 Share premium related to ordinary shares +x70 Initial funds [members' contributions or the equival +x144 Subordinated mutual member accounts +x149 Surplus funds +x160 Preference shares and share premium related t= +x112 Preference shares +x132 Share premium related to preference shares +x143 Subordinated debt instruments +x110 Own funds equivalent to the value of net deferred ta+x91 Other items approved by supervisory authority +x28 Deductions = -x5 Article 68 [1] [2] deduction = +x4 Article 68 [1] deduction +x6 Article 68 [2] deduction +x2 Article 228 deduction +x3 Article 229 deduction +x1 Article 223 deduction +

s2cx0 Total/NA =x107 Own funds [before deductions] = +x108 Own funds [before deductions] other than othe= +x123 Reconciliation reserve +x109 Own funds [before deductions] other than recon= +x88 Ordinary shares, preference shares and initial = +x87 Ordinary shares +x112 Preference shares +x70 Initial funds [members' contributions or the equival +x134 Share premiums = +x133 Share premium related to ordinary shares +x132 Share premium related to preference shares +x142 Subordinated = +x144 Subordinated mutual member accounts +x143 Subordinated debt instruments +x74 Legally binding commitment to subscribe and pay for s+x68 Guarantees and letters of credit received = +x76 Letters of credit and guarantees under Article 96[2] +x75 Letters of credit and guarantees other than under Art+x146 Supplementary members calls = +x148 Supplementary members calls under Article 96[3] of +x147 Supplementary members calls - other than under Arti+x149 Surplus funds +x110 Own funds equivalent to the value of net deferred ta+x92 Other items of own funds +x28 Deductions = -x5 Article 68 [1] [2] deduction = +x4 Article 68 [1] deduction +x6 Article 68 [2] deduction +x2 Article 228 deduction >= +x243 Article 228 (paragraphs 2) deduction +

Page 744: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x3 Article 229 deduction +x1 Article 223 deduction +

s2cx0 Total/NAx73 Investmentx157 Underwriting

s2cx164 1 - Cash or equivalent in Trustx165 2 - Cash or Funds Withheldx166 3 - Letter of Creditx167 4 - Otherx0 5 - None

s2cx168 Assets other than derivatives and Assets held as collateralx169 Derivatives - Openx170 Derivatives - Transactionsx171 Assets held as collateral

s2cx172 Property (other than for own use)x173 Participationsx174 Equitiesx175 Government Bondsx176 Corporate Bondsx136 Structured notesx18 Collateralised securitiesx177 Collective investments undertakingsx32 Derivativesx178 Deposits other than cash equivalentsx179 Other investmentsx81 Mortgages and loansx181 Loans and mortgages to individualsx182 Other loans and mortgagesx183 Loans on policies

s2cx0 Total/NA =x116 Property, plant and equipment and financial [o = +x115 Properties +x49 Financial [other than receivables/payables and = +x11 Cash +x32 Derivatives +x31 Deposits other than reinsurance deposits +x82 Loans and bonds = +x81 Mortgages and loans +x7 Bonds = +x137 Structured notes and collateralised securities = +x139 Structured notes and collateralised securities [synthet+x141 Structured notes and collateralised securities [traditi +x10 Bonds securities other than structured notes and colla+x39 Equity instruments = +x40 Listed equity +x41 Unlisted equity +

Page 745: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x52 Financial other than receivables/payables, recoverabl+x127 Reinsurance deposits and receivables/payables = +x126 Reinsurance deposits +x120 Receivables/payables [insurance/reinsurance re= +x119 Receivables/payables [insurance/reinsurance accept +x121 Receivables/payables [reinsurance ceded] +x184 Recoverables recognised for TP calculation = +x206 Premium recoverables recognised for TP calculation +x207 Claims recoverables recognised for TP calculation +x185 Recoverables not recognised for TP calculation +x101 Other than property, plant and equipment, fina= +x71 Intangible = +x62 Goodwill +x29 Deferred acquisition costs +x72 Intangible other than goodwill and deferred acquisiti+x30 Deferred tax +x122 Receivables/payables [trade] +x111 Pension benefit +x38 Due in respect of own fund items or initial fund calle +x97 Other than intangible, deferred tax, pension benefit, +

s2cx0 Total/NA =x63 Gross technical provisions [local GAAP specific] +x64 Gross technical provisions [other than local GAA= +x113 Premium provisions [other than local GAAP specific] +x12 Claim provisions [other than local GAAP specific= +x84 New claim provisions [other than local GAAP specific]+x13 Claim provisions other than new [other than local GA+x19 Contingent +x248 Contingent [for which maximum value is identified]x249 Contingent [for which maximum value is not identified]x32 Derivatives +x27 Debt instruments [not subordinated] = +x213 Debt instruments [not subordinated]. Debts owed to c+x214 Debt instruments [not subordinated]. Financial l= +x215 Debt instruments [not subordinated]. Debts owed to n+x216 Debt instruments [not subordinated]. Financial liabili+x127 Reinsurance deposits and receivables/payables = +x126 Reinsurance deposits +x120 Receivables/payables [insurance/reinsurance re= +x119 Receivables/payables [insurance/reinsurance accept +x121 Receivables/payables [reinsurance ceded] +x205 Other than technical provisions, contingent, de= +x118 Provisions other than technical provisions +x111 Pension benefit +x30 Deferred tax +x122 Receivables/payables [trade] +x143 Subordinated debt instruments +x102 Other than provisions, pension benefit, contingent, d+

s2cx0 Total/NA =

Page 746: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x117 Property, plant and equipment, financial [othe = +x115 Properties +x186 Cash and deposits = +x11 Cash +x31 Deposits other than reinsurance deposits +x126 Reinsurance deposits +x32 Derivatives +x82 Loans and bonds = +x81 Mortgages and loans = +x208 Loans +x209 Mortgages +x175 Government Bonds +x176 Corporate Bonds +x136 Structured notes +x18 Collateralised securities +x39 Equity instruments = +x40 Listed equity +x41 Unlisted equity +x52 Financial other than receivables/payables, recoverabl+x100 Other than property, plant and equipment, fina= +x120 Receivables/payables [insurance/reinsurance re= +x119 Receivables/payables [insurance/reinsurance accept +x121 Receivables/payables [reinsurance ceded] +x124 Recoverables = +x114 Premium recoverables +x14 Claims recoverables +x101 Other than property, plant and equipment, fina= +x71 Intangible = +x62 Goodwill +x29 Deferred acquisition costs +x72 Intangible other than goodwill and deferred acquisiti+x30 Deferred tax +x122 Receivables/payables [trade] +x111 Pension benefit +x38 Due in respect of own fund items or initial fund calle +x97 Other than intangible, deferred tax, pension benefit, +

s2cx0 Total/NAx187 Assets [listed]x188 Assets that are not listed in a stock exchangex189 Assets that are not exchange tradable

s2cx0 Total/NA =x212 Property, plant and equipment, Cash, Derivativ= +x190 Property, plant and equipment, Cash, Derivative= +x115 Properties +x191 Cash, Derivatives, Bonds, Equity instruments, P = +x11 Cash +x32 Derivatives +x31 Deposits other than reinsurance deposits +x7 Bonds = +

Page 747: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x137 Structured notes and collateralised securities +x136 Structured notes +x18 Collateralised securities +x10 Bonds securities other than structured notes and= +x175 Government Bonds +x176 Corporate Bonds +x192 Participations and related undertakings +x39 Equity instruments = +x40 Listed equity +x41 Unlisted equity +x179 Other investments +x177 Collective investments undertakings +x81 Mortgages and loans = +x183 Loans on policies +x181 Loans and mortgages to individuals +x182 Other loans and mortgages +x127 Reinsurance deposits and receivables/payables = +x126 Reinsurance deposits +x120 Receivables/payables [insurance/reinsurance re= +x119 Receivables/payables [insurance/reinsurance accept +x121 Receivables/payables [reinsurance ceded] +x124 Recoverables = +x184 Recoverables recognised for TP calculation +x185 Recoverables not recognised for TP calculation +x101 Other than property, plant and equipment, fina= +x71 Intangible = +x62 Goodwill +x29 Deferred acquisition costs +x72 Intangible other than goodwill and deferred acquisiti+x30 Deferred tax +x122 Receivables/payables [trade] +x111 Pension benefit +x38 Due in respect of own fund items or initial fund calle +x97 Other than intangible, deferred tax, pension benefit, +

s2cx175 1 - Government bondsx176 2 - Corporate bondsx40 3L - Listed equityx41 3X - Unlisted equityx177 4 - Collective Investment Undertakingsx136 5 - Structured notesx18 6 - Collateralised securitiesx186 7 - Cash and depositsx81 8 - Mortgages and loansx115 9 - Propertiesx179 0 - Other investments (including receivables)x34 A – Futuresx201 B – Call Optionsx202 C – Put Optionsx150 D – Swapsx33 E – Forwards

Page 748: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x25 F – Credit derivativesx195 L - Liabilities

s2cx200 1 - Not an infrastructure investmentx196 2 - Government Guarantee: where there is an explicit government guaranteex197 3 - Government Supported including Public Finance initiative: where there is a government policy or public finance initiatives x198 4 - Supranational Guarantee/Supported: where there is an explicit supranational guarantee or supportx199 9 – Other: Other infrastructure loans or investments, not classified under the above categories

s2cx175 Government bondsx176 Corporate bondsx39 Equityx177 Collective Investment Undertakingsx136 Structured notesx18 Collateralised securitiesx186 Cash and depositsx81 Mortgages and loansx115 Propertyx179 Other investmentsx34 Futuresx201 Call Optionsx202 Put Optionsx150 Swapsx33 Forwardsx25 Credit derivatives

s2cx175 1 - Government bondsx176 2 - Corporate bondsx39 3 - Equityx177 4 - Collective Investment Undertakingsx136 5 - Structured notesx18 6 - Collateralised securitiesx186 7 - Cash and depositsx81 8 - Mortgages and loansx115 9 - Propertiesx179 0 - Other investmentsx240 10 – No collateral

s2cx203 1 – Structured product without any transfer of assetx204 2 – Structured product with transfer of asset

s2cx175 1 - Government bondsx176 2 - Corporate bondsx174 3 - Equitiesx177 4 - Collective Investment Undertakingsx136 5 - Structured notesx18 6 - Collateralised securitiesx186 7 - Cash and depositsx81 8 - Mortgages and loansx115 9 - Propertiesx179 0 - Other investments (including receivables)

Page 749: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x32 X - Derivativess2c

x163 1 - Buyerx131 2 - Sellerx59 3 - FX-FL: Deliver fixed-for-floatingx61 4 - FX-FX: Deliver fixed-for-fixedx56 5 - FL-FX: Deliver floating-for-fixedx54 6 - FL-FL: Deliver floating-for-floating

s2cx162 1 - Buyerx130 2 - Sellerx58 3 - FX-FL: Deliver fixed-for-floatingx60 4 - FX-FX: Deliver fixed-for-fixedx55 5 - FL-FX: Deliver floating-for-fixedx53 6 - FL-FL: Deliver floating-for-floating

s2cx0 Total/NAx210 Assets where third party can change the cash flowsx211 Assets linked to inflation

s2cx8 1 - Bonds / Debt - collateralisedx9 2 - Bonds / Debt - uncollateralisedx46 3 - Equity type - shares/participationsx45 4 - Equity type - othersx90 5 - Other asset transfer - propertiesx89 6 - Other asset transfer - others

s2cx34 1 - Derivatives - futuresx33 2 - Derivatives - forwardsx35 3 - Derivatives - optionsx36 4 - Derivatives - othersx65 5 - Guarantees - credit protectionx66 6 - Guarantees - othersx151 7 - Swaps - credit defaultx153 8 - Swaps - interest ratex152 9 - Swaps - currencyx154 10 - Swaps - others

s2cx20 1 - Contingent liabilitiesx85 2 - Off balance sheet itemsx23 3 - Internal cost sharingx106 4 - Others

s2cx168 Assets other than derivatives and Assets held as collateralx137 Structured notes and collateralised securitiesx169 Derivatives - Openx170 Derivatives - Transactionsx171 Assets held as collateral

s2cx217 Borrower's notes, non-negotiable debt securities and nonnegotiable money market securitiesx218 Registered bonds, registered participation certificates and subscription rights

Page 750: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x219 Other than borrower's notes, non-negotiable debt securities, nonnegotiable money market securities, registered bonds, registers2c

x0 Total/NA =x220 Deposits and loans claims +x221 Securitised loans +x222 Debt securities +x223 Other securitised assets +x224 Equity and collective investment units +x32 Derivatives +x225 Non-financial assets (including fixed assets) +x226 Total of other material classes of assets +x227 Remaining assets +

s2cx0 Total/NA =x228 Loans and deposits received +x229 Debt securities issued +x32 Derivatives +x230 Total of other material classes of liabilities +x231 Remaining liabilities +

s2cx69 Guarantees received and collateral held =x68 Guarantees and letters of credit received = +x232 Guarantees received = +x233 Letters of credit received +x16 Collateral held +

s2cx234 Borrower's notes, registered bonds, registered participation certificates and subscription rightsx235 Other than borrower's notes, registered bonds, registered participation certificates and subscription rights

s2cx236 Off-balance sheet items =x232 Guarantees received +x16 Collateral held +x237 Off-balance sheet items other than guarantees receiv+

s2cx238 Off-balance sheet obligations =x17 Collateral pledged +x239 Off-balance sheet obligations other than collateral p +

s2cx21 Contingent liabilities and collateral pledged =x20 Contingent liabilities = +x67 Guarantees and letters of credit given = +x158 Unlimited guarantees and letters of credit given +x78 Limited guarantees and letters of credit given +x22 Contingent liabilities other than guarantees and letter+x17 Collateral pledged +

s2cx0 Total/NA =x116 Property, plant and equipment and financial [o = +x115 Properties +x49 Financial [other than receivables/payables and = +x11 Cash +

Page 751: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x32 Derivatives +x31 Deposits other than reinsurance deposits +x82 Loans and bonds = +x81 Mortgages and loans +x7 Bonds = +x137 Structured notes and collateralised securities = +x139 Structured notes and collateralised securities [synthet+x141 Structured notes and collateralised securities [traditi +x10 Bonds securities other than structured notes and colla+x39 Equity instruments = +x40 Listed equity +x41 Unlisted equity +x52 Financial other than receivables/payables, recoverabl+x127 Reinsurance deposits and receivables/payables = +x126 Reinsurance deposits +x120 Receivables/payables [insurance/reinsurance re= +x119 Receivables/payables [insurance/reinsurance accept +x121 Receivables/payables [reinsurance ceded] +x184 Recoverables recognised for TP calculation = +x206 Premium recoverables recognised for TP calculation +x207 Claims recoverables recognised for TP calculation +x241 Other than property, plant and equipment, finan= +x71 Intangible = +x62 Goodwill +x29 Deferred acquisition costs +x72 Intangible other than goodwill and deferred acquisiti+x30 Deferred tax +x122 Receivables/payables [trade] +x111 Pension benefit +x38 Due in respect of own fund items or initial fund calle +x242 Other than intangible, deferred tax, pension benefit, +

s2cx244 1 – instrument is (i), (ii) or (iii)x245 2 – instrument is (iv)x246 3 – instrument is (v) or (vi)x247 9 – any other instrument

s2cx250 Equity-type transactions, debt and asset transferx32 Derivativesx251 Internal Reinsurancex252 Cost Sharing, contingent liabilities, off BS and other items

s2cx0 Total/NA = nox200 1 – Not an infrastructure investment +x196 Government Guarantee = + nox253 2 – Infrastructure non-qualifying: Government Guara+x254 12 – Infrastructure qualifying: Government Guarante+x197 Government Supported including Public Finance i= + nox255 3 – Infrastructure non-qualifying: Government Suppor+x256 13 – Infrastructure qualifying: Government Supported+x198 Supranational Guarantee/Supported = + no

Page 752: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x257 4 – Infrastructure non-qualifying: Supranational Gua +x258 14 – Infrastructure qualifying: Supranational Guaran +x199 Other infrastructure loans or investments = + nox259 9 – Infrastructure non-qualifying: Other non-qualifyin+x260 19 – Infrastructure qualifying: Other qualifying infra +x262 20 – European Long-Term Investment Fund +

s2cx0 Total/NA =x116 Property, plant and equipment and financial [o = +x115 Properties +x49 Financial [other than receivables/payables and = +x186 Cash and deposits = +x11 Cash +x31 Deposits other than reinsurance deposits +x32 Derivatives +x192 Participations and related undertakings +x82 Loans and bonds = +x81 Mortgages and loans = +x209 Mortgages +x208 Loans +x7 Bonds = +x137 Structured notes and collateralised securities = +x139 Structured notes and collateralised securities [synthet+x141 Structured notes and collateralised securities [traditi +x10 Bonds securities other than structured notes and colla+x39 Equity instruments = +x40 Listed equity +x41 Unlisted equity +x177 Collective investments undertakings +x179 Other investments +x127 Reinsurance deposits and receivables/payables = +x126 Reinsurance deposits +x120 Receivables/payables [insurance/reinsurance re= +x119 Receivables/payables [insurance/reinsurance accept +x121 Receivables/payables [reinsurance ceded] +x184 Recoverables recognised for TP calculation = +x206 Premium recoverables recognised for TP calculation +x207 Claims recoverables recognised for TP calculation +x241 Other than property, plant and equipment, finan= +x71 Intangible = +x62 Goodwill +x29 Deferred acquisition costs +x72 Intangible other than goodwill and deferred acquisiti+x30 Deferred tax +x122 Receivables/payables [trade] +x111 Pension benefit +x38 Due in respect of own fund items or initial fund calle +x242 Other than intangible, deferred tax, pension benefit, +

s2cx0 Total/NA =x212 Property, plant and equipment, Cash, Derivativ= +

Page 753: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x190 Property, plant and equipment, Cash, Derivative= +x115 Properties +x191 Cash, Derivatives, Bonds, Equity instruments, P = +x11 Cash +x32 Derivatives +x31 Deposits other than reinsurance deposits +x7 Bonds = +x137 Structured notes and collateralised securities +x136 Structured notes +x18 Collateralised securities +x10 Bonds securities other than structured notes and= +x175 Government Bonds +x176 Corporate Bonds +x192 Participations and related undertakings +x39 Equity instruments = +x40 Listed equity +x41 Unlisted equity +x179 Other investments +x177 Collective investments undertakings +x81 Mortgages and loans = +x183 Loans on policies +x181 Loans and mortgages to individuals +x182 Other loans and mortgages +x127 Reinsurance deposits and receivables/payables = +x126 Reinsurance deposits +x120 Receivables/payables [insurance/reinsurance re= +x119 Receivables/payables [insurance/reinsurance accept +x121 Receivables/payables [reinsurance ceded] +x184 Recoverables recognised for TP calculation = +x206 Premium recoverables recognised for TP calculation +x207 Claims recoverables recognised for TP calculation +x241 Other than property, plant and equipment, finan= +x71 Intangible = +x62 Goodwill +x29 Deferred acquisition costs +x72 Intangible other than goodwill and deferred acquisiti+x30 Deferred tax +x122 Receivables/payables [trade] +x111 Pension benefit +x38 Due in respect of own fund items or initial fund calle +x242 Other than intangible, deferred tax, pension benefit, +

s2cx0 Total/NAx16 Collateral heldx51 Financial guaranteesx261 Cash deposits

Page 754: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable dim Applicable sheets for drop Creation date Validity dateAL 7/7/2014

7/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/2013

TT 7/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

AL, TT 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 755: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

GR 7/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/2014

AS 7/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 756: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

AS 7/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

AS 7/7/20147/7/2014

T152
Michal Skopowski: Must stay due to S.03.01
Page 757: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/2013

AL, LB 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014

LB 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 758: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/2014 12/31/20137/7/2014 12/31/2013

LB 7/7/20147/7/20147/7/20147/7/2014

OB 7/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014

N/A 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

OS 7/7/20147/7/20147/7/20147/7/2014

OS 7/7/20147/7/20147/7/20147/7/2014 12/31/2013

OF 7/7/20147/7/20147/7/20147/7/2014

Page 759: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

OF 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 760: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/2014

PF 7/7/20147/7/20147/7/20147/7/2014

N/A S.30.04 (201) 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

SU 7/7/20147/7/20147/7/20147/7/20147/7/2014

N/A 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

AS 9/30/2015 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 761: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/20159/30/20159/30/2015 12/31/2013

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

LB 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014

9/30/20159/30/2015

7/7/20147/7/2014

9/30/20159/30/20159/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

AL, AS 9/30/2015 7/15/20167/7/2014

Page 762: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 12/31/20137/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/2015 12/31/20139/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

AS 9/30/20157/7/2014

9/30/20159/30/20159/30/2015

AS 9/30/2015 9/30/20157/7/2014

9/30/20159/30/2015

7/7/20149/30/2015 12/31/2013

7/7/20147/7/20147/7/20147/7/2014

Page 763: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/2015 12/31/2013

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

AS S.06.03 (201) 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/2015

7/7/20147/7/2014

Page 764: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20149/30/2015

TT S.06.02 (201), SE.06.02 (20 9/30/2015 7/15/20169/30/20159/30/2015

3 - Government Supported including Public Finance initiative: where there is a government policy or public finance initiatives 9/30/20154 - Supranational Guarantee/Supported: where there is an explicit supranational guarantee or support 9/30/20159 – Other: Other infrastructure loans or investments, not classified under the above categories 9/30/2015

AS S.09.01 (201), S.10.01 (201) 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/2015

7/7/20147/7/20147/7/2014

N/A S.07.01 (201), S.10.01 (201) 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/2014

9/30/2015N/A S.07.01 (201) 9/30/2015

9/30/20159/30/2015

N/A S.11.01 (201) 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/2014

Page 765: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014N/A S.08.01 (201) 9/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

N/A S.08.02 (201) 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

AS 9/30/20157/7/2014

9/30/20159/30/2015

TT S.36.01 (201) 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

TT S.36.02 (201) 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

TT S.36.04 (201) 9/30/20157/7/20147/7/20147/7/20147/7/2014

SU 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014

AS SE.06.02 (201) 9/30/2015 12/31/2013Borrower's notes, non-negotiable debt securities and nonnegotiable money market securities 9/30/2015

9/30/2015

Page 766: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other than borrower's notes, non-negotiable debt securities, nonnegotiable money market securities, registered bonds, register 9/30/2015AS 9/30/2015

7/7/20149/30/20159/30/20159/30/20159/30/20159/30/2015

7/7/20149/30/20159/30/20159/30/2015

LB 9/30/20157/7/2014

9/30/20159/30/2015

7/7/20149/30/20159/30/2015

OB 9/30/20157/7/2014 12/31/20137/7/2014

9/30/20159/30/2015 12/31/2013

7/7/2014AS 9/30/2015 9/30/2015

Borrower's notes, registered bonds, registered participation certificates and subscription rights 9/30/2015 9/30/2015Other than borrower's notes, registered bonds, registered participation certificates and subscription rights 9/30/2015 9/30/2015

OB 9/30/20159/30/2015 12/31/20139/30/2015

7/7/20149/30/2015

OB 9/30/20159/30/2015 12/31/2013

7/7/20149/30/2015

OB 9/30/20157/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014

AS 9/30/2015 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/2014

Page 767: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/20159/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/2015AS SE.06.02 (201) 9/30/2015

9/30/20159/30/20159/30/20159/30/2015

SU 9/30/20159/30/2015

7/7/20149/30/20159/30/2015

TT S.06.02 (210), SE.06.02 (21 7/15/20167/7/2014

9/30/20159/30/20157/15/20167/15/20169/30/20157/15/20167/15/20169/30/2015

Page 768: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/20167/15/20169/30/20157/15/20167/15/20167/15/2016

AS 7/15/20167/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/2014

9/30/20159/30/2015 12/31/2013

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/20159/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/2015AS S.02.02 (210) 7/15/2016

7/7/20149/30/2015

Page 769: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20157/7/2014

9/30/2015 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/20159/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/2015GR 7/15/2016

7/7/20147/7/20147/7/2014

7/15/2016

Page 770: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modified date Comment

Page 771: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

Page 772: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

Page 773: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

Page 774: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 775: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/2015

9/30/20159/30/20159/30/2015

Page 776: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

9/30/2015

Page 777: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

Page 778: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

9/30/2015

Page 779: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

Page 780: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

7/15/2017

9/30/2015

Page 781: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 782: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 783: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

Page 784: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

Page 785: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

9/30/2015

Page 786: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerTotal/NA x0 yes s2cA - Agriculture, forestry and fishing A s2cA1 - Crop and animal production, hunting and related service activities A01 s2cA1.1 - Growing of non-perennial crops A011 s2cA1.1.1 - Growing of cereals (except rice), leguminous crops and oil seeds A0111 s2cA1.1.2 - Growing of rice A0112 s2cA1.1.3 - Growing of vegetables and melons, roots and tubers A0113 s2cA1.1.4 - Growing of sugar cane A0114 s2cA1.1.5 - Growing of tobacco A0115 s2cA1.1.6 - Growing of fibre crops A0116 s2cA1.1.9 - Growing of other non-perennial crops A0119 s2cA1.2 - Growing of perennial crops A012 s2cA1.2.1 - Growing of grapes A0121 s2cA1.2.2 - Growing of tropical and subtropical fruits A0122 s2cA1.2.3 - Growing of citrus fruits A0123 s2cA1.2.4 - Growing of pome fruits and stone fruits A0124 s2cA1.2.5 - Growing of other tree and bush fruits and nuts A0125 s2cA1.2.6 - Growing of oleaginous fruits A0126 s2cA1.2.7 - Growing of beverage crops A0127 s2cA1.2.8 - Growing of spices, aromatic, drug and pharmaceutical crops A0128 s2cA1.2.9 - Growing of other perennial crops A0129 s2cA1.3 - Plant propagation A013 s2cA1.3.0 - Plant propagation A0130 s2cA1.4 - Animal production A014 s2cA1.4.1 - Raising of dairy cattle A0141 s2cA1.4.2 - Raising of other cattle and buffaloes A0142 s2cA1.4.3 - Raising of horses and other equines A0143 s2cA1.4.4 - Raising of camels and camelids A0144 s2cA1.4.5 - Raising of sheep and goats A0145 s2cA1.4.6 - Raising of swine/pigs A0146 s2cA1.4.7 - Raising of poultry A0147 s2cA1.4.9 - Raising of other animals A0149 s2cA1.5 - Mixed farming A015 s2cA1.5.0 - Mixed farming A0150 s2cA1.6 - Support activities to agriculture and post-harvest crop activities A016 s2cA1.6.1 - Support activities for crop production A0161 s2cA1.6.2 - Support activities for animal production A0162 s2cA1.6.3 - Post-harvest crop activities A0163 s2cA1.6.4 - Seed processing for propagation A0164 s2cA1.7 - Hunting, trapping and related service activities A017 s2cA1.7.0 - Hunting, trapping and related service activities A0170 s2cA2 - Forestry and logging A02 s2cA2.1 - Silviculture and other forestry activities A021 s2cA2.1.0 - Silviculture and other forestry activities A0210 s2cA2.2 - Logging A022 s2cA2.2.0 - Logging A0220 s2cA2.3 - Gathering of wild growing non-wood products A023 s2cA2.3.0 - Gathering of wild growing non-wood products A0230 s2cA2.4 - Support services to forestry A024 s2cA2.4.0 - Support services to forestry A0240 s2c

Page 787: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

A3 - Fishing and aquaculture A03 s2cA3.1 - Fishing A031 s2cA3.1.1 - Marine fishing A0311 s2cA3.1.2 - Freshwater fishing A0312 s2cA3.2 - Aquaculture A032 s2cA3.2.1 - Marine aquaculture A0321 s2cA3.2.2 - Freshwater aquaculture A0322 s2cB - Mining and quarrying B s2cB5 - Mining of coal and lignite B05 s2cB5.1 - Mining of hard coal B051 s2cB5.1.0 - Mining of hard coal B0510 s2cB5.2 - Mining of lignite B052 s2cB5.2.0 - Mining of lignite B0520 s2cB6 - Extraction of crude petroleum and natural gas B06 s2cB6.1 - Extraction of crude petroleum B061 s2cB6.1.0 - Extraction of crude petroleum B0610 s2cB6.2 - Extraction of natural gas B062 s2cB6.2.0 - Extraction of natural gas B0620 s2cB7 - Mining of metal ores B07 s2cB7.1 - Mining of iron ores B071 s2cB7.1.0 - Mining of iron ores B0710 s2cB7.2 - Mining of non-ferrous metal ores B072 s2cB7.2.1 - Mining of uranium and thorium ores B0721 s2cB7.2.9 - Mining of other non-ferrous metal ores B0729 s2cB8 - Other mining and quarrying B08 s2cB8.1 - Quarrying of stone, sand and clay B081 s2cB8.1.1 - Quarrying of ornamental and building stone, limestone, gypsum, B0811 s2cB8.1.2 - Operation of gravel and sand pits; mining of clays and kaolin B0812 s2cB8.9 - Mining and quarrying n.e.c. B089 s2cB8.9.1 - Mining of chemical and fertiliser minerals B0891 s2cB8.9.2 - Extraction of peat B0892 s2cB8.9.3 - Extraction of salt B0893 s2cB8.9.9 - Other mining and quarrying n.e.c. B0899 s2cB9 - Mining support service activities B09 s2cB9.1 - Support activities for petroleum and natural gas extraction B091 s2cB9.1.0 - Support activities for petroleum and natural gas extraction B0910 s2cB9.9 - Support activities for other mining and quarrying B099 s2cB9.9.0 - Support activities for other mining and quarrying B0990 s2cC - Manufacturing C s2cC10 - Manufacture of food products C10 s2cC10.1 - Processing and preserving of meat and production of meat produC101 s2cC10.1.1 - Processing and preserving of meat C1011 s2cC10.1.2 - Processing and preserving of poultry meat C1012 s2cC10.1.3 - Production of meat and poultry meat products C1013 s2cC10.2 - Processing and preserving of fish, crustaceans and molluscs C102 s2cC10.2.0 - Processing and preserving of fish, crustaceans and molluscs C1020 s2cC10.3 - Processing and preserving of fruit and vegetables C103 s2cC10.3.1 - Processing and preserving of potatoes C1031 s2cC10.3.2 - Manufacture of fruit and vegetable juice C1032 s2cC10.3.9 - Other processing and preserving of fruit and vegetables C1039 s2cC10.4 - Manufacture of vegetable and animal oils and fats C104 s2c

Page 788: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C10.4.1 - Manufacture of oils and fats C1041 s2cC10.4.2 - Manufacture of margarine and similar edible fats C1042 s2cC10.5 - Manufacture of dairy products C105 s2cC10.5.1 - Operation of dairies and cheese making C1051 s2cC10.5.2 - Manufacture of ice cream C1052 s2cC10.6 - Manufacture of grain mill products, starches and starch products C106 s2cC10.6.1 - Manufacture of grain mill products C1061 s2cC10.6.2 - Manufacture of starches and starch products C1062 s2cC10.7 - Manufacture of bakery and farinaceous products C107 s2cC10.7.1 - Manufacture of bread; manufacture of fresh pastry goods and C1071 s2cC10.7.2 - Manufacture of rusks and biscuits; manufacture of preserved p C1072 s2cC10.7.3 - Manufacture of macaroni, noodles, couscous and similar farina C1073 s2cC10.8 - Manufacture of other food products C108 s2cC10.8.1 - Manufacture of sugar C1081 s2cC10.8.2 - Manufacture of cocoa, chocolate and sugar confectionery C1082 s2cC10.8.3 - Processing of tea and coffee C1083 s2cC10.8.4 - Manufacture of condiments and seasonings C1084 s2cC10.8.5 - Manufacture of prepared meals and dishes C1085 s2cC10.8.6 - Manufacture of homogenised food preparations and dietetic f C1086 s2cC10.8.9 - Manufacture of other food products n.e.c. C1089 s2cC10.9 - Manufacture of prepared animal feeds C109 s2cC10.9.1 - Manufacture of prepared feeds for farm animals C1091 s2cC10.9.2 - Manufacture of prepared pet foods C1092 s2cC11 - Manufacture of beverages C11 s2cC11.0 - Manufacture of beverages C110 s2cC11.0.1 - Distilling, rectifying and blending of spirits C1101 s2cC11.0.2 - Manufacture of wine from grape C1102 s2cC11.0.3 - Manufacture of cider and other fruit wines C1103 s2cC11.0.4 - Manufacture of other non-distilled fermented beverages C1104 s2cC11.0.5 - Manufacture of beer C1105 s2cC11.0.6 - Manufacture of malt C1106 s2cC11.0.7 - Manufacture of soft drinks; production of mineral waters and oC1107 s2cC12 - Manufacture of tobacco products C12 s2cC12.0 - Manufacture of tobacco products C120 s2cC12.0.0 - Manufacture of tobacco products C1200 s2cC13 - Manufacture of textiles C13 s2cC13.1 - Preparation and spinning of textile fibres C131 s2cC13.1.0 - Preparation and spinning of textile fibres C1310 s2cC13.2 - Weaving of textiles C132 s2cC13.2.0 - Weaving of textiles C1320 s2cC13.3 - Finishing of textiles C133 s2cC13.3.0 - Finishing of textiles C1330 s2cC13.9 - Manufacture of other textiles C139 s2cC13.9.1 - Manufacture of knitted and crocheted fabrics C1391 s2cC13.9.2 - Manufacture of made-up textile articles, except apparel C1392 s2cC13.9.3 - Manufacture of carpets and rugs C1393 s2cC13.9.4 - Manufacture of cordage, rope, twine and netting C1394 s2cC13.9.5 - Manufacture of non-wovens and articles made from non-wovenC1395 s2cC13.9.6 - Manufacture of other technical and industrial textiles C1396 s2cC13.9.9 - Manufacture of other textiles n.e.c. C1399 s2cC14 - Manufacture of wearing apparel C14 s2c

Page 789: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C14.1 - Manufacture of wearing apparel, except fur apparel C141 s2cC14.1.1 - Manufacture of leather clothes C1411 s2cC14.1.2 - Manufacture of workwear C1412 s2cC14.1.3 - Manufacture of other outerwear C1413 s2cC14.1.4 - Manufacture of underwear C1414 s2cC14.1.9 - Manufacture of other wearing apparel and accessories C1419 s2cC14.2 - Manufacture of articles of fur C142 s2cC14.2.0 - Manufacture of articles of fur C1420 s2cC14.3 - Manufacture of knitted and crocheted apparel C143 s2cC14.3.1 - Manufacture of knitted and crocheted hosiery C1431 s2cC14.3.9 - Manufacture of other knitted and crocheted apparel C1439 s2cC15 - Manufacture of leather and related products C15 s2cC15.1 - Tanning and dressing of leather; manufacture of luggage, handbagC151 s2cC15.1.1 - Tanning and dressing of leather; dressing and dyeing of fur C1511 s2cC15.1.2 - Manufacture of luggage, handbags and the like, saddlery and h C1512 s2cC15.2 - Manufacture of footwear C152 s2cC15.2.0 - Manufacture of footwear C1520 s2cC16 - Manufacture of wood and of products of wood and cork, except furniC16 s2cC16.1 - Sawmilling and planing of wood C161 s2cC16.1.0 - Sawmilling and planing of wood C1610 s2cC16.2 - Manufacture of products of wood, cork, straw and plaiting materiC162 s2cC16.2.1 - Manufacture of veneer sheets and wood-based panels C1621 s2cC16.2.2 - Manufacture of assembled parquet floors C1622 s2cC16.2.3 - Manufacture of other builders' carpentry and joinery C1623 s2cC16.2.4 - Manufacture of wooden containers C1624 s2cC16.2.9 - Manufacture of other products of wood; manufacture of articles C1629 s2cC17 - Manufacture of paper and paper products C17 s2cC17.1 - Manufacture of pulp, paper and paperboard C171 s2cC17.1.1 - Manufacture of pulp C1711 s2cC17.1.2 - Manufacture of paper and paperboard C1712 s2cC17.2 - Manufacture of articles of paper and paperboard C172 s2cC17.2.1 - Manufacture of corrugated paper and paperboard and of contaC1721 s2cC17.2.2 - Manufacture of household and sanitary goods and of toilet requC1722 s2cC17.2.3 - Manufacture of paper stationery C1723 s2cC17.2.4 - Manufacture of wallpaper C1724 s2cC17.2.9 - Manufacture of other articles of paper and paperboard C1729 s2cC18 - Printing and reproduction of recorded media C18 s2cC18.1 - Printing and service activities related to printing C181 s2cC18.1.1 - Printing of newspapers C1811 s2cC18.1.2 - Other printing C1812 s2cC18.1.3 - Pre-press and pre-media services C1813 s2cC18.1.4 - Binding and related services C1814 s2cC18.2 - Reproduction of recorded media C182 s2cC18.2.0 - Reproduction of recorded media C1820 s2cC19 - Manufacture of coke and refined petroleum products C19 s2cC19.1 - Manufacture of coke oven products C191 s2cC19.1.0 - Manufacture of coke oven products C1910 s2cC19.2 - Manufacture of refined petroleum products C192 s2cC19.2.0 - Manufacture of refined petroleum products C1920 s2cC20 - Manufacture of chemicals and chemical products C20 s2cC20.1 - Manufacture of basic chemicals, fertilisers and nitrogen compounC201 s2c

Page 790: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C20.1.1 - Manufacture of industrial gases C2011 s2cC20.1.2 - Manufacture of dyes and pigments C2012 s2cC20.1.3 - Manufacture of other inorganic basic chemicals C2013 s2cC20.1.4 - Manufacture of other organic basic chemicals C2014 s2cC20.1.5 - Manufacture of fertilisers and nitrogen compounds C2015 s2cC20.1.6 - Manufacture of plastics in primary forms C2016 s2cC20.1.7 - Manufacture of synthetic rubber in primary forms C2017 s2cC20.2 - Manufacture of pesticides and other agrochemical products C202 s2cC20.2.0 - Manufacture of pesticides and other agrochemical products C2020 s2cC20.3 - Manufacture of paints, varnishes and similar coatings, printing in C203 s2cC20.3.0 - Manufacture of paints, varnishes and similar coatings, printing C2030 s2cC20.4 - Manufacture of soap and detergents, cleaning and polishing prepC204 s2cC20.4.1 - Manufacture of soap and detergents, cleaning and polishing pr C2041 s2cC20.4.2 - Manufacture of perfumes and toilet preparations C2042 s2cC20.5 - Manufacture of other chemical products C205 s2cC20.5.1 - Manufacture of explosives C2051 s2cC20.5.2 - Manufacture of glues C2052 s2cC20.5.3 - Manufacture of essential oils C2053 s2cC20.5.9 - Manufacture of other chemical products n.e.c. C2059 s2cC20.6 - Manufacture of man-made fibres C206 s2cC20.6.0 - Manufacture of man-made fibres C2060 s2cC21 - Manufacture of basic pharmaceutical products and pharmaceuticalC21 s2cC21.1 - Manufacture of basic pharmaceutical products C211 s2cC21.1.0 - Manufacture of basic pharmaceutical products C2110 s2cC21.2 - Manufacture of pharmaceutical preparations C212 s2cC21.2.0 - Manufacture of pharmaceutical preparations C2120 s2cC22 - Manufacture of rubber and plastic products C22 s2cC22.1 - Manufacture of rubber products C221 s2cC22.1.1 - Manufacture of rubber tyres and tubes; retreading and rebuildiC2211 s2cC22.1.9 - Manufacture of other rubber products C2219 s2cC22.2 - Manufacture of plastics products C222 s2cC22.2.1 - Manufacture of plastic plates, sheets, tubes and profiles C2221 s2cC22.2.2 - Manufacture of plastic packing goods C2222 s2cC22.2.3 - Manufacture of builders’ ware of plastic C2223 s2cC22.2.9 - Manufacture of other plastic products C2229 s2cC23 - Manufacture of other non-metallic mineral products C23 s2cC23.1 - Manufacture of glass and glass products C231 s2cC23.1.1 - Manufacture of flat glass C2311 s2cC23.1.2 - Shaping and processing of flat glass C2312 s2cC23.1.3 - Manufacture of hollow glass C2313 s2cC23.1.4 - Manufacture of glass fibres C2314 s2cC23.1.9 - Manufacture and processing of other glass, including technical C2319 s2cC23.2 - Manufacture of refractory products C232 s2cC23.2.0 - Manufacture of refractory products C2320 s2cC23.3 - Manufacture of clay building materials C233 s2cC23.3.1 - Manufacture of ceramic tiles and flags C2331 s2cC23.3.2 - Manufacture of bricks, tiles and construction products, in bakedC2332 s2cC23.4 - Manufacture of other porcelain and ceramic products C234 s2cC23.4.1 - Manufacture of ceramic household and ornamental articles C2341 s2cC23.4.2 - Manufacture of ceramic sanitary fixtures C2342 s2cC23.4.3 - Manufacture of ceramic insulators and insulating fittings C2343 s2c

Page 791: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C23.4.4 - Manufacture of other technical ceramic products C2344 s2cC23.4.9 - Manufacture of other ceramic products C2349 s2cC23.5 - Manufacture of cement, lime and plaster C235 s2cC23.5.1 - Manufacture of cement C2351 s2cC23.5.2 - Manufacture of lime and plaster C2352 s2cC23.6 - Manufacture of articles of concrete, cement and plaster C236 s2cC23.6.1 - Manufacture of concrete products for construction purposes C2361 s2cC23.6.2 - Manufacture of plaster products for construction purposes C2362 s2cC23.6.3 - Manufacture of ready-mixed concrete C2363 s2cC23.6.4 - Manufacture of mortars C2364 s2cC23.6.5 - Manufacture of fibre cement C2365 s2cC23.6.9 - Manufacture of other articles of concrete, plaster and cement C2369 s2cC23.7 - Cutting, shaping and finishing of stone C237 s2cC23.7.0 - Cutting, shaping and finishing of stone C2370 s2cC23.9 - Manufacture of abrasive products and non-metallic mineral produC239 s2cC23.9.1 - Production of abrasive products C2391 s2cC23.9.9 - Manufacture of other non-metallic mineral products n.e.c. C2399 s2cC24 - Manufacture of basic metals C24 s2cC24.1 - Manufacture of basic iron and steel and of ferro-alloys C241 s2cC24.1.0 - Manufacture of basic iron and steel and of ferro-alloys C2410 s2cC24.2 - Manufacture of tubes, pipes, hollow profiles and related fittings, oC242 s2cC24.2.0 - Manufacture of tubes, pipes, hollow profiles and related fittings,C2420 s2cC24.3 - Manufacture of other products of first processing of steel C243 s2cC24.3.1 - Cold drawing of bars C2431 s2cC24.3.2 - Cold rolling of narrow strip C2432 s2cC24.3.3 - Cold forming or folding C2433 s2cC24.3.4 - Cold drawing of wire C2434 s2cC24.4 - Manufacture of basic precious and other non-ferrous metals C244 s2cC24.4.1 - Precious metals production C2441 s2cC24.4.2 - Aluminium production C2442 s2cC24.4.3 - Lead, zinc and tin production C2443 s2cC24.4.4 - Copper production C2444 s2cC24.4.5 - Other non-ferrous metal production C2445 s2cC24.4.6 - Processing of nuclear fuel C2446 s2cC24.5 - Casting of metals C245 s2cC24.5.1 - Casting of iron C2451 s2cC24.5.2 - Casting of steel C2452 s2cC24.5.3 - Casting of light metals C2453 s2cC24.5.4 - Casting of other non-ferrous metals C2454 s2cC25 - Manufacture of fabricated metal products, except machinery and C25 s2cC25.1 - Manufacture of structural metal products C251 s2cC25.1.1 - Manufacture of metal structures and parts of structures C2511 s2cC25.1.2 - Manufacture of doors and windows of metal C2512 s2cC25.2 - Manufacture of tanks, reservoirs and containers of metal C252 s2cC25.2.1 - Manufacture of central heating radiators and boilers C2521 s2cC25.2.9 - Manufacture of other tanks, reservoirs and containers of metal C2529 s2cC25.3 - Manufacture of steam generators, except central heating hot watC253 s2cC25.3.0 - Manufacture of steam generators, except central heating hot waC2530 s2cC25.4 - Manufacture of weapons and ammunition C254 s2cC25.4.0 - Manufacture of weapons and ammunition C2540 s2cC25.5 - Forging, pressing, stamping and roll-forming of metal; powder meC255 s2c

Page 792: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C25.5.0 - Forging, pressing, stamping and roll-forming of metal; powder C2550 s2cC25.6 - Treatment and coating of metals; machining C256 s2cC25.6.1 - Treatment and coating of metals C2561 s2cC25.6.2 - Machining C2562 s2cC25.7 - Manufacture of cutlery, tools and general hardware C257 s2cC25.7.1 - Manufacture of cutlery C2571 s2cC25.7.2 - Manufacture of locks and hinges C2572 s2cC25.7.3 - Manufacture of tools C2573 s2cC25.9 - Manufacture of other fabricated metal products C259 s2cC25.9.1 - Manufacture of steel drums and similar containers C2591 s2cC25.9.2 - Manufacture of light metal packaging C2592 s2cC25.9.3 - Manufacture of wire products, chain and springs C2593 s2cC25.9.4 - Manufacture of fasteners and screw machine products C2594 s2cC25.9.9 - Manufacture of other fabricated metal products n.e.c. C2599 s2cC26 - Manufacture of computer, electronic and optical products C26 s2cC26.1 - Manufacture of electronic components and boards C261 s2cC26.1.1 - Manufacture of electronic components C2611 s2cC26.1.2 - Manufacture of loaded electronic boards C2612 s2cC26.2 - Manufacture of computers and peripheral equipment C262 s2cC26.2.0 - Manufacture of computers and peripheral equipment C2620 s2cC26.3 - Manufacture of communication equipment C263 s2cC26.3.0 - Manufacture of communication equipment C2630 s2cC26.4 - Manufacture of consumer electronics C264 s2cC26.4.0 - Manufacture of consumer electronics C2640 s2cC26.5 - Manufacture of instruments and appliances for measuring, testinC265 s2cC26.5.1 - Manufacture of instruments and appliances for measuring, testC2651 s2cC26.5.2 - Manufacture of watches and clocks C2652 s2cC26.6 - Manufacture of irradiation, electromedical and electrotherapeut C266 s2cC26.6.0 - Manufacture of irradiation, electromedical and electrotherape C2660 s2cC26.7 - Manufacture of optical instruments and photographic equipmentC267 s2cC26.7.0 - Manufacture of optical instruments and photographic equipmeC2670 s2cC26.8 - Manufacture of magnetic and optical media C268 s2cC26.8.0 - Manufacture of magnetic and optical media C2680 s2cC27 - Manufacture of electrical equipment C27 s2cC27.1 - Manufacture of electric motors, generators, transformers and elecC271 s2cC27.1.1 - Manufacture of electric motors, generators and transformers C2711 s2cC27.1.2 - Manufacture of electricity distribution and control apparatus C2712 s2cC27.2 - Manufacture of batteries and accumulators C272 s2cC27.2.0 - Manufacture of batteries and accumulators C2720 s2cC27.3 - Manufacture of wiring and wiring devices C273 s2cC27.3.1 - Manufacture of fibre optic cables C2731 s2cC27.3.2 - Manufacture of other electronic and electric wires and cables C2732 s2cC27.3.3 - Manufacture of wiring devices C2733 s2cC27.4 - Manufacture of electric lighting equipment C274 s2cC27.4.0 - Manufacture of electric lighting equipment C2740 s2cC27.5 - Manufacture of domestic appliances C275 s2cC27.5.1 - Manufacture of electric domestic appliances C2751 s2cC27.5.2 - Manufacture of non-electric domestic appliances C2752 s2cC27.9 - Manufacture of other electrical equipment C279 s2cC27.9.0 - Manufacture of other electrical equipment C2790 s2cC28 - Manufacture of machinery and equipment n.e.c. C28 s2c

Page 793: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C28.1 - Manufacture of general-purpose machinery C281 s2cC28.1.1 - Manufacture of engines and turbines, except aircraft, vehicle a C2811 s2cC28.1.2 - Manufacture of fluid power equipment C2812 s2cC28.1.3 - Manufacture of other pumps and compressors C2813 s2cC28.1.4 - Manufacture of other taps and valves C2814 s2cC28.1.5 - Manufacture of bearings, gears, gearing and driving elements C2815 s2cC28.2 - Manufacture of other general-purpose machinery C282 s2cC28.2.1 - Manufacture of ovens, furnaces and furnace burners C2821 s2cC28.2.2 - Manufacture of lifting and handling equipment C2822 s2cC28.2.3 - Manufacture of office machinery and equipment (except compuC2823 s2cC28.2.4 - Manufacture of power-driven hand tools C2824 s2cC28.2.5 - Manufacture of non-domestic cooling and ventilation equipme C2825 s2cC28.2.9 - Manufacture of other general-purpose machinery n.e.c. C2829 s2cC28.3 - Manufacture of agricultural and forestry machinery C283 s2cC28.3.0 - Manufacture of agricultural and forestry machinery C2830 s2cC28.4 - Manufacture of metal forming machinery and machine tools C284 s2cC28.4.1 - Manufacture of metal forming machinery C2841 s2cC28.4.9 - Manufacture of other machine tools C2849 s2cC28.9 - Manufacture of other special-purpose machinery C289 s2cC28.9.1 - Manufacture of machinery for metallurgy C2891 s2cC28.9.2 - Manufacture of machinery for mining, quarrying and constructiC2892 s2cC28.9.3 - Manufacture of machinery for food, beverage and tobacco procC2893 s2cC28.9.4 - Manufacture of machinery for textile, apparel and leather prodC2894 s2cC28.9.5 - Manufacture of machinery for paper and paperboard productioC2895 s2cC28.9.6 - Manufacture of plastics and rubber machinery C2896 s2cC28.9.9 - Manufacture of other special-purpose machinery n.e.c. C2899 s2cC29 - Manufacture of motor vehicles, trailers and semi-trailers C29 s2cC29.1 - Manufacture of motor vehicles C291 s2cC29.1.0 - Manufacture of motor vehicles C2910 s2cC29.2 - Manufacture of bodies (coachwork) for motor vehicles; manufacturC292 s2cC29.2.0 - Manufacture of bodies (coachwork) for motor vehicles; manufactC2920 s2cC29.3 - Manufacture of parts and accessories for motor vehicles C293 s2cC29.3.1 - Manufacture of electrical and electronic equipment for motor vC2931 s2cC29.3.2 - Manufacture of other parts and accessories for motor vehicles C2932 s2cC30 - Manufacture of other transport equipment C30 s2cC30.1 - Building of ships and boats C301 s2cC30.1.1 - Building of ships and floating structures C3011 s2cC30.1.2 - Building of pleasure and sporting boats C3012 s2cC30.2 - Manufacture of railway locomotives and rolling stock C302 s2cC30.2.0 - Manufacture of railway locomotives and rolling stock C3020 s2cC30.3 - Manufacture of air and spacecraft and related machinery C303 s2cC30.3.0 - Manufacture of air and spacecraft and related machinery C3030 s2cC30.4 - Manufacture of military fighting vehicles C304 s2cC30.4.0 - Manufacture of military fighting vehicles C3040 s2cC30.9 - Manufacture of transport equipment n.e.c. C309 s2cC30.9.1 - Manufacture of motorcycles C3091 s2cC30.9.2 - Manufacture of bicycles and invalid carriages C3092 s2cC30.9.9 - Manufacture of other transport equipment n.e.c. C3099 s2cC31 - Manufacture of furniture C31 s2cC31.0 - Manufacture of furniture C310 s2cC31.0.1 - Manufacture of office and shop furniture C3101 s2c

Page 794: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C31.0.2 - Manufacture of kitchen furniture C3102 s2cC31.0.3 - Manufacture of mattresses C3103 s2cC31.0.9 - Manufacture of other furniture C3109 s2cC32 - Other manufacturing C32 s2cC32.1 - Manufacture of jewellery, bijouterie and related articles C321 s2cC32.1.1 - Striking of coins C3211 s2cC32.1.2 - Manufacture of jewellery and related articles C3212 s2cC32.1.3 - Manufacture of imitation jewellery and related articles C3213 s2cC32.2 - Manufacture of musical instruments C322 s2cC32.2.0 - Manufacture of musical instruments C3220 s2cC32.3 - Manufacture of sports goods C323 s2cC32.3.0 - Manufacture of sports goods C3230 s2cC32.4 - Manufacture of games and toys C324 s2cC32.4.0 - Manufacture of games and toys C3240 s2cC32.5 - Manufacture of medical and dental instruments and supplies C325 s2cC32.5.0 - Manufacture of medical and dental instruments and supplies C3250 s2cC32.9 - Manufacturing n.e.c. C329 s2cC32.9.1 - Manufacture of brooms and brushes C3291 s2cC32.9.9 - Other manufacturing n.e.c. C3299 s2cC33 - Repair and installation of machinery and equipment C33 s2cC33.1 - Repair of fabricated metal products, machinery and equipment C331 s2cC33.1.1 - Repair of fabricated metal products C3311 s2cC33.1.2 - Repair of machinery C3312 s2cC33.1.3 - Repair of electronic and optical equipment C3313 s2cC33.1.4 - Repair of electrical equipment C3314 s2cC33.1.5 - Repair and maintenance of ships and boats C3315 s2cC33.1.6 - Repair and maintenance of aircraft and spacecraft C3316 s2cC33.1.7 - Repair and maintenance of other transport equipment C3317 s2cC33.1.9 - Repair of other equipment C3319 s2cC33.2 - Installation of industrial machinery and equipment C332 s2cC33.2.0 - Installation of industrial machinery and equipment C3320 s2cD - Electricity, gas, steam and air conditioning supply D s2cD35 - Electricity, gas, steam and air conditioning supply D35 s2cD35.1 - Electric power generation, transmission and distribution D351 s2cD35.1.1 - Production of electricity D3511 s2cD35.1.2 - Transmission of electricity D3512 s2cD35.1.3 - Distribution of electricity D3513 s2cD35.1.4 - Trade of electricity D3514 s2cD35.2 - Manufacture of gas; distribution of gaseous fuels through mains D352 s2cD35.2.1 - Manufacture of gas D3521 s2cD35.2.2 - Distribution of gaseous fuels through mains D3522 s2cD35.2.3 - Trade of gas through mains D3523 s2cD35.3 - Steam and air conditioning supply D353 s2cD35.3.0 - Steam and air conditioning supply D3530 s2cE - Water supply; sewerage; waste managment and remediation activitieE s2cE36 - Water collection, treatment and supply E36 s2cE36.0 - Water collection, treatment and supply E360 s2cE36.0.0 - Water collection, treatment and supply E3600 s2cE37 - Sewerage E37 s2cE37.0 - Sewerage E370 s2cE37.0.0 - Sewerage E3700 s2c

Page 795: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

E38 - Waste collection, treatment and disposal activities; materials recovE38 s2cE38.1 - Waste collection E381 s2cE38.1.1 - Collection of non-hazardous waste E3811 s2cE38.1.2 - Collection of hazardous waste E3812 s2cE38.2 - Waste treatment and disposal E382 s2cE38.2.1 - Treatment and disposal of non-hazardous waste E3821 s2cE38.2.2 - Treatment and disposal of hazardous waste E3822 s2cE38.3 - Materials recovery E383 s2cE38.3.1 - Dismantling of wrecks E3831 s2cE38.3.2 - Recovery of sorted materials E3832 s2cE39 - Remediation activities and other waste management services E39 s2cE39.0 - Remediation activities and other waste management services E390 s2cE39.0.0 - Remediation activities and other waste management services E3900 s2cF - Construction F s2cF41 - Construction of buildings F41 s2cF41.1 - Development of building projects F411 s2cF41.1.0 - Development of building projects F4110 s2cF41.2 - Construction of residential and non-residential buildings F412 s2cF41.2.0 - Construction of residential and non-residential buildings F4120 s2cF42 - Civil engineering F42 s2cF42.1 - Construction of roads and railways F421 s2cF42.1.1 - Construction of roads and motorways F4211 s2cF42.1.2 - Construction of railways and underground railways F4212 s2cF42.1.3 - Construction of bridges and tunnels F4213 s2cF42.2 - Construction of utility projects F422 s2cF42.2.1 - Construction of utility projects for fluids F4221 s2cF42.2.2 - Construction of utility projects for electricity and telecommunicF4222 s2cF42.9 - Construction of other civil engineering projects F429 s2cF42.9.1 - Construction of water projects F4291 s2cF42.9.9 - Construction of other civil engineering projects n.e.c. F4299 s2cF43 - Specialised construction activities F43 s2cF43.1 - Demolition and site preparation F431 s2cF43.1.1 - Demolition F4311 s2cF43.1.2 - Site preparation F4312 s2cF43.1.3 - Test drilling and boring F4313 s2cF43.2 - Electrical, plumbing and other construction installation activities F432 s2cF43.2.1 - Electrical installation F4321 s2cF43.2.2 - Plumbing, heat and air-conditioning installation F4322 s2cF43.2.9 - Other construction installation F4329 s2cF43.3 - Building completion and finishing F433 s2cF43.3.1 - Plastering F4331 s2cF43.3.2 - Joinery installation F4332 s2cF43.3.3 - Floor and wall covering F4333 s2cF43.3.4 - Painting and glazing F4334 s2cF43.3.9 - Other building completion and finishing F4339 s2cF43.9 - Other specialised construction activities F439 s2cF43.9.1 - Roofing activities F4391 s2cF43.9.9 - Other specialised construction activities n.e.c. F4399 s2cG - Wholesale and retail trade; repair of motor vehicles and motorcycles G s2cG45 - Wholesale and retail trade and repair of motor vehicles and motorcG45 s2cG45.1 - Sale of motor vehicles G451 s2c

Page 796: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

G45.1.1 - Sale of cars and light motor vehicles G4511 s2cG45.1.9 - Sale of other motor vehicles G4519 s2cG45.2 - Maintenance and repair of motor vehicles G452 s2cG45.2.0 - Maintenance and repair of motor vehicles G4520 s2cG45.3 - Sale of motor vehicle parts and accessories G453 s2cG45.3.1 - Wholesale trade of motor vehicle parts and accessories G4531 s2cG45.3.2 - Retail trade of motor vehicle parts and accessories G4532 s2cG45.4 - Sale, maintenance and repair of motorcycles and related parts anG454 s2cG45.4.0 - Sale, maintenance and repair of motorcycles and related parts G4540 s2cG46 - Wholesale trade, except of motor vehicles and motorcycles G46 s2cG46.1 - Wholesale on a fee or contract basis G461 s2cG46.1.1 - Agents involved in the sale of agricultural raw materials, live a G4611 s2cG46.1.2 - Agents involved in the sale of fuels, ores, metals and industrial G4612 s2cG46.1.3 - Agents involved in the sale of timber and building materials G4613 s2cG46.1.4 - Agents involved in the sale of machinery, industrial equipment, G4614 s2cG46.1.5 - Agents involved in the sale of furniture, household goods, ha G4615 s2cG46.1.6 - Agents involved in the sale of textiles, clothing, fur, footwear G4616 s2cG46.1.7 - Agents involved in the sale of food, beverages and tobacco G4617 s2cG46.1.8 - Agents specialised in the sale of other particular products G4618 s2cG46.1.9 - Agents involved in the sale of a variety of goods G4619 s2cG46.2 - Wholesale of agricultural raw materials and live animals G462 s2cG46.2.1 - Wholesale of grain, unmanufactured tobacco, seeds and animalG4621 s2cG46.2.2 - Wholesale of flowers and plants G4622 s2cG46.2.3 - Wholesale of live animals G4623 s2cG46.2.4 - Wholesale of hides, skins and leather G4624 s2cG46.3 - Wholesale of food, beverages and tobacco G463 s2cG46.3.1 - Wholesale of fruit and vegetables G4631 s2cG46.3.2 - Wholesale of meat and meat products G4632 s2cG46.3.3 - Wholesale of dairy products, eggs and edible oils and fats G4633 s2cG46.3.4 - Wholesale of beverages G4634 s2cG46.3.5 - Wholesale of tobacco products G4635 s2cG46.3.6 - Wholesale of sugar and chocolate and sugar confectionery G4636 s2cG46.3.7 - Wholesale of coffee, tea, cocoa and spices G4637 s2cG46.3.8 - Wholesale of other food, including fish, crustaceans and mollusG4638 s2cG46.3.9 - Non-specialised wholesale of food, beverages and tobacco G4639 s2cG46.4 - Wholesale of household goods G464 s2cG46.4.1 - Wholesale of textiles G4641 s2cG46.4.2 - Wholesale of clothing and footwear G4642 s2cG46.4.3 - Wholesale of electrical household appliances G4643 s2cG46.4.4 - Wholesale of china and glassware and cleaning materials G4644 s2cG46.4.5 - Wholesale of perfume and cosmetics G4645 s2cG46.4.6 - Wholesale of pharmaceutical goods G4646 s2cG46.4.7 - Wholesale of furniture, carpets and lighting equipment G4647 s2cG46.4.8 - Wholesale of watches and jewellery G4648 s2cG46.4.9 - Wholesale of other household goods G4649 s2cG46.5 - Wholesale of information and communication equipment G465 s2cG46.5.1 - Wholesale of computers, computer peripheral equipment and G4651 s2cG46.5.2 - Wholesale of electronic and telecommunications equipment anG4652 s2cG46.6 - Wholesale of other machinery, equipment and supplies G466 s2cG46.6.1 - Wholesale of agricultural machinery, equipment and supplies G4661 s2cG46.6.2 - Wholesale of machine tools G4662 s2c

Page 797: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

G46.6.3 - Wholesale of mining, construction and civil engineering machinG4663 s2cG46.6.4 - Wholesale of machinery for the textile industry and of sewing G4664 s2cG46.6.5 - Wholesale of office furniture G4665 s2cG46.6.6 - Wholesale of other office machinery and equipment G4666 s2cG46.6.9 - Wholesale of other machinery and equipment G4669 s2cG46.7 - Other specialised wholesale G467 s2cG46.7.1 - Wholesale of solid, liquid and gaseous fuels and related producG4671 s2cG46.7.2 - Wholesale of metals and metal ores G4672 s2cG46.7.3 - Wholesale of wood, construction materials and sanitary equip G4673 s2cG46.7.4 - Wholesale of hardware, plumbing and heating equipment and sG4674 s2cG46.7.5 - Wholesale of chemical products G4675 s2cG46.7.6 - Wholesale of other intermediate products G4676 s2cG46.7.7 - Wholesale of waste and scrap G4677 s2cG46.9 - Non-specialised wholesale trade G469 s2cG46.9.0 - Non-specialised wholesale trade G4690 s2cG47 - Retail trade, except of motor vehicles and motorcycles G47 s2cG47.1 - Retail sale in non-specialised stores G471 s2cG47.1.1 - Retail sale in non-specialised stores with food, beverages or t G4711 s2cG47.1.9 - Other retail sale in non-specialised stores G4719 s2cG47.2 - Retail sale of food, beverages and tobacco in specialised stores G472 s2cG47.2.1 - Retail sale of fruit and vegetables in specialised stores G4721 s2cG47.2.2 - Retail sale of meat and meat products in specialised stores G4722 s2cG47.2.3 - Retail sale of fish, crustaceans and molluscs in specialised storeG4723 s2cG47.2.4 - Retail sale of bread, cakes, flour confectionery and sugar confecG4724 s2cG47.2.5 - Retail sale of beverages in specialised stores G4725 s2cG47.2.6 - Retail sale of tobacco products in specialised stores G4726 s2cG47.2.9 - Other retail sale of food in specialised stores G4729 s2cG47.3 - Retail sale of automotive fuel in specialised stores G473 s2cG47.3.0 - Retail sale of automotive fuel in specialised stores G4730 s2cG47.4 - Retail sale of information and communication equipment in speciG474 s2cG47.4.1 - Retail sale of computers, peripheral units and software in speci G4741 s2cG47.4.2 - Retail sale of telecommunications equipment in specialised sto G4742 s2cG47.4.3 - Retail sale of audio and video equipment in specialised stores G4743 s2cG47.5 - Retail sale of other household equipment in specialised stores G475 s2cG47.5.1 - Retail sale of textiles in specialised stores G4751 s2cG47.5.2 - Retail sale of hardware, paints and glass in specialised stores G4752 s2cG47.5.3 - Retail sale of carpets, rugs, wall and floor coverings in specialis G4753 s2cG47.5.4 - Retail sale of electrical household appliances in specialised storG4754 s2cG47.5.9 - Retail sale of furniture, lighting equipment and other household G4759 s2cG47.6 - Retail sale of cultural and recreation goods in specialised stores G476 s2cG47.6.1 - Retail sale of books in specialised stores G4761 s2cG47.6.2 - Retail sale of newspapers and stationery in specialised stores G4762 s2cG47.6.3 - Retail sale of music and video recordings in specialised stores G4763 s2cG47.6.4 - Retail sale of sporting equipment in specialised stores G4764 s2cG47.6.5 - Retail sale of games and toys in specialised stores G4765 s2cG47.7 - Retail sale of other goods in specialised stores G477 s2cG47.7.1 - Retail sale of clothing in specialised stores G4771 s2cG47.7.2 - Retail sale of footwear and leather goods in specialised stores G4772 s2cG47.7.3 - Dispensing chemist in specialised stores G4773 s2cG47.7.4 - Retail sale of medical and orthopaedic goods in specialised storG4774 s2cG47.7.5 - Retail sale of cosmetic and toilet articles in specialised stores G4775 s2c

Page 798: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

G47.7.6 - Retail sale of flowers, plants, seeds, fertilisers, pet animals and G4776 s2cG47.7.7 - Retail sale of watches and jewellery in specialised stores G4777 s2cG47.7.8 - Other retail sale of new goods in specialised stores G4778 s2cG47.7.9 - Retail sale of second-hand goods in stores G4779 s2cG47.8 - Retail sale via stalls and markets G478 s2cG47.8.1 - Retail sale via stalls and markets of food, beverages and tobac G4781 s2cG47.8.2 - Retail sale via stalls and markets of textiles, clothing and footw G4782 s2cG47.8.9 - Retail sale via stalls and markets of other goods G4789 s2cG47.9 - Retail trade not in stores, stalls or markets G479 s2cG47.9.1 - Retail sale via mail order houses or via Internet G4791 s2cG47.9.9 - Other retail sale not in stores, stalls or markets G4799 s2cH - Transporting and storage H s2cH49 - Land transport and transport via pipelines H49 s2cH49.1 - Passenger rail transport, interurban H491 s2cH49.1.0 - Passenger rail transport, interurban H4910 s2cH49.2 - Freight rail transport H492 s2cH49.2.0 - Freight rail transport H4920 s2cH49.3 - Other passenger land transport H493 s2cH49.3.1 - Urban and suburban passenger land transport H4931 s2cH49.3.2 - Taxi operation H4932 s2cH49.3.9 - Other passenger land transport n.e.c. H4939 s2cH49.4 - Freight transport by road and removal services H494 s2cH49.4.1 - Freight transport by road H4941 s2cH49.4.2 - Removal services H4942 s2cH49.5 - Transport via pipeline H495 s2cH49.5.0 - Transport via pipeline H4950 s2cH50 - Water transport H50 s2cH50.1 - Sea and coastal passenger water transport H501 s2cH50.1.0 - Sea and coastal passenger water transport H5010 s2cH50.2 - Sea and coastal freight water transport H502 s2cH50.2.0 - Sea and coastal freight water transport H5020 s2cH50.3 - Inland passenger water transport H503 s2cH50.3.0 - Inland passenger water transport H5030 s2cH50.4 - Inland freight water transport H504 s2cH50.4.0 - Inland freight water transport H5040 s2cH51 - Air transport H51 s2cH51.1 - Passenger air transport H511 s2cH51.1.0 - Passenger air transport H5110 s2cH51.2 - Freight air transport and space transport H512 s2cH51.2.1 - Freight air transport H5121 s2cH51.2.2 - Space transport H5122 s2cH52 - Warehousing and support activities for transportation H52 s2cH52.1 - Warehousing and storage H521 s2cH52.1.0 - Warehousing and storage H5210 s2cH52.2 - Support activities for transportation H522 s2cH52.2.1 - Service activities incidental to land transportation H5221 s2cH52.2.2 - Service activities incidental to water transportation H5222 s2cH52.2.3 - Service activities incidental to air transportation H5223 s2cH52.2.4 - Cargo handling H5224 s2cH52.2.9 - Other transportation support activities H5229 s2cH53 - Postal and courier activities H53 s2c

Page 799: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

H53.1 - Postal activities under universal service obligation H531 s2cH53.1.0 - Postal activities under universal service obligation H5310 s2cH53.2 - Other postal and courier activities H532 s2cH53.2.0 - Other postal and courier activities H5320 s2cI - Accommodation and food service activities I s2cI55 - Accommodation I55 s2cI55.1 - Hotels and similar accommodation I551 s2cI55.1.0 - Hotels and similar accommodation I5510 s2cI55.2 - Holiday and other short-stay accommodation I552 s2cI55.2.0 - Holiday and other short-stay accommodation I5520 s2cI55.3 - Camping grounds, recreational vehicle parks and trailer parks I553 s2cI55.3.0 - Camping grounds, recreational vehicle parks and trailer parks I5530 s2cI55.9 - Other accommodation I559 s2cI55.9.0 - Other accommodation I5590 s2cI56 - Food and beverage service activities I56 s2cI56.1 - Restaurants and mobile food service activities I561 s2cI56.1.0 - Restaurants and mobile food service activities I5610 s2cI56.2 - Event catering and other food service activities I562 s2cI56.2.1 - Event catering activities I5621 s2cI56.2.9 - Other food service activities I5629 s2cI56.3 - Beverage serving activities I563 s2cI56.3.0 - Beverage serving activities I5630 s2cJ - Information and communication J s2cJ58 - Publishing activities J58 s2cJ58.1 - Publishing of books, periodicals and other publishing activities J581 s2cJ58.1.1 - Book publishing J5811 s2cJ58.1.2 - Publishing of directories and mailing lists J5812 s2cJ58.1.3 - Publishing of newspapers J5813 s2cJ58.1.4 - Publishing of journals and periodicals J5814 s2cJ58.1.9 - Other publishing activities J5819 s2cJ58.2 - Software publishing J582 s2cJ58.2.1 - Publishing of computer games J5821 s2cJ58.2.9 - Other software publishing J5829 s2cJ59 - Motion picture, video and television programme production, sound rJ59 s2cJ59.1 - Motion picture, video and television programme activities J591 s2cJ59.1.1 - Motion picture, video and television programme production actiJ5911 s2cJ59.1.2 - Motion picture, video and television programme post-productionJ5912 s2cJ59.1.3 - Motion picture, video and television programme distribution actiJ5913 s2cJ59.1.4 - Motion picture projection activities J5914 s2cJ59.2 - Sound recording and music publishing activities J592 s2cJ59.2.0 - Sound recording and music publishing activities J5920 s2cJ60 - Programming and broadcasting activities J60 s2cJ60.1 - Radio broadcasting J601 s2cJ60.1.0 - Radio broadcasting J6010 s2cJ60.2 - Television programming and broadcasting activities J602 s2cJ60.2.0 - Television programming and broadcasting activities J6020 s2cJ61 - Telecommunications J61 s2cJ61.1 - Wired telecommunications activities J611 s2cJ61.1.0 - Wired telecommunications activities J6110 s2cJ61.2 - Wireless telecommunications activities J612 s2cJ61.2.0 - Wireless telecommunications activities J6120 s2c

Page 800: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

J61.3 - Satellite telecommunications activities J613 s2cJ61.3.0 - Satellite telecommunications activities J6130 s2cJ61.9 - Other telecommunications activities J619 s2cJ61.9.0 - Other telecommunications activities J6190 s2cJ62 - Computer programming, consultancy and related activities J62 s2cJ62.0 - Computer programming, consultancy and related activities J620 s2cJ62.0.1 - Computer programming activities J6201 s2cJ62.0.2 - Computer consultancy activities J6202 s2cJ62.0.3 - Computer facilities management activities J6203 s2cJ62.0.9 - Other information technology and computer service activities J6209 s2cJ63 - Information service activities J63 s2cJ63.1 - Data processing, hosting and related activities; web portals J631 s2cJ63.1.1 - Data processing, hosting and related activities J6311 s2cJ63.1.2 - Web portals J6312 s2cJ63.9 - Other information service activities J639 s2cJ63.9.1 - News agency activities J6391 s2cJ63.9.9 - Other information service activities n.e.c. J6399 s2cK - Financial and insurance activities K s2cK64 - Financial service activities, except insurance and pension funding K64 s2cK64.1 - Monetary intermediation K641 s2cK64.1.1 - Central banking K6411 s2cK64.1.9 - Other monetary intermediation K6419 s2cK64.2 - Activities of holding companies K642 s2cK64.2.0 - Activities of holding companies K6420 s2cK64.3 - Trusts, funds and similar financial entities K643 s2cK64.3.0 - Trusts, funds and similar financial entities K6430 s2cK64.9 - Other financial service activities, except insurance and pension f K649 s2cK64.9.1 - Financial leasing K6491 s2cK64.9.2 - Other credit granting K6492 s2cK64.9.9 - Other financial service activities, except insurance and pension K6499 s2cK65 - Insurance, reinsurance and pension funding, except compulsory sociK65 s2cK65.1 - Insurance K651 s2cK65.1.1 - Life insurance K6511 s2cK65.1.2 - Non-life insurance K6512 s2cK65.2 - Reinsurance K652 s2cK65.2.0 - Reinsurance K6520 s2cK65.3 - Pension funding K653 s2cK65.3.0 - Pension funding K6530 s2cK66 - Activities auxiliary to financial services and insurance activities K66 s2cK66.1 - Activities auxiliary to financial services, except insurance and pe K661 s2cK66.1.1 - Administration of financial markets K6611 s2cK66.1.2 - Security and commodity contracts brokerage K6612 s2cK66.1.9 - Other activities auxiliary to financial services, except insuranc K6619 s2cK66.2 - Activities auxiliary to insurance and pension funding K662 s2cK66.2.1 - Risk and damage evaluation K6621 s2cK66.2.2 - Activities of insurance agents and brokers K6622 s2cK66.2.9 - Other activities auxiliary to insurance and pension funding K6629 s2cK66.3 - Fund management activities K663 s2cK66.3.0 - Fund management activities K6630 s2cL - Real estate activities L s2cL68 - Real estate activities L68 s2c

Page 801: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

L68.1 - Buying and selling of own real estate L681 s2cL68.1.0 - Buying and selling of own real estate L6810 s2cL68.2 - Renting and operating of own or leased real estate L682 s2cL68.2.0 - Renting and operating of own or leased real estate L6820 s2cL68.3 - Real estate activities on a fee or contract basis L683 s2cL68.3.1 - Real estate agencies L6831 s2cL68.3.2 - Management of real estate on a fee or contract basis L6832 s2cM - Professional, scientific and technical activities M s2cM69 - Legal and accounting activities M69 s2cM69.1 - Legal activities M691 s2cM69.1.0 - Legal activities M6910 s2cM69.2 - Accounting, bookkeeping and auditing activities; tax consultancyM692 s2cM69.2.0 - Accounting, bookkeeping and auditing activities; tax consultan M6920 s2cM70 - Activities of head offices; management consultancy activities M70 s2cM70.1 - Activities of head offices M701 s2cM70.1.0 - Activities of head offices M7010 s2cM70.2 - Management consultancy activities M702 s2cM70.2.1 - Public relations and communication activities M7021 s2cM70.2.2 - Business and other management consultancy activities M7022 s2cM71 - Architectural and engineering activities; technical testing and analyM71 s2cM71.1 - Architectural and engineering activities and related technical co M711 s2cM71.1.1 - Architectural activities M7111 s2cM71.1.2 - Engineering activities and related technical consultancy M7112 s2cM71.2 - Technical testing and analysis M712 s2cM71.2.0 - Technical testing and analysis M7120 s2cM72 - Scientific research and development M72 s2cM72.1 - Research and experimental development on natural sciences an M721 s2cM72.1.1 - Research and experimental development on biotechnology M7211 s2cM72.1.9 - Other research and experimental development on natural scie M7219 s2cM72.2 - Research and experimental development on social sciences and M722 s2cM72.2.0 - Research and experimental development on social sciences anM7220 s2cM73 - Advertising and market research M73 s2cM73.1 - Advertising M731 s2cM73.1.1 - Advertising agencies M7311 s2cM73.1.2 - Media representation M7312 s2cM73.2 - Market research and public opinion polling M732 s2cM73.2.0 - Market research and public opinion polling M7320 s2cM74 - Other professional, scientific and technical activities M74 s2cM74.1 - Specialised design activities M741 s2cM74.1.0 - Specialised design activities M7410 s2cM74.2 - Photographic activities M742 s2cM74.2.0 - Photographic activities M7420 s2cM74.3 - Translation and interpretation activities M743 s2cM74.3.0 - Translation and interpretation activities M7430 s2cM74.9 - Other professional, scientific and technical activities n.e.c. M749 s2cM74.9.0 - Other professional, scientific and technical activities n.e.c. M7490 s2cM75 - Veterinary activities M75 s2cM75.0 - Veterinary activities M750 s2cM75.0.0 - Veterinary activities M7500 s2cN - Administrative and support service activities N s2cN77 - Rental and leasing activities N77 s2c

Page 802: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

N77.1 - Renting and leasing of motor vehicles N771 s2cN77.1.1 - Renting and leasing of cars and light motor vehicles N7711 s2cN77.1.2 - Renting and leasing of trucks N7712 s2cN77.2 - Renting and leasing of personal and household goods N772 s2cN77.2.1 - Renting and leasing of recreational and sports goods N7721 s2cN77.2.2 - Renting of video tapes and disks N7722 s2cN77.2.9 - Renting and leasing of other personal and household goods N7729 s2cN77.3 - Renting and leasing of other machinery, equipment and tangible N773 s2cN77.3.1 - Renting and leasing of agricultural machinery and equipment N7731 s2cN77.3.2 - Renting and leasing of construction and civil engineering mac N7732 s2cN77.3.3 - Renting and leasing of office machinery and equipment (includ N7733 s2cN77.3.4 - Renting and leasing of water transport equipment N7734 s2cN77.3.5 - Renting and leasing of air transport equipment N7735 s2cN77.3.9 - Renting and leasing of other machinery, equipment and tangiblN7739 s2cN77.4 - Leasing of intellectual property and similar products, except cop N774 s2cN77.4.0 - Leasing of intellectual property and similar products, except c N7740 s2cN78 - Employment activities N78 s2cN78.1 - Activities of employment placement agencies N781 s2cN78.1.0 - Activities of employment placement agencies N7810 s2cN78.2 - Temporary employment agency activities N782 s2cN78.2.0 - Temporary employment agency activities N7820 s2cN78.3 - Other human resources provision N783 s2cN78.3.0 - Other human resources provision N7830 s2cN79 - Travel agency, tour operator and other reservation service and relatN79 s2cN79.1 - Travel agency and tour operator activities N791 s2cN79.1.1 - Travel agency activities N7911 s2cN79.1.2 - Tour operator activities N7912 s2cN79.9 - Other reservation service and related activities N799 s2cN79.9.0 - Other reservation service and related activities N7990 s2cN80 - Security and investigation activities N80 s2cN80.1 - Private security activities N801 s2cN80.1.0 - Private security activities N8010 s2cN80.2 - Security systems service activities N802 s2cN80.2.0 - Security systems service activities N8020 s2cN80.3 - Investigation activities N803 s2cN80.3.0 - Investigation activities N8030 s2cN81 - Services to buildings and landscape activities N81 s2cN81.1 - Combined facilities support activities N811 s2cN81.1.0 - Combined facilities support activities N8110 s2cN81.2 - Cleaning activities N812 s2cN81.2.1 - General cleaning of buildings N8121 s2cN81.2.2 - Other building and industrial cleaning activities N8122 s2cN81.2.9 - Other cleaning activities N8129 s2cN81.3 - Landscape service activities N813 s2cN81.3.0 - Landscape service activities N8130 s2cN82 - Office administrative, office support and other business support actN82 s2cN82.1 - Office administrative and support activities N821 s2cN82.1.1 - Combined office administrative service activities N8211 s2cN82.1.9 - Photocopying, document preparation and other specialised officN8219 s2cN82.2 - Activities of call centres N822 s2cN82.2.0 - Activities of call centres N8220 s2c

Page 803: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

N82.3 - Organisation of conventions and trade shows N823 s2cN82.3.0 - Organisation of conventions and trade shows N8230 s2cN82.9 - Business support service activities n.e.c. N829 s2cN82.9.1 - Activities of collection agencies and credit bureaus N8291 s2cN82.9.2 - Packaging activities N8292 s2cN82.9.9 - Other business support service activities n.e.c. N8299 s2cO - Public administration and defence; compulsory social security O s2cO84 - Public administration and defence; compulsory social security O84 s2cO84.1 - Administration of the State and the economic and social policy O841 s2cO84.1.1 - General public administration activities O8411 s2cO84.1.2 - Regulation of the activities of providing health care, education, O8412 s2cO84.1.3 - Regulation of and contribution to more efficient operation of b O8413 s2cO84.2 - Provision of services to the community as a whole O842 s2cO84.2.1 - Foreign affairs O8421 s2cO84.2.2 - Defence activities O8422 s2cO84.2.3 - Justice and judicial activities O8423 s2cO84.2.4 - Public order and safety activities O8424 s2cO84.2.5 - Fire service activities O8425 s2cO84.3 - Compulsory social security activities O843 s2cO84.3.0 - Compulsory social security activities O8430 s2cP - Education P s2cP85 - Education P85 s2cP85.1 - Pre-primary education P851 s2cP85.1.0 - Pre-primary education P8510 s2cP85.2 - Primary education P852 s2cP85.2.0 - Primary education P8520 s2cP85.3 - Secondary education P853 s2cP85.3.1 - General secondary education P8531 s2cP85.3.2 - Technical and vocational secondary education P8532 s2cP85.4 - Higher education P854 s2cP85.4.1 - Post-secondary non-tertiary education P8541 s2cP85.4.2 - Tertiary education P8542 s2cP85.5 - Other education P855 s2cP85.5.1 - Sports and recreation education P8551 s2cP85.5.2 - Cultural education P8552 s2cP85.5.3 - Driving school activities P8553 s2cP85.5.9 - Other education n.e.c. P8559 s2cP85.6 - Educational support activities P856 s2cP85.6.0 - Educational support activities P8560 s2cQ - Human health and social work activities Q s2cQ86 - Human health activities Q86 s2cQ86.1 - Hospital activities Q861 s2cQ86.1.0 - Hospital activities Q8610 s2cQ86.2 - Medical and dental practice activities Q862 s2cQ86.2.1 - General medical practice activities Q8621 s2cQ86.2.2 - Specialist medical practice activities Q8622 s2cQ86.2.3 - Dental practice activities Q8623 s2cQ86.9 - Other human health activities Q869 s2cQ86.9.0 - Other human health activities Q8690 s2cQ87 - Residential care activities Q87 s2cQ87.1 - Residential nursing care activities Q871 s2c

Page 804: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Q87.1.0 - Residential nursing care activities Q8710 s2cQ87.2 - Residential care activities for mental retardation, mental health Q872 s2cQ87.2.0 - Residential care activities for mental retardation, mental heal Q8720 s2cQ87.3 - Residential care activities for the elderly and disabled Q873 s2cQ87.3.0 - Residential care activities for the elderly and disabled Q8730 s2cQ87.9 - Other residential care activities Q879 s2cQ87.9.0 - Other residential care activities Q8790 s2cQ88 - Social work activities without accommodation Q88 s2cQ88.1 - Social work activities without accommodation for the elderly andQ881 s2cQ88.1.0 - Social work activities without accommodation for the elderly a Q8810 s2cQ88.9 - Other social work activities without accommodation Q889 s2cQ88.9.1 - Child day-care activities Q8891 s2cQ88.9.9 - Other social work activities without accommodation n.e.c. Q8899 s2cR - Arts, entertainment and recreation R s2cR90 - Creative, arts and entertainment activities R90 s2cR90.0 - Creative, arts and entertainment activities R900 s2cR90.0.1 - Performing arts R9001 s2cR90.0.2 - Support activities to performing arts R9002 s2cR90.0.3 - Artistic creation R9003 s2cR90.0.4 - Operation of arts facilities R9004 s2cR91 - Libraries, archives, museums and other cultural activities R91 s2cR91.0 - Libraries, archives, museums and other cultural activities R910 s2cR91.0.1 - Library and archives activities R9101 s2cR91.0.2 - Museums activities R9102 s2cR91.0.3 - Operation of historical sites and buildings and similar visitor att R9103 s2cR91.0.4 - Botanical and zoological gardens and nature reserves activities R9104 s2cR92 - Gambling and betting activities R92 s2cR92.0 - Gambling and betting activities R920 s2cR92.0.0 - Gambling and betting activities R9200 s2cR93 - Sports activities and amusement and recreation activities R93 s2cR93.1 - Sports activities R931 s2cR93.1.1 - Operation of sports facilities R9311 s2cR93.1.2 - Activities of sport clubs R9312 s2cR93.1.3 - Fitness facilities R9313 s2cR93.1.9 - Other sports activities R9319 s2cR93.2 - Amusement and recreation activities R932 s2cR93.2.1 - Activities of amusement parks and theme parks R9321 s2cR93.2.9 - Other amusement and recreation activities R9329 s2cS - Other services activities S s2cS94 - Activities of membership organisations S94 s2cS94.1 - Activities of business, employers and professional membership orS941 s2cS94.1.1 - Activities of business and employers membership organisationsS9411 s2cS94.1.2 - Activities of professional membership organisations S9412 s2cS94.2 - Activities of trade unions S942 s2cS94.2.0 - Activities of trade unions S9420 s2cS94.9 - Activities of other membership organisations S949 s2cS94.9.1 - Activities of religious organisations S9491 s2cS94.9.2 - Activities of political organisations S9492 s2cS94.9.9 - Activities of other membership organisations n.e.c. S9499 s2cS95 - Repair of computers and personal and household goods S95 s2cS95.1 - Repair of computers and communication equipment S951 s2c

Page 805: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

S95.1.1 - Repair of computers and peripheral equipment S9511 s2cS95.1.2 - Repair of communication equipment S9512 s2cS95.2 - Repair of personal and household goods S952 s2cS95.2.1 - Repair of consumer electronics S9521 s2cS95.2.2 - Repair of household appliances and home and garden equipme S9522 s2cS95.2.3 - Repair of footwear and leather goods S9523 s2cS95.2.4 - Repair of furniture and home furnishings S9524 s2cS95.2.5 - Repair of watches, clocks and jewellery S9525 s2cS95.2.9 - Repair of other personal and household goods S9529 s2cS96 - Other personal service activities S96 s2cS96.0 - Other personal service activities S960 s2cS96.0.1 - Washing and (dry-)cleaning of textile and fur products S9601 s2cS96.0.2 - Hairdressing and other beauty treatment S9602 s2cS96.0.3 - Funeral and related activities S9603 s2cS96.0.4 - Physical well-being activities S9604 s2cS96.0.9 - Other personal service activities n.e.c. S9609 s2cT - Activities of households as employers; undifferentiated goods - and seT s2cT97 - Activities of households as employers of domestic personnel T97 s2cT97.0 - Activities of households as employers of domestic personnel T970 s2cT97.0.0 - Activities of households as employers of domestic personnel T9700 s2cT98 - Undifferentiated goods- and services-producing activities of privat T98 s2cT98.1 - Undifferentiated goods-producing activities of private household T981 s2cT98.1.0 - Undifferentiated goods-producing activities of private househo T9810 s2cT98.2 - Undifferentiated service-producing activities of private househol T982 s2cT98.2.0 - Undifferentiated service-producing activities of private househ T9820 s2cU - Activities of extraterritorial organisations and bodies U s2cU99 - Activities of extraterritorial organisations and bodies U99 s2cU99.0 - Activities of extraterritorial organisations and bodies U990 s2cU99.0.0 - Activities of extraterritorial organisations and bodie U9900 s2c

Page 806: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity datLast modifi Count Comment7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 807: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 808: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 809: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 810: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 811: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 812: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 813: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 814: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 815: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 816: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 817: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 818: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 819: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 820: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 821: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 822: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 823: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 824: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 825: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 826: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name1: NACE

Total/NA x0A - Agriculture, forestry and fishing A

A1 - Crop and animal production, hunting and related service activities A01A1.1 - Growing of non-perennial crops A011

A1.1.1 - Growing of cereals (except rice), leguminous crops and oil seeds A0111A1.1.2 - Growing of rice A0112A1.1.3 - Growing of vegetables and melons, roots and tubers A0113A1.1.4 - Growing of sugar cane A0114A1.1.5 - Growing of tobacco A0115A1.1.6 - Growing of fibre crops A0116A1.1.9 - Growing of other non-perennial crops A0119

A1.2 - Growing of perennial crops A012A1.2.1 - Growing of grapes A0121A1.2.2 - Growing of tropical and subtropical fruits A0122A1.2.3 - Growing of citrus fruits A0123A1.2.4 - Growing of pome fruits and stone fruits A0124A1.2.5 - Growing of other tree and bush fruits and nuts A0125A1.2.6 - Growing of oleaginous fruits A0126A1.2.7 - Growing of beverage crops A0127A1.2.8 - Growing of spices, aromatic, drug and pharmaceutical crops A0128A1.2.9 - Growing of other perennial crops A0129

A1.3 - Plant propagation A013A1.3.0 - Plant propagation A0130

A1.4 - Animal production A014A1.4.1 - Raising of dairy cattle A0141A1.4.2 - Raising of other cattle and buffaloes A0142A1.4.3 - Raising of horses and other equines A0143A1.4.4 - Raising of camels and camelids A0144A1.4.5 - Raising of sheep and goats A0145A1.4.6 - Raising of swine/pigs A0146A1.4.7 - Raising of poultry A0147A1.4.9 - Raising of other animals A0149

A1.5 - Mixed farming A015A1.5.0 - Mixed farming A0150

A1.6 - Support activities to agriculture and post-harvest crop activities A016A1.6.1 - Support activities for crop production A0161A1.6.2 - Support activities for animal production A0162A1.6.3 - Post-harvest crop activities A0163A1.6.4 - Seed processing for propagation A0164

A1.7 - Hunting, trapping and related service activities A017A1.7.0 - Hunting, trapping and related service activities A0170

A2 - Forestry and logging A02A2.1 - Silviculture and other forestry activities A021

A2.1.0 - Silviculture and other forestry activities A0210A2.2 - Logging A022

A2.2.0 - Logging A0220A2.3 - Gathering of wild growing non-wood products A023

A2.3.0 - Gathering of wild growing non-wood products A0230A2.4 - Support services to forestry A024

Page 827: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

A2.4.0 - Support services to forestry A0240A3 - Fishing and aquaculture A03

A3.1 - Fishing A031A3.1.1 - Marine fishing A0311A3.1.2 - Freshwater fishing A0312

A3.2 - Aquaculture A032A3.2.1 - Marine aquaculture A0321A3.2.2 - Freshwater aquaculture A0322

B - Mining and quarrying BB5 - Mining of coal and lignite B05

B5.1 - Mining of hard coal B051B5.1.0 - Mining of hard coal B0510

B5.2 - Mining of lignite B052B5.2.0 - Mining of lignite B0520

B6 - Extraction of crude petroleum and natural gas B06B6.1 - Extraction of crude petroleum B061

B6.1.0 - Extraction of crude petroleum B0610B6.2 - Extraction of natural gas B062

B6.2.0 - Extraction of natural gas B0620B7 - Mining of metal ores B07

B7.1 - Mining of iron ores B071B7.1.0 - Mining of iron ores B0710

B7.2 - Mining of non-ferrous metal ores B072B7.2.1 - Mining of uranium and thorium ores B0721B7.2.9 - Mining of other non-ferrous metal ores B0729

B8 - Other mining and quarrying B08B8.1 - Quarrying of stone, sand and clay B081

B8.1.1 - Quarrying of ornamental and building stone, limestone, gypsum, chalk aB0811B8.1.2 - Operation of gravel and sand pits; mining of clays and kaolin B0812

B8.9 - Mining and quarrying n.e.c. B089B8.9.1 - Mining of chemical and fertiliser minerals B0891B8.9.2 - Extraction of peat B0892B8.9.3 - Extraction of salt B0893B8.9.9 - Other mining and quarrying n.e.c. B0899

B9 - Mining support service activities B09B9.1 - Support activities for petroleum and natural gas extraction B091

B9.1.0 - Support activities for petroleum and natural gas extraction B0910B9.9 - Support activities for other mining and quarrying B099

B9.9.0 - Support activities for other mining and quarrying B0990C - Manufacturing C

C10 - Manufacture of food products C10C10.1 - Processing and preserving of meat and production of meat products C101

C10.1.1 - Processing and preserving of meat C1011C10.1.2 - Processing and preserving of poultry meat C1012C10.1.3 - Production of meat and poultry meat products C1013

C10.2 - Processing and preserving of fish, crustaceans and molluscs C102C10.2.0 - Processing and preserving of fish, crustaceans and molluscs C1020

C10.3 - Processing and preserving of fruit and vegetables C103C10.3.1 - Processing and preserving of potatoes C1031C10.3.2 - Manufacture of fruit and vegetable juice C1032C10.3.9 - Other processing and preserving of fruit and vegetables C1039

Page 828: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C10.4 - Manufacture of vegetable and animal oils and fats C104C10.4.1 - Manufacture of oils and fats C1041C10.4.2 - Manufacture of margarine and similar edible fats C1042

C10.5 - Manufacture of dairy products C105C10.5.1 - Operation of dairies and cheese making C1051C10.5.2 - Manufacture of ice cream C1052

C10.6 - Manufacture of grain mill products, starches and starch products C106C10.6.1 - Manufacture of grain mill products C1061C10.6.2 - Manufacture of starches and starch products C1062

C10.7 - Manufacture of bakery and farinaceous products C107C10.7.1 - Manufacture of bread; manufacture of fresh pastry goods and cakes C1071C10.7.2 - Manufacture of rusks and biscuits; manufacture of preserved pastry g C1072C10.7.3 - Manufacture of macaroni, noodles, couscous and similar farinaceous p C1073

C10.8 - Manufacture of other food products C108C10.8.1 - Manufacture of sugar C1081C10.8.2 - Manufacture of cocoa, chocolate and sugar confectionery C1082C10.8.3 - Processing of tea and coffee C1083C10.8.4 - Manufacture of condiments and seasonings C1084C10.8.5 - Manufacture of prepared meals and dishes C1085C10.8.6 - Manufacture of homogenised food preparations and dietetic food C1086C10.8.9 - Manufacture of other food products n.e.c. C1089

C10.9 - Manufacture of prepared animal feeds C109C10.9.1 - Manufacture of prepared feeds for farm animals C1091C10.9.2 - Manufacture of prepared pet foods C1092

C11 - Manufacture of beverages C11C11.0 - Manufacture of beverages C110

C11.0.1 - Distilling, rectifying and blending of spirits C1101C11.0.2 - Manufacture of wine from grape C1102C11.0.3 - Manufacture of cider and other fruit wines C1103C11.0.4 - Manufacture of other non-distilled fermented beverages C1104C11.0.5 - Manufacture of beer C1105C11.0.6 - Manufacture of malt C1106C11.0.7 - Manufacture of soft drinks; production of mineral waters and other bo C1107

C12 - Manufacture of tobacco products C12C12.0 - Manufacture of tobacco products C120

C12.0.0 - Manufacture of tobacco products C1200C13 - Manufacture of textiles C13

C13.1 - Preparation and spinning of textile fibres C131C13.1.0 - Preparation and spinning of textile fibres C1310

C13.2 - Weaving of textiles C132C13.2.0 - Weaving of textiles C1320

C13.3 - Finishing of textiles C133C13.3.0 - Finishing of textiles C1330

C13.9 - Manufacture of other textiles C139C13.9.1 - Manufacture of knitted and crocheted fabrics C1391C13.9.2 - Manufacture of made-up textile articles, except apparel C1392C13.9.3 - Manufacture of carpets and rugs C1393C13.9.4 - Manufacture of cordage, rope, twine and netting C1394C13.9.5 - Manufacture of non-wovens and articles made from non-wovens, exceC1395C13.9.6 - Manufacture of other technical and industrial textiles C1396C13.9.9 - Manufacture of other textiles n.e.c. C1399

Page 829: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C14 - Manufacture of wearing apparel C14C14.1 - Manufacture of wearing apparel, except fur apparel C141

C14.1.1 - Manufacture of leather clothes C1411C14.1.2 - Manufacture of workwear C1412C14.1.3 - Manufacture of other outerwear C1413C14.1.4 - Manufacture of underwear C1414C14.1.9 - Manufacture of other wearing apparel and accessories C1419

C14.2 - Manufacture of articles of fur C142C14.2.0 - Manufacture of articles of fur C1420

C14.3 - Manufacture of knitted and crocheted apparel C143C14.3.1 - Manufacture of knitted and crocheted hosiery C1431C14.3.9 - Manufacture of other knitted and crocheted apparel C1439

C15 - Manufacture of leather and related products C15C15.1 - Tanning and dressing of leather; manufacture of luggage, handbags, saddleC151

C15.1.1 - Tanning and dressing of leather; dressing and dyeing of fur C1511C15.1.2 - Manufacture of luggage, handbags and the like, saddlery and harness C1512

C15.2 - Manufacture of footwear C152C15.2.0 - Manufacture of footwear C1520

C16 - Manufacture of wood and of products of wood and cork, except furniture; manufC16C16.1 - Sawmilling and planing of wood C161

C16.1.0 - Sawmilling and planing of wood C1610C16.2 - Manufacture of products of wood, cork, straw and plaiting materials C162

C16.2.1 - Manufacture of veneer sheets and wood-based panels C1621C16.2.2 - Manufacture of assembled parquet floors C1622C16.2.3 - Manufacture of other builders' carpentry and joinery C1623C16.2.4 - Manufacture of wooden containers C1624C16.2.9 - Manufacture of other products of wood; manufacture of articles of corkC1629

C17 - Manufacture of paper and paper products C17C17.1 - Manufacture of pulp, paper and paperboard C171

C17.1.1 - Manufacture of pulp C1711C17.1.2 - Manufacture of paper and paperboard C1712

C17.2 - Manufacture of articles of paper and paperboard C172C17.2.1 - Manufacture of corrugated paper and paperboard and of containers o C1721C17.2.2 - Manufacture of household and sanitary goods and of toilet requisites C1722C17.2.3 - Manufacture of paper stationery C1723C17.2.4 - Manufacture of wallpaper C1724C17.2.9 - Manufacture of other articles of paper and paperboard C1729

C18 - Printing and reproduction of recorded media C18C18.1 - Printing and service activities related to printing C181

C18.1.1 - Printing of newspapers C1811C18.1.2 - Other printing C1812C18.1.3 - Pre-press and pre-media services C1813C18.1.4 - Binding and related services C1814

C18.2 - Reproduction of recorded media C182C18.2.0 - Reproduction of recorded media C1820

C19 - Manufacture of coke and refined petroleum products C19C19.1 - Manufacture of coke oven products C191

C19.1.0 - Manufacture of coke oven products C1910C19.2 - Manufacture of refined petroleum products C192

C19.2.0 - Manufacture of refined petroleum products C1920C20 - Manufacture of chemicals and chemical products C20

Page 830: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C20.1 - Manufacture of basic chemicals, fertilisers and nitrogen compounds, plastiC201C20.1.1 - Manufacture of industrial gases C2011C20.1.2 - Manufacture of dyes and pigments C2012C20.1.3 - Manufacture of other inorganic basic chemicals C2013C20.1.4 - Manufacture of other organic basic chemicals C2014C20.1.5 - Manufacture of fertilisers and nitrogen compounds C2015C20.1.6 - Manufacture of plastics in primary forms C2016C20.1.7 - Manufacture of synthetic rubber in primary forms C2017

C20.2 - Manufacture of pesticides and other agrochemical products C202C20.2.0 - Manufacture of pesticides and other agrochemical products C2020

C20.3 - Manufacture of paints, varnishes and similar coatings, printing ink and masC203C20.3.0 - Manufacture of paints, varnishes and similar coatings, printing ink and C2030

C20.4 - Manufacture of soap and detergents, cleaning and polishing preparations, C204C20.4.1 - Manufacture of soap and detergents, cleaning and polishing preparatioC2041C20.4.2 - Manufacture of perfumes and toilet preparations C2042

C20.5 - Manufacture of other chemical products C205C20.5.1 - Manufacture of explosives C2051C20.5.2 - Manufacture of glues C2052C20.5.3 - Manufacture of essential oils C2053C20.5.9 - Manufacture of other chemical products n.e.c. C2059

C20.6 - Manufacture of man-made fibres C206C20.6.0 - Manufacture of man-made fibres C2060

C21 - Manufacture of basic pharmaceutical products and pharmaceutical preparatioC21C21.1 - Manufacture of basic pharmaceutical products C211

C21.1.0 - Manufacture of basic pharmaceutical products C2110C21.2 - Manufacture of pharmaceutical preparations C212

C21.2.0 - Manufacture of pharmaceutical preparations C2120C22 - Manufacture of rubber and plastic products C22

C22.1 - Manufacture of rubber products C221C22.1.1 - Manufacture of rubber tyres and tubes; retreading and rebuilding of ruC2211C22.1.9 - Manufacture of other rubber products C2219

C22.2 - Manufacture of plastics products C222C22.2.1 - Manufacture of plastic plates, sheets, tubes and profiles C2221C22.2.2 - Manufacture of plastic packing goods C2222C22.2.3 - Manufacture of builders’ ware of plastic C2223C22.2.9 - Manufacture of other plastic products C2229

C23 - Manufacture of other non-metallic mineral products C23C23.1 - Manufacture of glass and glass products C231

C23.1.1 - Manufacture of flat glass C2311C23.1.2 - Shaping and processing of flat glass C2312C23.1.3 - Manufacture of hollow glass C2313C23.1.4 - Manufacture of glass fibres C2314C23.1.9 - Manufacture and processing of other glass, including technical glasswaC2319

C23.2 - Manufacture of refractory products C232C23.2.0 - Manufacture of refractory products C2320

C23.3 - Manufacture of clay building materials C233C23.3.1 - Manufacture of ceramic tiles and flags C2331C23.3.2 - Manufacture of bricks, tiles and construction products, in baked clay C2332

C23.4 - Manufacture of other porcelain and ceramic products C234C23.4.1 - Manufacture of ceramic household and ornamental articles C2341C23.4.2 - Manufacture of ceramic sanitary fixtures C2342

Page 831: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C23.4.3 - Manufacture of ceramic insulators and insulating fittings C2343C23.4.4 - Manufacture of other technical ceramic products C2344C23.4.9 - Manufacture of other ceramic products C2349

C23.5 - Manufacture of cement, lime and plaster C235C23.5.1 - Manufacture of cement C2351C23.5.2 - Manufacture of lime and plaster C2352

C23.6 - Manufacture of articles of concrete, cement and plaster C236C23.6.1 - Manufacture of concrete products for construction purposes C2361C23.6.2 - Manufacture of plaster products for construction purposes C2362C23.6.3 - Manufacture of ready-mixed concrete C2363C23.6.4 - Manufacture of mortars C2364C23.6.5 - Manufacture of fibre cement C2365C23.6.9 - Manufacture of other articles of concrete, plaster and cement C2369

C23.7 - Cutting, shaping and finishing of stone C237C23.7.0 - Cutting, shaping and finishing of stone C2370

C23.9 - Manufacture of abrasive products and non-metallic mineral products n.e.cC239C23.9.1 - Production of abrasive products C2391C23.9.9 - Manufacture of other non-metallic mineral products n.e.c. C2399

C24 - Manufacture of basic metals C24C24.1 - Manufacture of basic iron and steel and of ferro-alloys C241

C24.1.0 - Manufacture of basic iron and steel and of ferro-alloys C2410C24.2 - Manufacture of tubes, pipes, hollow profiles and related fittings, of steel C242

C24.2.0 - Manufacture of tubes, pipes, hollow profiles and related fittings, of steeC2420C24.3 - Manufacture of other products of first processing of steel C243

C24.3.1 - Cold drawing of bars C2431C24.3.2 - Cold rolling of narrow strip C2432C24.3.3 - Cold forming or folding C2433C24.3.4 - Cold drawing of wire C2434

C24.4 - Manufacture of basic precious and other non-ferrous metals C244C24.4.1 - Precious metals production C2441C24.4.2 - Aluminium production C2442C24.4.3 - Lead, zinc and tin production C2443C24.4.4 - Copper production C2444C24.4.5 - Other non-ferrous metal production C2445C24.4.6 - Processing of nuclear fuel C2446

C24.5 - Casting of metals C245C24.5.1 - Casting of iron C2451C24.5.2 - Casting of steel C2452C24.5.3 - Casting of light metals C2453C24.5.4 - Casting of other non-ferrous metals C2454

C25 - Manufacture of fabricated metal products, except machinery and equipment C25C25.1 - Manufacture of structural metal products C251

C25.1.1 - Manufacture of metal structures and parts of structures C2511C25.1.2 - Manufacture of doors and windows of metal C2512

C25.2 - Manufacture of tanks, reservoirs and containers of metal C252C25.2.1 - Manufacture of central heating radiators and boilers C2521C25.2.9 - Manufacture of other tanks, reservoirs and containers of metal C2529

C25.3 - Manufacture of steam generators, except central heating hot water boiler C253C25.3.0 - Manufacture of steam generators, except central heating hot water boiC2530

C25.4 - Manufacture of weapons and ammunition C254C25.4.0 - Manufacture of weapons and ammunition C2540

Page 832: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C25.5 - Forging, pressing, stamping and roll-forming of metal; powder metallurgy C255C25.5.0 - Forging, pressing, stamping and roll-forming of metal; powder metallurC2550

C25.6 - Treatment and coating of metals; machining C256C25.6.1 - Treatment and coating of metals C2561C25.6.2 - Machining C2562

C25.7 - Manufacture of cutlery, tools and general hardware C257C25.7.1 - Manufacture of cutlery C2571C25.7.2 - Manufacture of locks and hinges C2572C25.7.3 - Manufacture of tools C2573

C25.9 - Manufacture of other fabricated metal products C259C25.9.1 - Manufacture of steel drums and similar containers C2591C25.9.2 - Manufacture of light metal packaging C2592C25.9.3 - Manufacture of wire products, chain and springs C2593C25.9.4 - Manufacture of fasteners and screw machine products C2594C25.9.9 - Manufacture of other fabricated metal products n.e.c. C2599

C26 - Manufacture of computer, electronic and optical products C26C26.1 - Manufacture of electronic components and boards C261

C26.1.1 - Manufacture of electronic components C2611C26.1.2 - Manufacture of loaded electronic boards C2612

C26.2 - Manufacture of computers and peripheral equipment C262C26.2.0 - Manufacture of computers and peripheral equipment C2620

C26.3 - Manufacture of communication equipment C263C26.3.0 - Manufacture of communication equipment C2630

C26.4 - Manufacture of consumer electronics C264C26.4.0 - Manufacture of consumer electronics C2640

C26.5 - Manufacture of instruments and appliances for measuring, testing and navC265C26.5.1 - Manufacture of instruments and appliances for measuring, testing and C2651C26.5.2 - Manufacture of watches and clocks C2652

C26.6 - Manufacture of irradiation, electromedical and electrotherapeutic equipmC266C26.6.0 - Manufacture of irradiation, electromedical and electrotherapeutic eq C2660

C26.7 - Manufacture of optical instruments and photographic equipment C267C26.7.0 - Manufacture of optical instruments and photographic equipment C2670

C26.8 - Manufacture of magnetic and optical media C268C26.8.0 - Manufacture of magnetic and optical media C2680

C27 - Manufacture of electrical equipment C27C27.1 - Manufacture of electric motors, generators, transformers and electricity d C271

C27.1.1 - Manufacture of electric motors, generators and transformers C2711C27.1.2 - Manufacture of electricity distribution and control apparatus C2712

C27.2 - Manufacture of batteries and accumulators C272C27.2.0 - Manufacture of batteries and accumulators C2720

C27.3 - Manufacture of wiring and wiring devices C273C27.3.1 - Manufacture of fibre optic cables C2731C27.3.2 - Manufacture of other electronic and electric wires and cables C2732C27.3.3 - Manufacture of wiring devices C2733

C27.4 - Manufacture of electric lighting equipment C274C27.4.0 - Manufacture of electric lighting equipment C2740

C27.5 - Manufacture of domestic appliances C275C27.5.1 - Manufacture of electric domestic appliances C2751C27.5.2 - Manufacture of non-electric domestic appliances C2752

C27.9 - Manufacture of other electrical equipment C279C27.9.0 - Manufacture of other electrical equipment C2790

Page 833: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C28 - Manufacture of machinery and equipment n.e.c. C28C28.1 - Manufacture of general-purpose machinery C281

C28.1.1 - Manufacture of engines and turbines, except aircraft, vehicle and cycleC2811C28.1.2 - Manufacture of fluid power equipment C2812C28.1.3 - Manufacture of other pumps and compressors C2813C28.1.4 - Manufacture of other taps and valves C2814C28.1.5 - Manufacture of bearings, gears, gearing and driving elements C2815

C28.2 - Manufacture of other general-purpose machinery C282C28.2.1 - Manufacture of ovens, furnaces and furnace burners C2821C28.2.2 - Manufacture of lifting and handling equipment C2822C28.2.3 - Manufacture of office machinery and equipment (except computers anC2823C28.2.4 - Manufacture of power-driven hand tools C2824C28.2.5 - Manufacture of non-domestic cooling and ventilation equipment C2825C28.2.9 - Manufacture of other general-purpose machinery n.e.c. C2829

C28.3 - Manufacture of agricultural and forestry machinery C283C28.3.0 - Manufacture of agricultural and forestry machinery C2830

C28.4 - Manufacture of metal forming machinery and machine tools C284C28.4.1 - Manufacture of metal forming machinery C2841C28.4.9 - Manufacture of other machine tools C2849

C28.9 - Manufacture of other special-purpose machinery C289C28.9.1 - Manufacture of machinery for metallurgy C2891C28.9.2 - Manufacture of machinery for mining, quarrying and construction C2892C28.9.3 - Manufacture of machinery for food, beverage and tobacco processing C2893C28.9.4 - Manufacture of machinery for textile, apparel and leather production C2894C28.9.5 - Manufacture of machinery for paper and paperboard production C2895C28.9.6 - Manufacture of plastics and rubber machinery C2896C28.9.9 - Manufacture of other special-purpose machinery n.e.c. C2899

C29 - Manufacture of motor vehicles, trailers and semi-trailers C29C29.1 - Manufacture of motor vehicles C291

C29.1.0 - Manufacture of motor vehicles C2910C29.2 - Manufacture of bodies (coachwork) for motor vehicles; manufacture of traiC292

C29.2.0 - Manufacture of bodies (coachwork) for motor vehicles; manufacture of tC2920C29.3 - Manufacture of parts and accessories for motor vehicles C293

C29.3.1 - Manufacture of electrical and electronic equipment for motor vehicles C2931C29.3.2 - Manufacture of other parts and accessories for motor vehicles C2932

C30 - Manufacture of other transport equipment C30C30.1 - Building of ships and boats C301

C30.1.1 - Building of ships and floating structures C3011C30.1.2 - Building of pleasure and sporting boats C3012

C30.2 - Manufacture of railway locomotives and rolling stock C302C30.2.0 - Manufacture of railway locomotives and rolling stock C3020

C30.3 - Manufacture of air and spacecraft and related machinery C303C30.3.0 - Manufacture of air and spacecraft and related machinery C3030

C30.4 - Manufacture of military fighting vehicles C304C30.4.0 - Manufacture of military fighting vehicles C3040

C30.9 - Manufacture of transport equipment n.e.c. C309C30.9.1 - Manufacture of motorcycles C3091C30.9.2 - Manufacture of bicycles and invalid carriages C3092C30.9.9 - Manufacture of other transport equipment n.e.c. C3099

C31 - Manufacture of furniture C31C31.0 - Manufacture of furniture C310

Page 834: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C31.0.1 - Manufacture of office and shop furniture C3101C31.0.2 - Manufacture of kitchen furniture C3102C31.0.3 - Manufacture of mattresses C3103C31.0.9 - Manufacture of other furniture C3109

C32 - Other manufacturing C32C32.1 - Manufacture of jewellery, bijouterie and related articles C321

C32.1.1 - Striking of coins C3211C32.1.2 - Manufacture of jewellery and related articles C3212C32.1.3 - Manufacture of imitation jewellery and related articles C3213

C32.2 - Manufacture of musical instruments C322C32.2.0 - Manufacture of musical instruments C3220

C32.3 - Manufacture of sports goods C323C32.3.0 - Manufacture of sports goods C3230

C32.4 - Manufacture of games and toys C324C32.4.0 - Manufacture of games and toys C3240

C32.5 - Manufacture of medical and dental instruments and supplies C325C32.5.0 - Manufacture of medical and dental instruments and supplies C3250

C32.9 - Manufacturing n.e.c. C329C32.9.1 - Manufacture of brooms and brushes C3291C32.9.9 - Other manufacturing n.e.c. C3299

C33 - Repair and installation of machinery and equipment C33C33.1 - Repair of fabricated metal products, machinery and equipment C331

C33.1.1 - Repair of fabricated metal products C3311C33.1.2 - Repair of machinery C3312C33.1.3 - Repair of electronic and optical equipment C3313C33.1.4 - Repair of electrical equipment C3314C33.1.5 - Repair and maintenance of ships and boats C3315C33.1.6 - Repair and maintenance of aircraft and spacecraft C3316C33.1.7 - Repair and maintenance of other transport equipment C3317C33.1.9 - Repair of other equipment C3319

C33.2 - Installation of industrial machinery and equipment C332C33.2.0 - Installation of industrial machinery and equipment C3320

D - Electricity, gas, steam and air conditioning supply DD35 - Electricity, gas, steam and air conditioning supply D35

D35.1 - Electric power generation, transmission and distribution D351D35.1.1 - Production of electricity D3511D35.1.2 - Transmission of electricity D3512D35.1.3 - Distribution of electricity D3513D35.1.4 - Trade of electricity D3514

D35.2 - Manufacture of gas; distribution of gaseous fuels through mains D352D35.2.1 - Manufacture of gas D3521D35.2.2 - Distribution of gaseous fuels through mains D3522D35.2.3 - Trade of gas through mains D3523

D35.3 - Steam and air conditioning supply D353D35.3.0 - Steam and air conditioning supply D3530

E - Water supply; sewerage; waste managment and remediation activities EE36 - Water collection, treatment and supply E36

E36.0 - Water collection, treatment and supply E360E36.0.0 - Water collection, treatment and supply E3600

E37 - Sewerage E37E37.0 - Sewerage E370

Page 835: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

E37.0.0 - Sewerage E3700E38 - Waste collection, treatment and disposal activities; materials recovery E38

E38.1 - Waste collection E381E38.1.1 - Collection of non-hazardous waste E3811E38.1.2 - Collection of hazardous waste E3812

E38.2 - Waste treatment and disposal E382E38.2.1 - Treatment and disposal of non-hazardous waste E3821E38.2.2 - Treatment and disposal of hazardous waste E3822

E38.3 - Materials recovery E383E38.3.1 - Dismantling of wrecks E3831E38.3.2 - Recovery of sorted materials E3832

E39 - Remediation activities and other waste management services E39E39.0 - Remediation activities and other waste management services E390

E39.0.0 - Remediation activities and other waste management services E3900F - Construction F

F41 - Construction of buildings F41F41.1 - Development of building projects F411

F41.1.0 - Development of building projects F4110F41.2 - Construction of residential and non-residential buildings F412

F41.2.0 - Construction of residential and non-residential buildings F4120F42 - Civil engineering F42

F42.1 - Construction of roads and railways F421F42.1.1 - Construction of roads and motorways F4211F42.1.2 - Construction of railways and underground railways F4212F42.1.3 - Construction of bridges and tunnels F4213

F42.2 - Construction of utility projects F422F42.2.1 - Construction of utility projects for fluids F4221F42.2.2 - Construction of utility projects for electricity and telecommunications F4222

F42.9 - Construction of other civil engineering projects F429F42.9.1 - Construction of water projects F4291F42.9.9 - Construction of other civil engineering projects n.e.c. F4299

F43 - Specialised construction activities F43F43.1 - Demolition and site preparation F431

F43.1.1 - Demolition F4311F43.1.2 - Site preparation F4312F43.1.3 - Test drilling and boring F4313

F43.2 - Electrical, plumbing and other construction installation activities F432F43.2.1 - Electrical installation F4321F43.2.2 - Plumbing, heat and air-conditioning installation F4322F43.2.9 - Other construction installation F4329

F43.3 - Building completion and finishing F433F43.3.1 - Plastering F4331F43.3.2 - Joinery installation F4332F43.3.3 - Floor and wall covering F4333F43.3.4 - Painting and glazing F4334F43.3.9 - Other building completion and finishing F4339

F43.9 - Other specialised construction activities F439F43.9.1 - Roofing activities F4391F43.9.9 - Other specialised construction activities n.e.c. F4399

G - Wholesale and retail trade; repair of motor vehicles and motorcycles GG45 - Wholesale and retail trade and repair of motor vehicles and motorcycles G45

Page 836: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

G45.1 - Sale of motor vehicles G451G45.1.1 - Sale of cars and light motor vehicles G4511G45.1.9 - Sale of other motor vehicles G4519

G45.2 - Maintenance and repair of motor vehicles G452G45.2.0 - Maintenance and repair of motor vehicles G4520

G45.3 - Sale of motor vehicle parts and accessories G453G45.3.1 - Wholesale trade of motor vehicle parts and accessories G4531G45.3.2 - Retail trade of motor vehicle parts and accessories G4532

G45.4 - Sale, maintenance and repair of motorcycles and related parts and accessoG454G45.4.0 - Sale, maintenance and repair of motorcycles and related parts and acc G4540

G46 - Wholesale trade, except of motor vehicles and motorcycles G46G46.1 - Wholesale on a fee or contract basis G461

G46.1.1 - Agents involved in the sale of agricultural raw materials, live animals, G4611G46.1.2 - Agents involved in the sale of fuels, ores, metals and industrial chemicaG4612G46.1.3 - Agents involved in the sale of timber and building materials G4613G46.1.4 - Agents involved in the sale of machinery, industrial equipment, ships anG4614G46.1.5 - Agents involved in the sale of furniture, household goods, hardware G4615G46.1.6 - Agents involved in the sale of textiles, clothing, fur, footwear and leat G4616G46.1.7 - Agents involved in the sale of food, beverages and tobacco G4617G46.1.8 - Agents specialised in the sale of other particular products G4618G46.1.9 - Agents involved in the sale of a variety of goods G4619

G46.2 - Wholesale of agricultural raw materials and live animals G462G46.2.1 - Wholesale of grain, unmanufactured tobacco, seeds and animal feeds G4621G46.2.2 - Wholesale of flowers and plants G4622G46.2.3 - Wholesale of live animals G4623G46.2.4 - Wholesale of hides, skins and leather G4624

G46.3 - Wholesale of food, beverages and tobacco G463G46.3.1 - Wholesale of fruit and vegetables G4631G46.3.2 - Wholesale of meat and meat products G4632G46.3.3 - Wholesale of dairy products, eggs and edible oils and fats G4633G46.3.4 - Wholesale of beverages G4634G46.3.5 - Wholesale of tobacco products G4635G46.3.6 - Wholesale of sugar and chocolate and sugar confectionery G4636G46.3.7 - Wholesale of coffee, tea, cocoa and spices G4637G46.3.8 - Wholesale of other food, including fish, crustaceans and molluscs G4638G46.3.9 - Non-specialised wholesale of food, beverages and tobacco G4639

G46.4 - Wholesale of household goods G464G46.4.1 - Wholesale of textiles G4641G46.4.2 - Wholesale of clothing and footwear G4642G46.4.3 - Wholesale of electrical household appliances G4643G46.4.4 - Wholesale of china and glassware and cleaning materials G4644G46.4.5 - Wholesale of perfume and cosmetics G4645G46.4.6 - Wholesale of pharmaceutical goods G4646G46.4.7 - Wholesale of furniture, carpets and lighting equipment G4647G46.4.8 - Wholesale of watches and jewellery G4648G46.4.9 - Wholesale of other household goods G4649

G46.5 - Wholesale of information and communication equipment G465G46.5.1 - Wholesale of computers, computer peripheral equipment and softwar G4651G46.5.2 - Wholesale of electronic and telecommunications equipment and parts G4652

G46.6 - Wholesale of other machinery, equipment and supplies G466G46.6.1 - Wholesale of agricultural machinery, equipment and supplies G4661

Page 837: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

G46.6.2 - Wholesale of machine tools G4662G46.6.3 - Wholesale of mining, construction and civil engineering machinery G4663G46.6.4 - Wholesale of machinery for the textile industry and of sewing and knit G4664G46.6.5 - Wholesale of office furniture G4665G46.6.6 - Wholesale of other office machinery and equipment G4666G46.6.9 - Wholesale of other machinery and equipment G4669

G46.7 - Other specialised wholesale G467G46.7.1 - Wholesale of solid, liquid and gaseous fuels and related products G4671G46.7.2 - Wholesale of metals and metal ores G4672G46.7.3 - Wholesale of wood, construction materials and sanitary equipment G4673G46.7.4 - Wholesale of hardware, plumbing and heating equipment and suppliesG4674G46.7.5 - Wholesale of chemical products G4675G46.7.6 - Wholesale of other intermediate products G4676G46.7.7 - Wholesale of waste and scrap G4677

G46.9 - Non-specialised wholesale trade G469G46.9.0 - Non-specialised wholesale trade G4690

G47 - Retail trade, except of motor vehicles and motorcycles G47G47.1 - Retail sale in non-specialised stores G471

G47.1.1 - Retail sale in non-specialised stores with food, beverages or tobacco G4711G47.1.9 - Other retail sale in non-specialised stores G4719

G47.2 - Retail sale of food, beverages and tobacco in specialised stores G472G47.2.1 - Retail sale of fruit and vegetables in specialised stores G4721G47.2.2 - Retail sale of meat and meat products in specialised stores G4722G47.2.3 - Retail sale of fish, crustaceans and molluscs in specialised stores G4723G47.2.4 - Retail sale of bread, cakes, flour confectionery and sugar confectionery G4724G47.2.5 - Retail sale of beverages in specialised stores G4725G47.2.6 - Retail sale of tobacco products in specialised stores G4726G47.2.9 - Other retail sale of food in specialised stores G4729

G47.3 - Retail sale of automotive fuel in specialised stores G473G47.3.0 - Retail sale of automotive fuel in specialised stores G4730

G47.4 - Retail sale of information and communication equipment in specialised stoG474G47.4.1 - Retail sale of computers, peripheral units and software in specialised s G4741G47.4.2 - Retail sale of telecommunications equipment in specialised stores G4742G47.4.3 - Retail sale of audio and video equipment in specialised stores G4743

G47.5 - Retail sale of other household equipment in specialised stores G475G47.5.1 - Retail sale of textiles in specialised stores G4751G47.5.2 - Retail sale of hardware, paints and glass in specialised stores G4752G47.5.3 - Retail sale of carpets, rugs, wall and floor coverings in specialised storeG4753G47.5.4 - Retail sale of electrical household appliances in specialised stores G4754G47.5.9 - Retail sale of furniture, lighting equipment and other household articlesG4759

G47.6 - Retail sale of cultural and recreation goods in specialised stores G476G47.6.1 - Retail sale of books in specialised stores G4761G47.6.2 - Retail sale of newspapers and stationery in specialised stores G4762G47.6.3 - Retail sale of music and video recordings in specialised stores G4763G47.6.4 - Retail sale of sporting equipment in specialised stores G4764G47.6.5 - Retail sale of games and toys in specialised stores G4765

G47.7 - Retail sale of other goods in specialised stores G477G47.7.1 - Retail sale of clothing in specialised stores G4771G47.7.2 - Retail sale of footwear and leather goods in specialised stores G4772G47.7.3 - Dispensing chemist in specialised stores G4773G47.7.4 - Retail sale of medical and orthopaedic goods in specialised stores G4774

Page 838: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

G47.7.5 - Retail sale of cosmetic and toilet articles in specialised stores G4775G47.7.6 - Retail sale of flowers, plants, seeds, fertilisers, pet animals and pet foo G4776G47.7.7 - Retail sale of watches and jewellery in specialised stores G4777G47.7.8 - Other retail sale of new goods in specialised stores G4778G47.7.9 - Retail sale of second-hand goods in stores G4779

G47.8 - Retail sale via stalls and markets G478G47.8.1 - Retail sale via stalls and markets of food, beverages and tobacco produG4781G47.8.2 - Retail sale via stalls and markets of textiles, clothing and footwear G4782G47.8.9 - Retail sale via stalls and markets of other goods G4789

G47.9 - Retail trade not in stores, stalls or markets G479G47.9.1 - Retail sale via mail order houses or via Internet G4791G47.9.9 - Other retail sale not in stores, stalls or markets G4799

H - Transporting and storage HH49 - Land transport and transport via pipelines H49

H49.1 - Passenger rail transport, interurban H491H49.1.0 - Passenger rail transport, interurban H4910

H49.2 - Freight rail transport H492H49.2.0 - Freight rail transport H4920

H49.3 - Other passenger land transport H493H49.3.1 - Urban and suburban passenger land transport H4931H49.3.2 - Taxi operation H4932H49.3.9 - Other passenger land transport n.e.c. H4939

H49.4 - Freight transport by road and removal services H494H49.4.1 - Freight transport by road H4941H49.4.2 - Removal services H4942

H49.5 - Transport via pipeline H495H49.5.0 - Transport via pipeline H4950

H50 - Water transport H50H50.1 - Sea and coastal passenger water transport H501

H50.1.0 - Sea and coastal passenger water transport H5010H50.2 - Sea and coastal freight water transport H502

H50.2.0 - Sea and coastal freight water transport H5020H50.3 - Inland passenger water transport H503

H50.3.0 - Inland passenger water transport H5030H50.4 - Inland freight water transport H504

H50.4.0 - Inland freight water transport H5040H51 - Air transport H51

H51.1 - Passenger air transport H511H51.1.0 - Passenger air transport H5110

H51.2 - Freight air transport and space transport H512H51.2.1 - Freight air transport H5121H51.2.2 - Space transport H5122

H52 - Warehousing and support activities for transportation H52H52.1 - Warehousing and storage H521

H52.1.0 - Warehousing and storage H5210H52.2 - Support activities for transportation H522

H52.2.1 - Service activities incidental to land transportation H5221H52.2.2 - Service activities incidental to water transportation H5222H52.2.3 - Service activities incidental to air transportation H5223H52.2.4 - Cargo handling H5224H52.2.9 - Other transportation support activities H5229

Page 839: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

H53 - Postal and courier activities H53H53.1 - Postal activities under universal service obligation H531

H53.1.0 - Postal activities under universal service obligation H5310H53.2 - Other postal and courier activities H532

H53.2.0 - Other postal and courier activities H5320I - Accommodation and food service activities I

I55 - Accommodation I55I55.1 - Hotels and similar accommodation I551

I55.1.0 - Hotels and similar accommodation I5510I55.2 - Holiday and other short-stay accommodation I552

I55.2.0 - Holiday and other short-stay accommodation I5520I55.3 - Camping grounds, recreational vehicle parks and trailer parks I553

I55.3.0 - Camping grounds, recreational vehicle parks and trailer parks I5530I55.9 - Other accommodation I559

I55.9.0 - Other accommodation I5590I56 - Food and beverage service activities I56

I56.1 - Restaurants and mobile food service activities I561I56.1.0 - Restaurants and mobile food service activities I5610

I56.2 - Event catering and other food service activities I562I56.2.1 - Event catering activities I5621I56.2.9 - Other food service activities I5629

I56.3 - Beverage serving activities I563I56.3.0 - Beverage serving activities I5630

J - Information and communication JJ58 - Publishing activities J58

J58.1 - Publishing of books, periodicals and other publishing activities J581J58.1.1 - Book publishing J5811J58.1.2 - Publishing of directories and mailing lists J5812J58.1.3 - Publishing of newspapers J5813J58.1.4 - Publishing of journals and periodicals J5814J58.1.9 - Other publishing activities J5819J58.2 - Software publishing J582J58.2.1 - Publishing of computer games J5821J58.2.9 - Other software publishing J5829

J59 - Motion picture, video and television programme production, sound recording anJ59J59.1 - Motion picture, video and television programme activities J591J59.1.1 - Motion picture, video and television programme production activities J5911J59.1.2 - Motion picture, video and television programme post-production activitieJ5912J59.1.3 - Motion picture, video and television programme distribution activities J5913J59.1.4 - Motion picture projection activities J5914

J59.2 - Sound recording and music publishing activities J592J59.2.0 - Sound recording and music publishing activities J5920

J60 - Programming and broadcasting activities J60J60.1 - Radio broadcasting J601

J60.1.0 - Radio broadcasting J6010J60.2 - Television programming and broadcasting activities J602

J60.2.0 - Television programming and broadcasting activities J6020J61 - Telecommunications J61

J61.1 - Wired telecommunications activities J611J61.1.0 - Wired telecommunications activities J6110

J61.2 - Wireless telecommunications activities J612

Page 840: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

J61.2.0 - Wireless telecommunications activities J6120J61.3 - Satellite telecommunications activities J613

J61.3.0 - Satellite telecommunications activities J6130J61.9 - Other telecommunications activities J619

J61.9.0 - Other telecommunications activities J6190J62 - Computer programming, consultancy and related activities J62

J62.0 - Computer programming, consultancy and related activities J620J62.0.1 - Computer programming activities J6201J62.0.2 - Computer consultancy activities J6202J62.0.3 - Computer facilities management activities J6203J62.0.9 - Other information technology and computer service activities J6209

J63 - Information service activities J63J63.1 - Data processing, hosting and related activities; web portals J631

J63.1.1 - Data processing, hosting and related activities J6311J63.1.2 - Web portals J6312

J63.9 - Other information service activities J639J63.9.1 - News agency activities J6391J63.9.9 - Other information service activities n.e.c. J6399

K - Financial and insurance activities KK64 - Financial service activities, except insurance and pension funding K64

K64.1 - Monetary intermediation K641K64.1.1 - Central banking K6411K64.1.9 - Other monetary intermediation K6419

K64.2 - Activities of holding companies K642K64.2.0 - Activities of holding companies K6420

K64.3 - Trusts, funds and similar financial entities K643K64.3.0 - Trusts, funds and similar financial entities K6430

K64.9 - Other financial service activities, except insurance and pension funding K649K64.9.1 - Financial leasing K6491K64.9.2 - Other credit granting K6492K64.9.9 - Other financial service activities, except insurance and pension funding K6499

K65 - Insurance, reinsurance and pension funding, except compulsory social securityK65K65.1 - Insurance K651

K65.1.1 - Life insurance K6511K65.1.2 - Non-life insurance K6512

K65.2 - Reinsurance K652K65.2.0 - Reinsurance K6520

K65.3 - Pension funding K653K65.3.0 - Pension funding K6530

K66 - Activities auxiliary to financial services and insurance activities K66K66.1 - Activities auxiliary to financial services, except insurance and pension fund K661

K66.1.1 - Administration of financial markets K6611K66.1.2 - Security and commodity contracts brokerage K6612K66.1.9 - Other activities auxiliary to financial services, except insurance and pe K6619

K66.2 - Activities auxiliary to insurance and pension funding K662K66.2.1 - Risk and damage evaluation K6621K66.2.2 - Activities of insurance agents and brokers K6622K66.2.9 - Other activities auxiliary to insurance and pension funding K6629

K66.3 - Fund management activities K663K66.3.0 - Fund management activities K6630

L - Real estate activities L

Page 841: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

L68 - Real estate activities L68L68.1 - Buying and selling of own real estate L681

L68.1.0 - Buying and selling of own real estate L6810L68.2 - Renting and operating of own or leased real estate L682

L68.2.0 - Renting and operating of own or leased real estate L6820L68.3 - Real estate activities on a fee or contract basis L683

L68.3.1 - Real estate agencies L6831L68.3.2 - Management of real estate on a fee or contract basis L6832

M - Professional, scientific and technical activities MM69 - Legal and accounting activities M69

M69.1 - Legal activities M691M69.1.0 - Legal activities M6910

M69.2 - Accounting, bookkeeping and auditing activities; tax consultancy M692M69.2.0 - Accounting, bookkeeping and auditing activities; tax consultancy M6920

M70 - Activities of head offices; management consultancy activities M70M70.1 - Activities of head offices M701

M70.1.0 - Activities of head offices M7010M70.2 - Management consultancy activities M702

M70.2.1 - Public relations and communication activities M7021M70.2.2 - Business and other management consultancy activities M7022

M71 - Architectural and engineering activities; technical testing and analysis M71M71.1 - Architectural and engineering activities and related technical consultancy M711

M71.1.1 - Architectural activities M7111M71.1.2 - Engineering activities and related technical consultancy M7112

M71.2 - Technical testing and analysis M712M71.2.0 - Technical testing and analysis M7120

M72 - Scientific research and development M72M72.1 - Research and experimental development on natural sciences and engineeM721

M72.1.1 - Research and experimental development on biotechnology M7211M72.1.9 - Other research and experimental development on natural sciences an M7219

M72.2 - Research and experimental development on social sciences and humaniti M722M72.2.0 - Research and experimental development on social sciences and humanM7220

M73 - Advertising and market research M73M73.1 - Advertising M731

M73.1.1 - Advertising agencies M7311M73.1.2 - Media representation M7312

M73.2 - Market research and public opinion polling M732M73.2.0 - Market research and public opinion polling M7320

M74 - Other professional, scientific and technical activities M74M74.1 - Specialised design activities M741

M74.1.0 - Specialised design activities M7410M74.2 - Photographic activities M742

M74.2.0 - Photographic activities M7420M74.3 - Translation and interpretation activities M743

M74.3.0 - Translation and interpretation activities M7430M74.9 - Other professional, scientific and technical activities n.e.c. M749

M74.9.0 - Other professional, scientific and technical activities n.e.c. M7490M75 - Veterinary activities M75

M75.0 - Veterinary activities M750M75.0.0 - Veterinary activities M7500

N - Administrative and support service activities N

Page 842: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

N77 - Rental and leasing activities N77N77.1 - Renting and leasing of motor vehicles N771

N77.1.1 - Renting and leasing of cars and light motor vehicles N7711N77.1.2 - Renting and leasing of trucks N7712

N77.2 - Renting and leasing of personal and household goods N772N77.2.1 - Renting and leasing of recreational and sports goods N7721N77.2.2 - Renting of video tapes and disks N7722N77.2.9 - Renting and leasing of other personal and household goods N7729

N77.3 - Renting and leasing of other machinery, equipment and tangible goods N773N77.3.1 - Renting and leasing of agricultural machinery and equipment N7731N77.3.2 - Renting and leasing of construction and civil engineering machinery a N7732N77.3.3 - Renting and leasing of office machinery and equipment (including com N7733N77.3.4 - Renting and leasing of water transport equipment N7734N77.3.5 - Renting and leasing of air transport equipment N7735N77.3.9 - Renting and leasing of other machinery, equipment and tangible goods N7739

N77.4 - Leasing of intellectual property and similar products, except copyrighted N774N77.4.0 - Leasing of intellectual property and similar products, except copyright N7740

N78 - Employment activities N78N78.1 - Activities of employment placement agencies N781

N78.1.0 - Activities of employment placement agencies N7810N78.2 - Temporary employment agency activities N782

N78.2.0 - Temporary employment agency activities N7820N78.3 - Other human resources provision N783

N78.3.0 - Other human resources provision N7830N79 - Travel agency, tour operator and other reservation service and related activitiN79

N79.1 - Travel agency and tour operator activities N791N79.1.1 - Travel agency activities N7911N79.1.2 - Tour operator activities N7912

N79.9 - Other reservation service and related activities N799N79.9.0 - Other reservation service and related activities N7990

N80 - Security and investigation activities N80N80.1 - Private security activities N801

N80.1.0 - Private security activities N8010N80.2 - Security systems service activities N802

N80.2.0 - Security systems service activities N8020N80.3 - Investigation activities N803

N80.3.0 - Investigation activities N8030N81 - Services to buildings and landscape activities N81

N81.1 - Combined facilities support activities N811N81.1.0 - Combined facilities support activities N8110

N81.2 - Cleaning activities N812N81.2.1 - General cleaning of buildings N8121N81.2.2 - Other building and industrial cleaning activities N8122N81.2.9 - Other cleaning activities N8129

N81.3 - Landscape service activities N813N81.3.0 - Landscape service activities N8130

N82 - Office administrative, office support and other business support activities N82N82.1 - Office administrative and support activities N821

N82.1.1 - Combined office administrative service activities N8211N82.1.9 - Photocopying, document preparation and other specialised office supporN8219

N82.2 - Activities of call centres N822

Page 843: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

N82.2.0 - Activities of call centres N8220N82.3 - Organisation of conventions and trade shows N823

N82.3.0 - Organisation of conventions and trade shows N8230N82.9 - Business support service activities n.e.c. N829

N82.9.1 - Activities of collection agencies and credit bureaus N8291N82.9.2 - Packaging activities N8292N82.9.9 - Other business support service activities n.e.c. N8299

O - Public administration and defence; compulsory social security OO84 - Public administration and defence; compulsory social security O84

O84.1 - Administration of the State and the economic and social policy of the co O841O84.1.1 - General public administration activities O8411O84.1.2 - Regulation of the activities of providing health care, education, culturalO8412O84.1.3 - Regulation of and contribution to more efficient operation of business O8413

O84.2 - Provision of services to the community as a whole O842O84.2.1 - Foreign affairs O8421O84.2.2 - Defence activities O8422O84.2.3 - Justice and judicial activities O8423O84.2.4 - Public order and safety activities O8424O84.2.5 - Fire service activities O8425

O84.3 - Compulsory social security activities O843O84.3.0 - Compulsory social security activities O8430

P - Education PP85 - Education P85

P85.1 - Pre-primary education P851P85.1.0 - Pre-primary education P8510

P85.2 - Primary education P852P85.2.0 - Primary education P8520

P85.3 - Secondary education P853P85.3.1 - General secondary education P8531P85.3.2 - Technical and vocational secondary education P8532

P85.4 - Higher education P854P85.4.1 - Post-secondary non-tertiary education P8541P85.4.2 - Tertiary education P8542

P85.5 - Other education P855P85.5.1 - Sports and recreation education P8551P85.5.2 - Cultural education P8552P85.5.3 - Driving school activities P8553P85.5.9 - Other education n.e.c. P8559

P85.6 - Educational support activities P856P85.6.0 - Educational support activities P8560

Q - Human health and social work activities QQ86 - Human health activities Q86

Q86.1 - Hospital activities Q861Q86.1.0 - Hospital activities Q8610

Q86.2 - Medical and dental practice activities Q862Q86.2.1 - General medical practice activities Q8621Q86.2.2 - Specialist medical practice activities Q8622Q86.2.3 - Dental practice activities Q8623

Q86.9 - Other human health activities Q869Q86.9.0 - Other human health activities Q8690

Q87 - Residential care activities Q87

Page 844: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Q87.1 - Residential nursing care activities Q871Q87.1.0 - Residential nursing care activities Q8710

Q87.2 - Residential care activities for mental retardation, mental health and subs Q872Q87.2.0 - Residential care activities for mental retardation, mental health and s Q8720

Q87.3 - Residential care activities for the elderly and disabled Q873Q87.3.0 - Residential care activities for the elderly and disabled Q8730

Q87.9 - Other residential care activities Q879Q87.9.0 - Other residential care activities Q8790

Q88 - Social work activities without accommodation Q88Q88.1 - Social work activities without accommodation for the elderly and disabledQ881

Q88.1.0 - Social work activities without accommodation for the elderly and disabQ8810Q88.9 - Other social work activities without accommodation Q889

Q88.9.1 - Child day-care activities Q8891Q88.9.9 - Other social work activities without accommodation n.e.c. Q8899

R - Arts, entertainment and recreation RR90 - Creative, arts and entertainment activities R90

R90.0 - Creative, arts and entertainment activities R900R90.0.1 - Performing arts R9001R90.0.2 - Support activities to performing arts R9002R90.0.3 - Artistic creation R9003R90.0.4 - Operation of arts facilities R9004

R91 - Libraries, archives, museums and other cultural activities R91R91.0 - Libraries, archives, museums and other cultural activities R910

R91.0.1 - Library and archives activities R9101R91.0.2 - Museums activities R9102R91.0.3 - Operation of historical sites and buildings and similar visitor attractionsR9103R91.0.4 - Botanical and zoological gardens and nature reserves activities R9104

R92 - Gambling and betting activities R92R92.0 - Gambling and betting activities R920

R92.0.0 - Gambling and betting activities R9200R93 - Sports activities and amusement and recreation activities R93

R93.1 - Sports activities R931R93.1.1 - Operation of sports facilities R9311R93.1.2 - Activities of sport clubs R9312R93.1.3 - Fitness facilities R9313R93.1.9 - Other sports activities R9319

R93.2 - Amusement and recreation activities R932R93.2.1 - Activities of amusement parks and theme parks R9321R93.2.9 - Other amusement and recreation activities R9329

S - Other services activities SS94 - Activities of membership organisations S94

S94.1 - Activities of business, employers and professional membership organisatioS941S94.1.1 - Activities of business and employers membership organisations S9411S94.1.2 - Activities of professional membership organisations S9412

S94.2 - Activities of trade unions S942S94.2.0 - Activities of trade unions S9420

S94.9 - Activities of other membership organisations S949S94.9.1 - Activities of religious organisations S9491S94.9.2 - Activities of political organisations S9492S94.9.9 - Activities of other membership organisations n.e.c. S9499

S95 - Repair of computers and personal and household goods S95

Page 845: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

S95.1 - Repair of computers and communication equipment S951S95.1.1 - Repair of computers and peripheral equipment S9511S95.1.2 - Repair of communication equipment S9512

S95.2 - Repair of personal and household goods S952S95.2.1 - Repair of consumer electronics S9521S95.2.2 - Repair of household appliances and home and garden equipment S9522S95.2.3 - Repair of footwear and leather goods S9523S95.2.4 - Repair of furniture and home furnishings S9524S95.2.5 - Repair of watches, clocks and jewellery S9525S95.2.9 - Repair of other personal and household goods S9529

S96 - Other personal service activities S96S96.0 - Other personal service activities S960

S96.0.1 - Washing and (dry-)cleaning of textile and fur products S9601S96.0.2 - Hairdressing and other beauty treatment S9602S96.0.3 - Funeral and related activities S9603S96.0.4 - Physical well-being activities S9604S96.0.9 - Other personal service activities n.e.c. S9609

T - Activities of households as employers; undifferentiated goods - and services - prodTT97 - Activities of households as employers of domestic personnel T97

T97.0 - Activities of households as employers of domestic personnel T970T97.0.0 - Activities of households as employers of domestic personnel T9700

T98 - Undifferentiated goods- and services-producing activities of private househol T98T98.1 - Undifferentiated goods-producing activities of private households for own T981

T98.1.0 - Undifferentiated goods-producing activities of private households for T9810T98.2 - Undifferentiated service-producing activities of private households for ow T982

T98.2.0 - Undifferentiated service-producing activities of private households for T9820U - Activities of extraterritorial organisations and bodies U

U99 - Activities of extraterritorial organisations and bodies U99U99.0 - Activities of extraterritorial organisations and bodies U990

U99.0.0 - Activities of extraterritorial organisations and bodie U9900

Page 846: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy node label Sign Weight Owner Usable Applicable dim Applicable s2c N/A S.06.02 (201

Total/NA = s2cA - Agriculture, forestry = + s2cA1 - Crop and animal prod= + s2cA1.1 - Growing of non-pe= + s2cA1.1.1 - Growing of cereals (except + s2cA1.1.2 - Growing of rice + s2cA1.1.3 - Growing of vegetables and + s2cA1.1.4 - Growing of sugar cane + s2cA1.1.5 - Growing of tobacco + s2cA1.1.6 - Growing of fibre crops + s2cA1.1.9 - Growing of other non-peren+ s2cA1.2 - Growing of perenn= + s2cA1.2.1 - Growing of grapes + s2cA1.2.2 - Growing of tropical and subt+ s2cA1.2.3 - Growing of citrus fruits + s2cA1.2.4 - Growing of pome fruits and + s2cA1.2.5 - Growing of other tree and b+ s2cA1.2.6 - Growing of oleaginous fruits+ s2cA1.2.7 - Growing of beverage crops + s2cA1.2.8 - Growing of spices, aromati + s2cA1.2.9 - Growing of other perennial + s2cA1.3 - Plant propagation = + s2cA1.3.0 - Plant propagation + s2cA1.4 - Animal production= + s2cA1.4.1 - Raising of dairy cattle + s2cA1.4.2 - Raising of other cattle and + s2cA1.4.3 - Raising of horses and other + s2cA1.4.4 - Raising of camels and camel+ s2cA1.4.5 - Raising of sheep and goats + s2cA1.4.6 - Raising of swine/pigs + s2cA1.4.7 - Raising of poultry + s2cA1.4.9 - Raising of other animals + s2cA1.5 - Mixed farming = + s2cA1.5.0 - Mixed farming + s2cA1.6 - Support activities = + s2cA1.6.1 - Support activities for crop + s2cA1.6.2 - Support activities for anima+ s2cA1.6.3 - Post-harvest crop activities + s2cA1.6.4 - Seed processing for propaga+ s2cA1.7 - Hunting, trapping a= + s2cA1.7.0 - Hunting, trapping and related+ s2cA2 - Forestry and logging= + s2cA2.1 - Silviculture and oth= + s2cA2.1.0 - Silviculture and other forestr+ s2cA2.2 - Logging = + s2cA2.2.0 - Logging + s2cA2.3 - Gathering of wild = + s2cA2.3.0 - Gathering of wild growing + s2cA2.4 - Support services to= + s2c

Page 847: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

A2.4.0 - Support services to forestry+ s2cA3 - Fishing and aquacul = + s2cA3.1 - Fishing = + s2cA3.1.1 - Marine fishing + s2cA3.1.2 - Freshwater fishing + s2cA3.2 - Aquaculture = + s2cA3.2.1 - Marine aquaculture + s2cA3.2.2 - Freshwater aquaculture + s2cB - Mining and quarrying= + s2cB5 - Mining of coal and li= + s2cB5.1 - Mining of hard coa= + s2cB5.1.0 - Mining of hard coal + s2cB5.2 - Mining of lignite = + s2cB5.2.0 - Mining of lignite + s2cB6 - Extraction of crude = + s2cB6.1 - Extraction of crud = + s2cB6.1.0 - Extraction of crude petrole + s2cB6.2 - Extraction of natur= + s2cB6.2.0 - Extraction of natural gas + s2cB7 - Mining of metal ores= + s2cB7.1 - Mining of iron ore = + s2cB7.1.0 - Mining of iron ores + s2cB7.2 - Mining of non-fer = + s2cB7.2.1 - Mining of uranium and thor+ s2cB7.2.9 - Mining of other non-ferrous+ s2cB8 - Other mining and qu= + s2cB8.1 - Quarrying of stone= + s2cB8.1.1 - Quarrying of ornamental and+ s2cB8.1.2 - Operation of gravel and sand+ s2cB8.9 - Mining and quarryi= + s2cB8.9.1 - Mining of chemical and ferti+ s2cB8.9.2 - Extraction of peat + s2cB8.9.3 - Extraction of salt + s2cB8.9.9 - Other mining and quarrying + s2cB9 - Mining support servic= + s2cB9.1 - Support activities = + s2cB9.1.0 - Support activities for petro + s2cB9.9 - Support activities = + s2cB9.9.0 - Support activities for other + s2cC - Manufacturing = + s2cC10 - Manufacture of fo = + s2cC10.1 - Processing and p = + s2cC10.1.1 - Processing and preserving + s2cC10.1.2 - Processing and preserving + s2cC10.1.3 - Production of meat and po+ s2cC10.2 - Processing and pr= + s2cC10.2.0 - Processing and preserving + s2cC10.3 - Processing and pr= + s2cC10.3.1 - Processing and preserving + s2cC10.3.2 - Manufacture of fruit and v+ s2cC10.3.9 - Other processing and prese+ s2c

Page 848: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C10.4 - Manufacture of v= + s2cC10.4.1 - Manufacture of oils and fa + s2cC10.4.2 - Manufacture of margarine a+ s2cC10.5 - Manufacture of d= + s2cC10.5.1 - Operation of dairies and + s2cC10.5.2 - Manufacture of ice cream + s2cC10.6 - Manufacture of gr= + s2cC10.6.1 - Manufacture of grain mill + s2cC10.6.2 - Manufacture of starches a + s2cC10.7 - Manufacture of b= + s2cC10.7.1 - Manufacture of bread; man+ s2cC10.7.2 - Manufacture of rusks and + s2cC10.7.3 - Manufacture of macaroni, + s2cC10.8 - Manufacture of o= + s2cC10.8.1 - Manufacture of sugar + s2cC10.8.2 - Manufacture of cocoa, cho+ s2cC10.8.3 - Processing of tea and coff + s2cC10.8.4 - Manufacture of condiment+ s2cC10.8.5 - Manufacture of prepared + s2cC10.8.6 - Manufacture of homogenis+ s2cC10.8.9 - Manufacture of other food + s2cC10.9 - Manufacture of p= + s2cC10.9.1 - Manufacture of prepared f+ s2cC10.9.2 - Manufacture of prepared p+ s2cC11 - Manufacture of be = + s2cC11.0 - Manufacture of = + s2cC11.0.1 - Distilling, rectifying and bl + s2cC11.0.2 - Manufacture of wine from+ s2cC11.0.3 - Manufacture of cider and o+ s2cC11.0.4 - Manufacture of other non-+ s2cC11.0.5 - Manufacture of beer + s2cC11.0.6 - Manufacture of malt + s2cC11.0.7 - Manufacture of soft drinks+ s2cC12 - Manufacture of to = + s2cC12.0 - Manufacture of t= + s2cC12.0.0 - Manufacture of tobacco p + s2cC13 - Manufacture of text= + s2cC13.1 - Preparation and sp= + s2cC13.1.0 - Preparation and spinning of+ s2cC13.2 - Weaving of textil = + s2cC13.2.0 - Weaving of textiles + s2cC13.3 - Finishing of textil= + s2cC13.3.0 - Finishing of textiles + s2cC13.9 - Manufacture of ot= + s2cC13.9.1 - Manufacture of knitted an + s2cC13.9.2 - Manufacture of made-up tex+ s2cC13.9.3 - Manufacture of carpets an+ s2cC13.9.4 - Manufacture of cordage, r + s2cC13.9.5 - Manufacture of non-woven+ s2cC13.9.6 - Manufacture of other techni+ s2cC13.9.9 - Manufacture of other textil+ s2c

Page 849: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C14 - Manufacture of we= + s2cC14.1 - Manufacture of w= + s2cC14.1.1 - Manufacture of leather clo+ s2cC14.1.2 - Manufacture of workwear + s2cC14.1.3 - Manufacture of other out + s2cC14.1.4 - Manufacture of underwear+ s2cC14.1.9 - Manufacture of other wear+ s2cC14.2 - Manufacture of ar= + s2cC14.2.0 - Manufacture of articles of + s2cC14.3 - Manufacture of k= + s2cC14.3.1 - Manufacture of knitted an + s2cC14.3.9 - Manufacture of other knit + s2cC15 - Manufacture of lea= + s2cC15.1 - Tanning and dress= + s2cC15.1.1 - Tanning and dressing of lea+ s2cC15.1.2 - Manufacture of luggage, h+ s2cC15.2 - Manufacture of = + s2cC15.2.0 - Manufacture of footwear + s2cC16 - Manufacture of wood= + s2cC16.1 - Sawmilling and p = + s2cC16.1.0 - Sawmilling and planing of + s2cC16.2 - Manufacture of pr= + s2cC16.2.1 - Manufacture of veneer sh + s2cC16.2.2 - Manufacture of assembled + s2cC16.2.3 - Manufacture of other build+ s2cC16.2.4 - Manufacture of wooden co+ s2cC16.2.9 - Manufacture of other produ+ s2cC17 - Manufacture of pa = + s2cC17.1 - Manufacture of = + s2cC17.1.1 - Manufacture of pulp + s2cC17.1.2 - Manufacture of paper and + s2cC17.2 - Manufacture of a= + s2cC17.2.1 - Manufacture of corrugate + s2cC17.2.2 - Manufacture of household a+ s2cC17.2.3 - Manufacture of paper stat + s2cC17.2.4 - Manufacture of wallpaper + s2cC17.2.9 - Manufacture of other arti + s2cC18 - Printing and repro = + s2cC18.1 - Printing and servi= + s2cC18.1.1 - Printing of newspapers + s2cC18.1.2 - Other printing + s2cC18.1.3 - Pre-press and pre-media se+ s2cC18.1.4 - Binding and related service+ s2cC18.2 - Reproduction of = + s2cC18.2.0 - Reproduction of recorded + s2cC19 - Manufacture of cok= + s2cC19.1 - Manufacture of = + s2cC19.1.0 - Manufacture of coke oven + s2cC19.2 - Manufacture of r= + s2cC19.2.0 - Manufacture of refined pe+ s2cC20 - Manufacture of che= + s2c

Page 850: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C20.1 - Manufacture of ba= + s2cC20.1.1 - Manufacture of industrial + s2cC20.1.2 - Manufacture of dyes and + s2cC20.1.3 - Manufacture of other inorg+ s2cC20.1.4 - Manufacture of other orga+ s2cC20.1.5 - Manufacture of fertiliser + s2cC20.1.6 - Manufacture of plastics in + s2cC20.1.7 - Manufacture of synthetic + s2cC20.2 - Manufacture of p= + s2cC20.2.0 - Manufacture of pesticides + s2cC20.3 - Manufacture of pa= + s2cC20.3.0 - Manufacture of paints, varn+ s2cC20.4 - Manufacture of s= + s2cC20.4.1 - Manufacture of soap and d+ s2cC20.4.2 - Manufacture of perfumes a+ s2cC20.5 - Manufacture of o= + s2cC20.5.1 - Manufacture of explosives+ s2cC20.5.2 - Manufacture of glues + s2cC20.5.3 - Manufacture of essential oi+ s2cC20.5.9 - Manufacture of other chem+ s2cC20.6 - Manufacture of = + s2cC20.6.0 - Manufacture of man-made + s2cC21 - Manufacture of bas= + s2cC21.1 - Manufacture of b= + s2cC21.1.0 - Manufacture of basic phar+ s2cC21.2 - Manufacture of p= + s2cC21.2.0 - Manufacture of pharmaceu+ s2cC22 - Manufacture of rub= + s2cC22.1 - Manufacture of r= + s2cC22.1.1 - Manufacture of rubber tyre+ s2cC22.1.9 - Manufacture of other rubb+ s2cC22.2 - Manufacture of p= + s2cC22.2.1 - Manufacture of plastic plat+ s2cC22.2.2 - Manufacture of plastic pa + s2cC22.2.3 - Manufacture of builders’ w+ s2cC22.2.9 - Manufacture of other plast+ s2cC23 - Manufacture of oth= + s2cC23.1 - Manufacture of g= + s2cC23.1.1 - Manufacture of flat glass + s2cC23.1.2 - Shaping and processing of f+ s2cC23.1.3 - Manufacture of hollow gla+ s2cC23.1.4 - Manufacture of glass fibre + s2cC23.1.9 - Manufacture and processing+ s2cC23.2 - Manufacture of r= + s2cC23.2.0 - Manufacture of refractory + s2cC23.3 - Manufacture of cl= + s2cC23.3.1 - Manufacture of ceramic til+ s2cC23.3.2 - Manufacture of bricks, tile + s2cC23.4 - Manufacture of o= + s2cC23.4.1 - Manufacture of ceramic ho+ s2cC23.4.2 - Manufacture of ceramic san+ s2c

Page 851: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C23.4.3 - Manufacture of ceramic insu+ s2cC23.4.4 - Manufacture of other tech+ s2cC23.4.9 - Manufacture of other cera+ s2cC23.5 - Manufacture of c= + s2cC23.5.1 - Manufacture of cement + s2cC23.5.2 - Manufacture of lime and p+ s2cC23.6 - Manufacture of ar= + s2cC23.6.1 - Manufacture of concrete p+ s2cC23.6.2 - Manufacture of plaster pr + s2cC23.6.3 - Manufacture of ready-mix + s2cC23.6.4 - Manufacture of mortars + s2cC23.6.5 - Manufacture of fibre ceme+ s2cC23.6.9 - Manufacture of other artic+ s2cC23.7 - Cutting, shaping a= + s2cC23.7.0 - Cutting, shaping and finish + s2cC23.9 - Manufacture of a= + s2cC23.9.1 - Production of abrasive pro+ s2cC23.9.9 - Manufacture of other non-m+ s2cC24 - Manufacture of bas= + s2cC24.1 - Manufacture of ba= + s2cC24.1.0 - Manufacture of basic iron a+ s2cC24.2 - Manufacture of tub= + s2cC24.2.0 - Manufacture of tubes, pipes,+ s2cC24.3 - Manufacture of ot= + s2cC24.3.1 - Cold drawing of bars + s2cC24.3.2 - Cold rolling of narrow strip+ s2cC24.3.3 - Cold forming or folding + s2cC24.3.4 - Cold drawing of wire + s2cC24.4 - Manufacture of b= + s2cC24.4.1 - Precious metals productio + s2cC24.4.2 - Aluminium production + s2cC24.4.3 - Lead, zinc and tin producti + s2cC24.4.4 - Copper production + s2cC24.4.5 - Other non-ferrous metal p+ s2cC24.4.6 - Processing of nuclear fuel + s2cC24.5 - Casting of metals= + s2cC24.5.1 - Casting of iron + s2cC24.5.2 - Casting of steel + s2cC24.5.3 - Casting of light metals + s2cC24.5.4 - Casting of other non-ferro + s2cC25 - Manufacture of fa = + s2cC25.1 - Manufacture of s= + s2cC25.1.1 - Manufacture of metal struc+ s2cC25.1.2 - Manufacture of doors and + s2cC25.2 - Manufacture of ta= + s2cC25.2.1 - Manufacture of central hea+ s2cC25.2.9 - Manufacture of other tanks+ s2cC25.3 - Manufacture of s= + s2cC25.3.0 - Manufacture of steam gener+ s2cC25.4 - Manufacture of = + s2cC25.4.0 - Manufacture of weapons + s2c

Page 852: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C25.5 - Forging, pressing = + s2cC25.5.0 - Forging, pressing, stampin + s2cC25.6 - Treatment and co= + s2cC25.6.1 - Treatment and coating of + s2cC25.6.2 - Machining + s2cC25.7 - Manufacture of c= + s2cC25.7.1 - Manufacture of cutlery + s2cC25.7.2 - Manufacture of locks and + s2cC25.7.3 - Manufacture of tools + s2cC25.9 - Manufacture of o= + s2cC25.9.1 - Manufacture of steel drums+ s2cC25.9.2 - Manufacture of light meta + s2cC25.9.3 - Manufacture of wire produ+ s2cC25.9.4 - Manufacture of fasteners + s2cC25.9.9 - Manufacture of other fabri+ s2cC26 - Manufacture of com= + s2cC26.1 - Manufacture of = + s2cC26.1.1 - Manufacture of electroni + s2cC26.1.2 - Manufacture of loaded ele+ s2cC26.2 - Manufacture of = + s2cC26.2.0 - Manufacture of computers+ s2cC26.3 - Manufacture of = + s2cC26.3.0 - Manufacture of communic+ s2cC26.4 - Manufacture of c= + s2cC26.4.0 - Manufacture of consumer e+ s2cC26.5 - Manufacture of i = + s2cC26.5.1 - Manufacture of instrument+ s2cC26.5.2 - Manufacture of watches an+ s2cC26.6 - Manufacture of i = + s2cC26.6.0 - Manufacture of irradiatio + s2cC26.7 - Manufacture of o= + s2cC26.7.0 - Manufacture of optical i + s2cC26.8 - Manufacture of m= + s2cC26.8.0 - Manufacture of magnetic a+ s2cC27 - Manufacture of ele= + s2cC27.1 - Manufacture of el= + s2cC27.1.1 - Manufacture of electric m + s2cC27.1.2 - Manufacture of electricity + s2cC27.2 - Manufacture of b= + s2cC27.2.0 - Manufacture of batteries + s2cC27.3 - Manufacture of w= + s2cC27.3.1 - Manufacture of fibre optic+ s2cC27.3.2 - Manufacture of other elect+ s2cC27.3.3 - Manufacture of wiring dev+ s2cC27.4 - Manufacture of el= + s2cC27.4.0 - Manufacture of electric li + s2cC27.5 - Manufacture of d= + s2cC27.5.1 - Manufacture of electric do+ s2cC27.5.2 - Manufacture of non-electr+ s2cC27.9 - Manufacture of o= + s2cC27.9.0 - Manufacture of other elec + s2c

Page 853: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C28 - Manufacture of ma= + s2cC28.1 - Manufacture of = + s2cC28.1.1 - Manufacture of engines and+ s2cC28.1.2 - Manufacture of fluid pow + s2cC28.1.3 - Manufacture of other pu + s2cC28.1.4 - Manufacture of other taps+ s2cC28.1.5 - Manufacture of bearings, g+ s2cC28.2 - Manufacture of = + s2cC28.2.1 - Manufacture of ovens, fur + s2cC28.2.2 - Manufacture of lifting an + s2cC28.2.3 - Manufacture of office ma + s2cC28.2.4 - Manufacture of power-dri + s2cC28.2.5 - Manufacture of non-domes+ s2cC28.2.9 - Manufacture of other gene+ s2cC28.3 - Manufacture of a= + s2cC28.3.0 - Manufacture of agricultura+ s2cC28.4 - Manufacture of = + s2cC28.4.1 - Manufacture of metal for + s2cC28.4.9 - Manufacture of other mach+ s2cC28.9 - Manufacture of o= + s2cC28.9.1 - Manufacture of machinery + s2cC28.9.2 - Manufacture of machinery + s2cC28.9.3 - Manufacture of machinery + s2cC28.9.4 - Manufacture of machinery f+ s2cC28.9.5 - Manufacture of machinery+ s2cC28.9.6 - Manufacture of plastics a + s2cC28.9.9 - Manufacture of other spec+ s2cC29 - Manufacture of moto= + s2cC29.1 - Manufacture of m= + s2cC29.1.0 - Manufacture of motor vehi+ s2cC29.2 - Manufacture of bo= + s2cC29.2.0 - Manufacture of bodies (coa+ s2cC29.3 - Manufacture of p= + s2cC29.3.1 - Manufacture of electrical + s2cC29.3.2 - Manufacture of other parts+ s2cC30 - Manufacture of ot = + s2cC30.1 - Building of ships = + s2cC30.1.1 - Building of ships and floati + s2cC30.1.2 - Building of pleasure and s + s2cC30.2 - Manufacture of ra= + s2cC30.2.0 - Manufacture of railway loc+ s2cC30.3 - Manufacture of a= + s2cC30.3.0 - Manufacture of air and sp + s2cC30.4 - Manufacture of mi= + s2cC30.4.0 - Manufacture of military fig+ s2cC30.9 - Manufacture of t= + s2cC30.9.1 - Manufacture of motorcycl + s2cC30.9.2 - Manufacture of bicycles an+ s2cC30.9.9 - Manufacture of other tran + s2cC31 - Manufacture of fur= + s2cC31.0 - Manufacture of f = + s2c

Page 854: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

C31.0.1 - Manufacture of office and + s2cC31.0.2 - Manufacture of kitchen fur+ s2cC31.0.3 - Manufacture of mattresses+ s2cC31.0.9 - Manufacture of other furni+ s2cC32 - Other manufacturi = + s2cC32.1 - Manufacture of je= + s2cC32.1.1 - Striking of coins + s2cC32.1.2 - Manufacture of jewellery a+ s2cC32.1.3 - Manufacture of imitation je+ s2cC32.2 - Manufacture of m= + s2cC32.2.0 - Manufacture of musical in + s2cC32.3 - Manufacture of s= + s2cC32.3.0 - Manufacture of sports goo+ s2cC32.4 - Manufacture of = + s2cC32.4.0 - Manufacture of games and+ s2cC32.5 - Manufacture of m= + s2cC32.5.0 - Manufacture of medical an+ s2cC32.9 - Manufacturing n.= + s2cC32.9.1 - Manufacture of brooms an+ s2cC32.9.9 - Other manufacturing n.e.c.+ s2cC33 - Repair and install = + s2cC33.1 - Repair of fabric = + s2cC33.1.1 - Repair of fabricated metal + s2cC33.1.2 - Repair of machinery + s2cC33.1.3 - Repair of electronic and o + s2cC33.1.4 - Repair of electrical equip + s2cC33.1.5 - Repair and maintenance of+ s2cC33.1.6 - Repair and maintenance of + s2cC33.1.7 - Repair and maintenance o + s2cC33.1.9 - Repair of other equipment+ s2cC33.2 - Installation of i = + s2cC33.2.0 - Installation of industrial + s2cD - Electricity, gas, stea = + s2cD35 - Electricity, gas, st = + s2cD35.1 - Electric power ge= + s2cD35.1.1 - Production of electricity + s2cD35.1.2 - Transmission of electricity + s2cD35.1.3 - Distribution of electricity + s2cD35.1.4 - Trade of electricity + s2cD35.2 - Manufacture of ga= + s2cD35.2.1 - Manufacture of gas + s2cD35.2.2 - Distribution of gaseous fu + s2cD35.2.3 - Trade of gas through main+ s2cD35.3 - Steam and air co = + s2cD35.3.0 - Steam and air conditioning+ s2cE - Water supply; sewera= + s2cE36 - Water collection, = + s2cE36.0 - Water collection = + s2cE36.0.0 - Water collection, treatmen+ s2cE37 - Sewerage = + s2cE37.0 - Sewerage = + s2c

Page 855: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

E37.0.0 - Sewerage + s2cE38 - Waste collection, t = + s2cE38.1 - Waste collection = + s2cE38.1.1 - Collection of non-hazardo + s2cE38.1.2 - Collection of hazardous wa+ s2cE38.2 - Waste treatment = + s2cE38.2.1 - Treatment and disposal of + s2cE38.2.2 - Treatment and disposal of + s2cE38.3 - Materials recover= + s2cE38.3.1 - Dismantling of wrecks + s2cE38.3.2 - Recovery of sorted materia+ s2cE39 - Remediation activi = + s2cE39.0 - Remediation acti = + s2cE39.0.0 - Remediation activities an + s2cF - Construction = + s2cF41 - Construction of bui= + s2cF41.1 - Development of b= + s2cF41.1.0 - Development of building pr+ s2cF41.2 - Construction of r = + s2cF41.2.0 - Construction of residential + s2cF42 - Civil engineering = + s2cF42.1 - Construction of r = + s2cF42.1.1 - Construction of roads and + s2cF42.1.2 - Construction of railways + s2cF42.1.3 - Construction of bridges an + s2cF42.2 - Construction of ut= + s2cF42.2.1 - Construction of utility proje+ s2cF42.2.2 - Construction of utility pro + s2cF42.9 - Construction of ot= + s2cF42.9.1 - Construction of water proj + s2cF42.9.9 - Construction of other civil + s2cF43 - Specialised construc= + s2cF43.1 - Demolition and si= + s2cF43.1.1 - Demolition + s2cF43.1.2 - Site preparation + s2cF43.1.3 - Test drilling and boring + s2cF43.2 - Electrical, plumbi= + s2cF43.2.1 - Electrical installation + s2cF43.2.2 - Plumbing, heat and air-cond+ s2cF43.2.9 - Other construction installa+ s2cF43.3 - Building completi= + s2cF43.3.1 - Plastering + s2cF43.3.2 - Joinery installation + s2cF43.3.3 - Floor and wall covering + s2cF43.3.4 - Painting and glazing + s2cF43.3.9 - Other building completion + s2cF43.9 - Other specialised = + s2cF43.9.1 - Roofing activities + s2cF43.9.9 - Other specialised constructi+ s2cG - Wholesale and retail = + s2cG45 - Wholesale and reta= + s2c

Page 856: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

G45.1 - Sale of motor veh= + s2cG45.1.1 - Sale of cars and light moto+ s2cG45.1.9 - Sale of other motor vehicl + s2cG45.2 - Maintenance and = + s2cG45.2.0 - Maintenance and repair of+ s2cG45.3 - Sale of motor veh= + s2cG45.3.1 - Wholesale trade of motor v+ s2cG45.3.2 - Retail trade of motor vehic+ s2cG45.4 - Sale, maintenanc= + s2cG45.4.0 - Sale, maintenance and repa+ s2cG46 - Wholesale trade, e= + s2cG46.1 - Wholesale on a fe= + s2cG46.1.1 - Agents involved in the sale+ s2cG46.1.2 - Agents involved in the sale+ s2cG46.1.3 - Agents involved in the sale+ s2cG46.1.4 - Agents involved in the sale+ s2cG46.1.5 - Agents involved in the sa + s2cG46.1.6 - Agents involved in the sale+ s2cG46.1.7 - Agents involved in the sal + s2cG46.1.8 - Agents specialised in the s + s2cG46.1.9 - Agents involved in the sale+ s2cG46.2 - Wholesale of agri= + s2cG46.2.1 - Wholesale of grain, unman+ s2cG46.2.2 - Wholesale of flowers and + s2cG46.2.3 - Wholesale of live animals + s2cG46.2.4 - Wholesale of hides, skins + s2cG46.3 - Wholesale of foo= + s2cG46.3.1 - Wholesale of fruit and veg+ s2cG46.3.2 - Wholesale of meat and me+ s2cG46.3.3 - Wholesale of dairy products+ s2cG46.3.4 - Wholesale of beverages + s2cG46.3.5 - Wholesale of tobacco prod+ s2cG46.3.6 - Wholesale of sugar and ch+ s2cG46.3.7 - Wholesale of coffee, tea, + s2cG46.3.8 - Wholesale of other food, i + s2cG46.3.9 - Non-specialised wholesale+ s2cG46.4 - Wholesale of ho = + s2cG46.4.1 - Wholesale of textiles + s2cG46.4.2 - Wholesale of clothing and + s2cG46.4.3 - Wholesale of electrical ho + s2cG46.4.4 - Wholesale of china and gl + s2cG46.4.5 - Wholesale of perfume and+ s2cG46.4.6 - Wholesale of pharmaceuti+ s2cG46.4.7 - Wholesale of furniture, ca + s2cG46.4.8 - Wholesale of watches and + s2cG46.4.9 - Wholesale of other house + s2cG46.5 - Wholesale of in = + s2cG46.5.1 - Wholesale of computers, + s2cG46.5.2 - Wholesale of electronic + s2cG46.6 - Wholesale of oth= + s2cG46.6.1 - Wholesale of agricultural + s2c

Page 857: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

G46.6.2 - Wholesale of machine tool+ s2cG46.6.3 - Wholesale of mining, const+ s2cG46.6.4 - Wholesale of machinery for+ s2cG46.6.5 - Wholesale of office furnitu+ s2cG46.6.6 - Wholesale of other offic + s2cG46.6.9 - Wholesale of other machi + s2cG46.7 - Other specialise = + s2cG46.7.1 - Wholesale of solid, liquid + s2cG46.7.2 - Wholesale of metals and m+ s2cG46.7.3 - Wholesale of wood, constr+ s2cG46.7.4 - Wholesale of hardware, p + s2cG46.7.5 - Wholesale of chemical pro+ s2cG46.7.6 - Wholesale of other interm+ s2cG46.7.7 - Wholesale of waste and sc+ s2cG46.9 - Non-specialised = + s2cG46.9.0 - Non-specialised wholesale+ s2cG47 - Retail trade, excep= + s2cG47.1 - Retail sale in non= + s2cG47.1.1 - Retail sale in non-special + s2cG47.1.9 - Other retail sale in non-spe+ s2cG47.2 - Retail sale of fo = + s2cG47.2.1 - Retail sale of fruit and veg + s2cG47.2.2 - Retail sale of meat and mea+ s2cG47.2.3 - Retail sale of fish, crustac + s2cG47.2.4 - Retail sale of bread, cakes + s2cG47.2.5 - Retail sale of beverages in + s2cG47.2.6 - Retail sale of tobacco prod+ s2cG47.2.9 - Other retail sale of food in+ s2cG47.3 - Retail sale of aut = + s2cG47.3.0 - Retail sale of automotive fu+ s2cG47.4 - Retail sale of i = + s2cG47.4.1 - Retail sale of computers, p+ s2cG47.4.2 - Retail sale of telecommuni+ s2cG47.4.3 - Retail sale of audio and vi + s2cG47.5 - Retail sale of ot = + s2cG47.5.1 - Retail sale of textiles in sp + s2cG47.5.2 - Retail sale of hardware, pai+ s2cG47.5.3 - Retail sale of carpets, rugs + s2cG47.5.4 - Retail sale of electrical ho + s2cG47.5.9 - Retail sale of furniture, l + s2cG47.6 - Retail sale of cul = + s2cG47.6.1 - Retail sale of books in spec+ s2cG47.6.2 - Retail sale of newspapers a+ s2cG47.6.3 - Retail sale of music and vi + s2cG47.6.4 - Retail sale of sporting equ + s2cG47.6.5 - Retail sale of games and to+ s2cG47.7 - Retail sale of oth = + s2cG47.7.1 - Retail sale of clothing in s + s2cG47.7.2 - Retail sale of footwear and+ s2cG47.7.3 - Dispensing chemist in speci+ s2cG47.7.4 - Retail sale of medical and + s2c

Page 858: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

G47.7.5 - Retail sale of cosmetic and + s2cG47.7.6 - Retail sale of flowers, plan+ s2cG47.7.7 - Retail sale of watches and + s2cG47.7.8 - Other retail sale of new go+ s2cG47.7.9 - Retail sale of second-hand+ s2cG47.8 - Retail sale via st = + s2cG47.8.1 - Retail sale via stalls and + s2cG47.8.2 - Retail sale via stalls and m + s2cG47.8.9 - Retail sale via stalls and + s2cG47.9 - Retail trade not i = + s2cG47.9.1 - Retail sale via mail order h+ s2cG47.9.9 - Other retail sale not in sto + s2cH - Transporting and sto = + s2cH49 - Land transport and = + s2cH49.1 - Passenger rail tr = + s2cH49.1.0 - Passenger rail transport, i + s2cH49.2 - Freight rail trans = + s2cH49.2.0 - Freight rail transport + s2cH49.3 - Other passenger = + s2cH49.3.1 - Urban and suburban passe+ s2cH49.3.2 - Taxi operation + s2cH49.3.9 - Other passenger land trans+ s2cH49.4 - Freight transport= + s2cH49.4.1 - Freight transport by road + s2cH49.4.2 - Removal services + s2cH49.5 - Transport via pip= + s2cH49.5.0 - Transport via pipeline + s2cH50 - Water transport = + s2cH50.1 - Sea and coastal = + s2cH50.1.0 - Sea and coastal passenger+ s2cH50.2 - Sea and coastal f= + s2cH50.2.0 - Sea and coastal freight wa+ s2cH50.3 - Inland passenger= + s2cH50.3.0 - Inland passenger water tr + s2cH50.4 - Inland freight wa= + s2cH50.4.0 - Inland freight water transp+ s2cH51 - Air transport = + s2cH51.1 - Passenger air tra = + s2cH51.1.0 - Passenger air transport + s2cH51.2 - Freight air trans = + s2cH51.2.1 - Freight air transport + s2cH51.2.2 - Space transport + s2cH52 - Warehousing and su= + s2cH52.1 - Warehousing and= + s2cH52.1.0 - Warehousing and storage + s2cH52.2 - Support activities= + s2cH52.2.1 - Service activities incidenta+ s2cH52.2.2 - Service activities incident + s2cH52.2.3 - Service activities incidenta+ s2cH52.2.4 - Cargo handling + s2cH52.2.9 - Other transportation suppor+ s2c

Page 859: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

H53 - Postal and courier a= + s2cH53.1 - Postal activities = + s2cH53.1.0 - Postal activities under univ+ s2cH53.2 - Other postal and c= + s2cH53.2.0 - Other postal and courier ac+ s2cI - Accommodation and foo= + s2cI55 - Accommodation = + s2cI55.1 - Hotels and simil = + s2cI55.1.0 - Hotels and similar accomm + s2cI55.2 - Holiday and othe = + s2cI55.2.0 - Holiday and other short-s + s2cI55.3 - Camping grounds, = + s2cI55.3.0 - Camping grounds, recreation+ s2cI55.9 - Other accommoda= + s2cI55.9.0 - Other accommodation + s2cI56 - Food and beverage s= + s2cI56.1 - Restaurants and m= + s2cI56.1.0 - Restaurants and mobile food+ s2cI56.2 - Event catering and= + s2cI56.2.1 - Event catering activities + s2cI56.2.9 - Other food service activitie + s2cI56.3 - Beverage serving a= + s2cI56.3.0 - Beverage serving activities + s2cJ - Information and com = + s2cJ58 - Publishing activities= + s2cJ58.1 - Publishing of books, periodica+ s2cJ58.1.1 - Book publishing + s2cJ58.1.2 - Publishing of directories and+ s2cJ58.1.3 - Publishing of newspapers + s2cJ58.1.4 - Publishing of journals and p+ s2cJ58.1.9 - Other publishing activities + s2cJ58.2 - Software publishing + s2cJ58.2.1 - Publishing of computer ga + s2cJ58.2.9 - Other software publishing + s2cJ59 - Motion picture, vi = + s2cJ59.1 - Motion picture, video and te + s2cJ59.1.1 - Motion picture, video and + s2cJ59.1.2 - Motion picture, video and + s2cJ59.1.3 - Motion picture, video and t+ s2cJ59.1.4 - Motion picture projection ac+ s2cJ59.2 - Sound recording a= + s2cJ59.2.0 - Sound recording and music p+ s2cJ60 - Programming and br= + s2cJ60.1 - Radio broadcastin= + s2cJ60.1.0 - Radio broadcasting + s2cJ60.2 - Television progra = + s2cJ60.2.0 - Television programming and+ s2cJ61 - Telecommunication= + s2cJ61.1 - Wired telecommuni= + s2cJ61.1.0 - Wired telecommunications a+ s2cJ61.2 - Wireless telecomm= + s2c

Page 860: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

J61.2.0 - Wireless telecommunication+ s2cJ61.3 - Satellite telecomm= + s2cJ61.3.0 - Satellite telecommunication+ s2cJ61.9 - Other telecommuni= + s2cJ61.9.0 - Other telecommunications a+ s2cJ62 - Computer programmi= + s2cJ62.0 - Computer program= + s2cJ62.0.1 - Computer programming acti+ s2cJ62.0.2 - Computer consultancy activ+ s2cJ62.0.3 - Computer facilities manage+ s2cJ62.0.9 - Other information technolo+ s2cJ63 - Information service = + s2cJ63.1 - Data processing, h= + s2cJ63.1.1 - Data processing, hosting and+ s2cJ63.1.2 - Web portals + s2cJ63.9 - Other information = + s2cJ63.9.1 - News agency activities + s2cJ63.9.9 - Other information service ac+ s2cK - Financial and insuranc= + s2c noK64 - Financial service a = + s2c noK64.1 - Monetary interm= + s2c noK64.1.1 - Central banking + s2cK64.1.9 - Other monetary intermedi+ s2cK64.2 - Activities of hol = + s2c noK64.2.0 - Activities of holding compa+ s2cK64.3 - Trusts, funds and = + s2c noK64.3.0 - Trusts, funds and similar fi + s2cK64.9 - Other financial s = + s2c noK64.9.1 - Financial leasing + s2cK64.9.2 - Other credit granting + s2cK64.9.9 - Other financial service act + s2cK65 - Insurance, reinsura= + s2c noK65.1 - Insurance = + s2c noK65.1.1 - Life insurance + s2cK65.1.2 - Non-life insurance + s2cK65.2 - Reinsurance = + s2c noK65.2.0 - Reinsurance + s2cK65.3 - Pension funding = + s2c noK65.3.0 - Pension funding + s2cK66 - Activities auxiliary = + s2c noK66.1 - Activities auxilia = + s2c noK66.1.1 - Administration of financia + s2cK66.1.2 - Security and commodity co+ s2cK66.1.9 - Other activities auxiliary + s2cK66.2 - Activities auxili = + s2c noK66.2.1 - Risk and damage evaluatio+ s2cK66.2.2 - Activities of insurance age + s2cK66.2.9 - Other activities auxiliary + s2cK66.3 - Fund management = + s2c noK66.3.0 - Fund management activitie+ s2cL - Real estate activities = + s2c

Page 861: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

L68 - Real estate activitie= + s2cL68.1 - Buying and sellin = + s2cL68.1.0 - Buying and selling of own r+ s2cL68.2 - Renting and opera= + s2cL68.2.0 - Renting and operating of o + s2cL68.3 - Real estate activi = + s2cL68.3.1 - Real estate agencies + s2cL68.3.2 - Management of real estate + s2cM - Professional, scientifi= + s2cM69 - Legal and accountin= + s2cM69.1 - Legal activities = + s2cM69.1.0 - Legal activities + s2cM69.2 - Accounting, bookk= + s2cM69.2.0 - Accounting, bookkeeping an+ s2cM70 - Activities of head = + s2cM70.1 - Activities of head= + s2cM70.1.0 - Activities of head offices + s2cM70.2 - Management cons= + s2cM70.2.1 - Public relations and commu+ s2cM70.2.2 - Business and other manag+ s2cM71 - Architectural and e= + s2cM71.1 - Architectural and= + s2cM71.1.1 - Architectural activities + s2cM71.1.2 - Engineering activities and + s2cM71.2 - Technical testing= + s2cM71.2.0 - Technical testing and anal+ s2cM72 - Scientific researc = + s2cM72.1 - Research and ex= + s2cM72.1.1 - Research and experiment + s2cM72.1.9 - Other research and exper + s2cM72.2 - Research and ex= + s2cM72.2.0 - Research and experimenta+ s2cM73 - Advertising and ma= + s2cM73.1 - Advertising = + s2cM73.1.1 - Advertising agencies + s2cM73.1.2 - Media representation + s2cM73.2 - Market research = + s2cM73.2.0 - Market research and publi+ s2cM74 - Other professional, = + s2cM74.1 - Specialised design= + s2cM74.1.0 - Specialised design activiti + s2cM74.2 - Photographic acti= + s2cM74.2.0 - Photographic activities + s2cM74.3 - Translation and i= + s2cM74.3.0 - Translation and interpretat+ s2cM74.9 - Other professional= + s2cM74.9.0 - Other professional, scientif+ s2cM75 - Veterinary activiti = + s2cM75.0 - Veterinary activi= + s2cM75.0.0 - Veterinary activities + s2cN - Administrative and su= + s2c

Page 862: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

N77 - Rental and leasing a= + s2cN77.1 - Renting and leasi= + s2cN77.1.1 - Renting and leasing of cars+ s2cN77.1.2 - Renting and leasing of truc+ s2cN77.2 - Renting and leas = + s2cN77.2.1 - Renting and leasing of rec + s2cN77.2.2 - Renting of video tapes and+ s2cN77.2.9 - Renting and leasing of ot + s2cN77.3 - Renting and leas = + s2cN77.3.1 - Renting and leasing of ag + s2cN77.3.2 - Renting and leasing of co + s2cN77.3.3 - Renting and leasing of of + s2cN77.3.4 - Renting and leasing of wa + s2cN77.3.5 - Renting and leasing of air + s2cN77.3.9 - Renting and leasing of ot + s2cN77.4 - Leasing of intell = + s2cN77.4.0 - Leasing of intellectual pr + s2cN78 - Employment activit= + s2cN78.1 - Activities of em = + s2cN78.1.0 - Activities of employment + s2cN78.2 - Temporary emplo= + s2cN78.2.0 - Temporary employment age+ s2cN78.3 - Other human res= + s2cN78.3.0 - Other human resources pr+ s2cN79 - Travel agency, tour= + s2cN79.1 - Travel agency and= + s2cN79.1.1 - Travel agency activities + s2cN79.1.2 - Tour operator activities + s2cN79.9 - Other reservation= + s2cN79.9.0 - Other reservation service a+ s2cN80 - Security and investi= + s2cN80.1 - Private security ac= + s2cN80.1.0 - Private security activities + s2cN80.2 - Security systems s= + s2cN80.2.0 - Security systems service act+ s2cN80.3 - Investigation acti= + s2cN80.3.0 - Investigation activities + s2cN81 - Services to buildin = + s2cN81.1 - Combined facilitie= + s2cN81.1.0 - Combined facilities support+ s2cN81.2 - Cleaning activitie= + s2cN81.2.1 - General cleaning of buildi + s2cN81.2.2 - Other building and industria+ s2cN81.2.9 - Other cleaning activities + s2cN81.3 - Landscape service= + s2cN81.3.0 - Landscape service activitie+ s2cN82 - Office administrati = + s2cN82.1 - Office administra= + s2cN82.1.1 - Combined office administrat+ s2cN82.1.9 - Photocopying, document pre+ s2cN82.2 - Activities of call = + s2c

Page 863: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

N82.2.0 - Activities of call centres + s2cN82.3 - Organisation of = + s2cN82.3.0 - Organisation of conventio + s2cN82.9 - Business support s= + s2cN82.9.1 - Activities of collection ag + s2cN82.9.2 - Packaging activities + s2cN82.9.9 - Other business support serv+ s2cO - Public administration= + s2cO84 - Public administrati= + s2cO84.1 - Administration o= + s2cO84.1.1 - General public administrati+ s2cO84.1.2 - Regulation of the activities+ s2cO84.1.3 - Regulation of and contribu+ s2cO84.2 - Provision of ser = + s2cO84.2.1 - Foreign affairs + s2cO84.2.2 - Defence activities + s2cO84.2.3 - Justice and judicial activiti + s2cO84.2.4 - Public order and safety acti+ s2cO84.2.5 - Fire service activities + s2cO84.3 - Compulsory social= + s2cO84.3.0 - Compulsory social security + s2cP - Education = + s2cP85 - Education = + s2cP85.1 - Pre-primary educ= + s2cP85.1.0 - Pre-primary education + s2cP85.2 - Primary educatio= + s2cP85.2.0 - Primary education + s2cP85.3 - Secondary educat= + s2cP85.3.1 - General secondary educati+ s2cP85.3.2 - Technical and vocational + s2cP85.4 - Higher education= + s2cP85.4.1 - Post-secondary non-tertia + s2cP85.4.2 - Tertiary education + s2cP85.5 - Other education = + s2cP85.5.1 - Sports and recreation educ+ s2cP85.5.2 - Cultural education + s2cP85.5.3 - Driving school activities + s2cP85.5.9 - Other education n.e.c. + s2cP85.6 - Educational suppo= + s2cP85.6.0 - Educational support activit+ s2cQ - Human health and soci= + s2cQ86 - Human health activ= + s2cQ86.1 - Hospital activitie = + s2cQ86.1.0 - Hospital activities + s2cQ86.2 - Medical and denta= + s2cQ86.2.1 - General medical practice ac+ s2cQ86.2.2 - Specialist medical practice + s2cQ86.2.3 - Dental practice activities + s2cQ86.9 - Other human heal= + s2cQ86.9.0 - Other human health activit+ s2cQ87 - Residential care act= + s2c

Page 864: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Q87.1 - Residential nursin= + s2cQ87.1.0 - Residential nursing care act+ s2cQ87.2 - Residential care = + s2cQ87.2.0 - Residential care activitie + s2cQ87.3 - Residential care a= + s2cQ87.3.0 - Residential care activities + s2cQ87.9 - Other residential = + s2cQ87.9.0 - Other residential care activ+ s2cQ88 - Social work activi = + s2cQ88.1 - Social work activ = + s2cQ88.1.0 - Social work activities wit + s2cQ88.9 - Other social wor = + s2cQ88.9.1 - Child day-care activities + s2cQ88.9.9 - Other social work activiti + s2cR - Arts, entertainment a= + s2cR90 - Creative, arts and = + s2cR90.0 - Creative, arts an = + s2cR90.0.1 - Performing arts + s2cR90.0.2 - Support activities to perfo + s2cR90.0.3 - Artistic creation + s2cR90.0.4 - Operation of arts facilities + s2cR91 - Libraries, archives = + s2cR91.0 - Libraries, archiv = + s2cR91.0.1 - Library and archives activit+ s2cR91.0.2 - Museums activities + s2cR91.0.3 - Operation of historical site+ s2cR91.0.4 - Botanical and zoological ga+ s2cR92 - Gambling and bettin= + s2cR92.0 - Gambling and bett= + s2cR92.0.0 - Gambling and betting activi+ s2cR93 - Sports activities a = + s2cR93.1 - Sports activities = + s2cR93.1.1 - Operation of sports faciliti + s2cR93.1.2 - Activities of sport clubs + s2cR93.1.3 - Fitness facilities + s2cR93.1.9 - Other sports activities + s2cR93.2 - Amusement and re= + s2cR93.2.1 - Activities of amusement p + s2cR93.2.9 - Other amusement and recre+ s2cS - Other services activiti = + s2cS94 - Activities of membe= + s2cS94.1 - Activities of bus = + s2cS94.1.1 - Activities of business an + s2cS94.1.2 - Activities of professional + s2cS94.2 - Activities of trad = + s2cS94.2.0 - Activities of trade unions + s2cS94.9 - Activities of oth = + s2cS94.9.1 - Activities of religious organ+ s2cS94.9.2 - Activities of political organ + s2cS94.9.9 - Activities of other members+ s2cS95 - Repair of compute = + s2c

Page 865: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

S95.1 - Repair of compu = + s2cS95.1.1 - Repair of computers and p + s2cS95.1.2 - Repair of communication + s2cS95.2 - Repair of person = + s2cS95.2.1 - Repair of consumer electro+ s2cS95.2.2 - Repair of household appl + s2cS95.2.3 - Repair of footwear and lea+ s2cS95.2.4 - Repair of furniture and ho + s2cS95.2.5 - Repair of watches, clocks a+ s2cS95.2.9 - Repair of other personal + s2cS96 - Other personal servi= + s2cS96.0 - Other personal ser= + s2cS96.0.1 - Washing and (dry-)cleaning + s2cS96.0.2 - Hairdressing and other be + s2cS96.0.3 - Funeral and related activiti+ s2cS96.0.4 - Physical well-being activiti + s2cS96.0.9 - Other personal service activ+ s2cT - Activities of househo = + s2cT97 - Activities of hous = + s2cT97.0 - Activities of hou = + s2cT97.0.0 - Activities of households a + s2cT98 - Undifferentiated go= + s2cT98.1 - Undifferentiated = + s2cT98.1.0 - Undifferentiated goods-pro+ s2cT98.2 - Undifferentiated = + s2cT98.2.0 - Undifferentiated service-p + s2cU - Activities of extrater = + s2cU99 - Activities of extrat = + s2cU99.0 - Activities of extr = + s2cU99.0.0 - Activities of extraterritori + s2c

Page 866: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity datLast modifi Comment7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 867: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 868: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 869: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 870: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 871: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 872: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 873: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 874: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 875: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 876: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 877: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 878: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 879: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 880: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 881: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 882: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 883: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 884: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 885: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 886: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerNA x0 yes s2cFrequency of claims x1 s2cNumber of claims x2 s2cNumber of contracts x3 s2cNumber of HRGs x4 s2cNumber of months for notice x5 s2cNumber of new contracts x6 s2cNumber of obligations x7 s2cNumber of people insured x8 s2cNumber of policyholders x9 s2cNumber of surplus/layers in program x10 s2cNumber of underlying assets x11 s2cNumber of underwriting risks x12 s2cNumber of vehicles x13 s2cNumber of vehicles policy limit above 24M€ x14 s2cNumber of vehicles policy limit below or equal to 24M€ x15 s2cNumber of reinstatements x16 s2cNumber of HRGs in product x17 s2cNumber of surrender options exercised x18 s2cNumber of separate risk arrangements x19 s2cLargest accident risk concentration of an insurance or reinsura x20 s2c

Page 887: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modifi Count Comment7/7/2014 07/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 1

9/30/2015 19/30/2015 19/30/2015 17/15/2016 1

Page 888: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name Hierarchy nSign Weight1: Types of integer

Frequency of claims x1 Frequency of claimsNumber of contracts x3 Number of contractsNumber of new contracts x6 Number of new contractsNumber of underlying assets x11 Number of underlying assetsNumber of HRGs x4 Number of HRGsNumber of HRGs in product x17 Number of HRGs in productNumber of obligations x7 Number of obligationsNumber of claims x2 Number of claimsNumber of underwriting risks x12 Number of underwriting risksNumber of surplus/layers in program x10 Number of surplus/layers in programNumber of months for notice x5 Number of months for noticeNumber of vehicles x13 Number of v=

Number of vehicles policy limit above 24M€ x14 Number of vehicles po+Number of vehicles policy limit below or equal to 24M€ x15 Number of vehicles pol+

Number of policyholders x9 Number of policyholdersNumber of people insured x8 Number of people insuredNumber of reinstatements x16 Number of reinstatementsNumber of surrender options exercised x18 Number of surrender options exercisedNumber of separate risk arrangements x19 Number of separate risk arrangementsLargest accident risk concentration of an insurance or rei x20 Largest accident risk concentration of an insurance or reinsurance undertaking

Page 889: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Owner Usable Applicable Applicable sheets fo Creation date Validity dates2c NT 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/2014

Number of surplus/layers in program 7/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014

Number of surrender options exercised 9/30/2015Number of separate risk arrangements 9/30/2015Largest accident risk concentration of an insurance or reinsurance undertaking 7/15/2016

Page 890: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modified date Comment7/15/2016

Page 891: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity date Last modifiTotal/NA x0 yes s2c 7/7/2014Call [C] x1 s2c 7/7/2014 12/31/2013Call and put [B] x2 s2c 7/7/2014 12/31/2013Commodities [Co] x3 s2c 7/7/2014Currency [CU] x4 s2c 7/7/2014Equity and Funds [EF] x5 s2c 7/7/2014Index [In] x6 s2c 7/7/2014Interest rate and yields [IR] x7 s2c 7/7/2014Multi [M] x8 s2c 7/7/2014Other [O] x9 s2c 7/7/2014Prepayments not possible x10 s2c 7/7/2014Prepayments possible x11 s2c 7/7/2014Put [P] x12 s2c 7/7/2014Call by the buyer x13 s2c 7/7/2014Call by the seller x14 s2c 7/7/2014Put by the buyer x15 s2c 7/7/2014Put by the seller x16 s2c 7/7/2014Any combination of the previousx17 s2c 7/7/2014

Page 892: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Count Comment Hierarchy Name Hierarchy nSign Weight0 1: Callable or Putable1 Call by the buyer x13 1 - Call by the buyer1 Call by the seller x14 2 - Call by the seller1 Put by the buyer x15 3 - Put by the buyer1 Put by the seller x16 4 - Put by the seller1 Any combination of the previous ox17 5 - Any combination of the previous options1 2: Underlying security1 Equity and Funds [EF] x5 1 - Equity and Funds (a selected group or basket of equities)1 Currency [CU] x4 2 - Currency (a selected group or basket of currencies)1 Interest rate and yields [IR] x7 3 - Interest rate and yields (bond indices, yield curves, differences in prevailing in1 Commodities [Co] x3 4 - Commodities (a selected, basic good or group of goods)1 Index [In] x6 5 - Index (performance of a selected index)1 Multi [M] x8 6 - Multi (allowing for a combination of the possible types listed above)1 Other [O] x9 9 - Others not covered by the previous options (e.g. other economic indicators)1 3: Prepayments for structured products1 Prepayments possible x11 1 – Prepayment structured product1 Prepayments not possible x10 2 – Not a prepayment structured product1 4: Type of options

Call and put [B] x2 Call and put [B]Call [C] x1 Call [C]Put [P] x12 Put [P]

Page 893: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Owner Usable Applicable Applicable sheet Creation date Validity date Last modifiedComments2c N/A S.07.01 (201) 7/7/2014

7/7/20147/7/20147/7/20147/7/2014

5 - Any combination of the previous options 7/7/2014s2c N/A S.07.01 (201) 7/7/2014

1 - Equity and Funds (a selected group or basket of equities) 7/7/20142 - Currency (a selected group or basket of currencies) 7/7/20143 - Interest rate and yields (bond indices, yield curves, differences in prevailing in 7/7/20144 - Commodities (a selected, basic good or group of goods) 7/7/20145 - Index (performance of a selected index) 7/7/20146 - Multi (allowing for a combination of the possible types listed above) 7/7/20149 - Others not covered by the previous options (e.g. other economic indicators) 7/7/2014

s2c N/A S.07.01 (201) 7/7/20141 – Prepayment structured product 7/7/20142 – Not a prepayment structured product 7/7/2014

s2c N/A 9/30/2015 9/30/20157/7/2014 12/31/20137/7/2014 12/31/20137/7/2014

Page 894: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity dateTotal/NA x0 yes s2c 7/7/2014> 90% x1 s2c 7/7/2014 9/30/2015≤ 10% x2 s2c 7/7/2014 9/30/2015Up to 0.5 per cent x3 s2c 9/30/2015Above 0.5% and up to 1.0% x4 s2c 9/30/2015Above 1.0% and up to 1.5% x5 s2c 9/30/2015Above 1.5% and up to 2.0% x6 s2c 9/30/2015Above 2.0% and up to 2.5% x7 s2c 9/30/2015Above 2.5% and up to 3.0% x8 s2c 9/30/2015Above 3.0% and up to 4.0% x9 s2c 9/30/2015Above 4.0% and up to 5.0% x10 s2c 9/30/2015Above 5.0% and up to 6.0% x11 s2c 9/30/2015Above 6.0% and up to 7.0% x12 s2c 9/30/2015Above 7.0% and up to 8.0% x13 s2c 9/30/2015Above 8.0% x14 s2c 9/30/2015

Page 895: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modifi Count Comment Hierarchy Name Hierarchy noSign2 1: Threshold0 Total/NA x0 Total/NA =1 > 90% x1 > 90%1 x2 ≤ 10%1 2: Threshold1 Total/NA x0 Total/NA =1 Up to 0.5 per cent x3 Up to 0.5 per cent1 Above 0.5% and up to 1.0% x4 Above 0.5% and up to 1 Above 1.0% and up to 1.5% x5 Above 1.0% and up to 1 Above 1.5% and up to 2.0% x6 Above 1.5% and up to 1 Above 2.0% and up to 2.5% x7 Above 2.0% and up to 1 Above 2.5% and up to 3.0% x8 Above 2.5% and up to 1 Above 3.0% and up to 4.0% x9 Above 3.0% and up to 1 Above 4.0% and up to 5.0% x10 Above 4.0% and up to 1 Above 5.0% and up to 6.0% x11 Above 5.0% and up to

Above 6.0% and up to 7.0% x12 Above 6.0% and up to Above 7.0% and up to 8.0% x13 Above 7.0% and up to Above 8.0% x14 Above 8.0%

≤ 10%

Page 896: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Weight Owner Usable Applicable Applicable Creation date Validity date Last modifi Comments2c PI 7/7/2014

7/7/2014+ 7/7/2014 9/30/2015+ 7/7/2014 9/30/2015

s2c PI 9/30/20157/7/2014

+ 9/30/2015+ 9/30/2015+ 9/30/2015+ 9/30/2015+ 9/30/2015+ 9/30/2015+ 9/30/2015+ 9/30/2015+ 9/30/2015+ 9/30/2015+ 9/30/2015+ 9/30/2015

Page 897: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label NameNA x0Aggregated deductibles x1Attachment point x2Average profit [or loss] sharing [i.e. own fund share of gain/loss] x3Contribution to group technical provisions [%] x4Detachment point x5Factor applied for the revision shock x6Fixed annual return x7Inflation rate x8Lapse/surrender rate contracts x9Lapse/surrender rate volume x10Limit x11Loss given default x12Percent of interest rate x13Percent of the issue held by entities in the group x14Percent of voting rights x15Percent used for the establishment of accounting consolidated accounts x16Percentage of gross Technical Provisions concerned by used of simplified methods for calculx17Percentage of par value x18Percentage of share reinsurer x19Percentage of the level of guarantee x20Probability of default x21Proportion of damage caused by scenario x22Proportion of the subscribed capital that is held, directly or indirectly, by the participating x23Proportional share retained x24Ratio of Eligible own funds to MCR x25Ratio of Eligible own funds to minimum Group SCR x26Ratio of Eligible own funds to SCR x27Retention or priority x28Risk charge factor x29Standard deviation - adjustment factor for non-proportional reinsurance [undertaking-specix30Standard deviation [undertaking-specific parameter] x31XL rate 1 x32XL rate 2 x33Percentage of the reinsurers limit collateralised x34Annual effective rate applied to the CF of the obligations x35Annual effective rate of the best estimate x36Cost of downgrade x37Increase of fundamental spread for sub investment grade assets x38Matching adjustment to the risk free rate x39Interest rate x40Annual effective rate x41Portion of the difference applied at the reporting date x42Adjustment to risk free rate x43Return on assets x44Aggregate deductibles (%) x45Reinsurance Commission [Maximum] x46Reinsurance Commission [Minimum] x47Reinsurance Commission [Expected] x48Overriding Commission [Maximum] x49

Page 898: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Overriding Commission [Minimum] x50Overriding Commission [Expected] x51Profit Commission [Maximum] x52Profit Commission [Minimum] x53Profit Commission [Expected] x54Ratio of insured persons using hospitalisation x55Ratio of insured persons using medical practitioner x56Ratio of insured persons using no formal medical care x57Risk rate x58Largest accident risk concentration of an insurance or reinsurance undertaking x59Termination rates x60Average profit/(loss) sharing x61Portion of the difference adjusted x62

Page 899: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Default Owner Creation date Validity date Last modifi Count Commentyes s2c 7/7/2014 0

s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 9/30/2015 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1

Page 900: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 7/15/2016 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1

Page 901: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy1: Types of percentage

Percentage of gross Technical Provisions concerned by used of simplified methods for calculationPercentage of the level of guaranteePercent of interest rateInflation ratePercentage of share reinsurerAggregated deductiblesRetention or priorityLimitXL rate 1XL rate 2Ratio of Eligible own funds to SCRRatio of Eligible own funds to MCRFixed annual returnLoss given defaultDetachment pointAttachment pointProbability of defaultFactor applied for the revision shockStandard deviation [undertaking-specific parameter]Standard deviation - adjustment factor for non-proportional reinsurance [undertaking-specific parameter]Risk charge factorProportion of damage caused by scenarioPercentage of par valueProportion of the subscribed capital that is held, directly or indirectly, by the participating undertaking in Percent used for the establishment of accounting consolidated accountsPercent of voting rightsContribution to group technical provisions [%]Proportional share retainedAverage profit [or loss] sharing [i.e. own fund share of gain/loss]Ratio of Eligible own funds to minimum Group SCRPercent of the issue held by entities in the groupLapse/surrender rate contractsLapse/surrender rate volumePercentage of the reinsurers limit collateralisedAnnual effective rate applied to the CF of the obligationsAnnual effective rate of the best estimateCost of downgradeIncrease of fundamental spread for sub investment grade assetsMatching adjustment to the risk free rateInterest rateAnnual effective ratePortion of the difference applied at the reporting dateAdjustment to risk free rateReturn on assetsAggregate deductibles (%)Reinsurance Commission [Maximum]Reinsurance Commission [Minimum]Reinsurance Commission [Expected]Overriding Commission [Maximum]

Page 902: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Overriding Commission [Minimum]Overriding Commission [Expected]Profit Commission [Maximum]Profit Commission [Minimum]Profit Commission [Expected]Ratio of insured persons using hospitalisationRatio of insured persons using medical practitionerRatio of insured persons using no formal medical careRisk rateLargest accident risk concentration of an insurance or reinsurance undertakingTermination ratesAverage profit/(loss) sharingPortion of the difference adjusted

Page 903: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Hierarchy nSign Weight Owner Usable Applicable Applicable Creation dates2c PP 7/7/2014

x17 Percentage of gross Technical Provisions concerned by used of simplified met 7/7/2014x20 Percentage of the level of guarantee 7/7/2014x13 Percent of interest rate 7/7/2014x8 Inflation rate 7/7/2014x19 Percentage of share reinsurer 7/7/2014x1 Aggregated deductibles 7/7/2014x28 Retention or priority 7/7/2014x11 Limit 7/7/2014x32 XL rate 1 7/7/2014x33 XL rate 2 7/7/2014x27 Ratio of Eligible own funds to SCR 7/7/2014x25 Ratio of Eligible own funds to MCR 7/7/2014x7 Fixed annual return 7/7/2014x12 Loss given default 7/7/2014x5 Detachment point 7/7/2014x2 Attachment point 7/7/2014x21 Probability of default 7/7/2014x6 Factor applied for the revision shock 7/7/2014x31 Standard deviation [undertaking-specific parameter] 7/7/2014x30 Standard deviation - adjustment factor for non-proportional reinsurance [un 7/7/2014x29 Risk charge factor 7/7/2014x22 Proportion of damage caused by scenario 7/7/2014x18 Percentage of par value 7/7/2014x23 Proportion of the subscribed capital that is held, directly or indirectly, by t 7/7/2014x16 Percent used for the establishment of accounting consolidated accounts 7/7/2014x15 Percent of voting rights 7/7/2014x4 Contribution to group technical provisions [%] 7/7/2014x24 Proportional share retained 7/7/2014x3 Average profit [or loss] sharing [i.e. own fund share of gain/loss] 7/7/2014x26 Ratio of Eligible own funds to minimum Group SCR 7/7/2014x14 Percent of the issue held by entities in the group 7/7/2014x9 Lapse/surrender rate contracts 7/7/2014x10 Lapse/surrender rate volume 7/7/2014x34 Percentage of the reinsurers limit collateralised 7/7/2014x35 Annual effective rate applied to the CF of the obligations 9/30/2015x36 Annual effective rate of the best estimate 9/30/2015x37 Cost of downgrade 9/30/2015x38 Increase of fundamental spread for sub investment grade assets 9/30/2015x39 Matching adjustment to the risk free rate 9/30/2015x40 Interest rate 9/30/2015x41 Annual effective rate 9/30/2015x42 Portion of the difference applied at the reporting date 9/30/2015x43 Adjustment to risk free rate 9/30/2015x44 Return on assets 9/30/2015x45 Aggregate deductibles (%) 9/30/2015x46 Reinsurance Commission [Maximum] 9/30/2015x47 Reinsurance Commission [Minimum] 9/30/2015x48 Reinsurance Commission [Expected] 9/30/2015x49 Overriding Commission [Maximum] 9/30/2015

Page 904: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x50 Overriding Commission [Minimum] 9/30/2015x51 Overriding Commission [Expected] 9/30/2015x52 Profit Commission [Maximum] 9/30/2015x53 Profit Commission [Minimum] 9/30/2015x54 Profit Commission [Expected] 9/30/2015x55 Ratio of insured persons using hospitalisation 9/30/2015x56 Ratio of insured persons using medical practitioner 9/30/2015x57 Ratio of insured persons using no formal medical care 9/30/2015x58 Risk rate 9/30/2015x59 Largest accident risk concentration of an insurance or reinsurance undertaki 9/30/2015x60 Termination rates 9/30/2015x61 Average profit/(loss) sharing 9/30/2015x62 Portion of the difference adjusted 9/30/2015

Page 905: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modified Comment9/30/2015

12/31/20139/30/2015

12/31/2013

12/31/2013

9/30/2015

Page 906: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2016

Page 907: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

LabelTotal/NACash and cash equivalentsEfficient portfolio management [EPM]General [no split]Reporting activity by RFFInsurance/reinsurance relatedInsurance/reinsurance related [risks accepted]InvestmentInvestments other than participationsIssued by the undertakingLife [split applicable]Macro hedge [MA]Micro hedge [MI]Non-life [split applicable]Non-strategic participation [not deducted from own funds]Non-strategic participation and investments other than participationsNot a participationNot reporting activity by RFFNot insurance/reinsurance related [trade]Not to be deductedOther than investmentOther than investment, cash and cash equivalents and own useOther than investment, own use, own instruments held directly and cash and cash equivalentsOther than own instruments held directlyOther than ring fenced fundsOwn instruments held directlyOwn useOwn use, cash and cash equivalentsParticipation but not consolidated at group level and not strategic [YNGNS]Participation consolidated at group level and not strategic [YGNS]Participation consolidated at group level and strategic [YGS]Participation not consolidated at group level but strategic [YNGS]ParticipationsParticipations [controlling]Participations [non-controlling]Participations which are considered strategic as defined in Article 152 ER4 of the [Delegated Acts] and whParticipations which individually exceed 10% of items included in [a], [b], [d] and [f] of Article 58[1] [exclParticipations which when aggregated exceed 10% of items included in [a], [b], [d] and [f] of Article 58[1] Reinsurance contracts related [risks transferred]Related to the undertakings’ liabilitiesMaterial Ring Fenced FundsSecuritisation assets not related to cedant held in trust with other third party than cedant/sponsorSecuritisation assets related to cedant held in trust with other third party than cedant/sponsorStrategic participation [not deducted from own funds]To be deductedNon-controlled participations under method 1 (NCP1)Other Financial Sectors (OFS)Subsidiaries under method 2 (SM2)Non-controlled participations under method 2 (NCP2)Shareholders' funds

Page 908: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other related undertaking under method 1 (ORUT1)Use of matching adjustmentNo use of matching adjustmentMatching Adjustment PortfoliosRemaining part [other than MAPs and material RFFs]Fund with other funds embeddedNot a fund with other funds embeddedOther internal fundsMatching assets and liabilities cash-flows used in the context of matching adjustment portfoliosEfficient portfolio management, other than “Matching assets and liabilities cash-flows used in the contexMaterial Ring Fenced Fund or Matching Adjustment PortfolioThe items reported refer to the remaining partEntity levelMaterial Ring fenced fund or Matching Adjustment Portfolio [201]Ring fenced funds and/or Matching portfolioParticipations in financial and credit institutions which individually exceed 10% of items included in (a) (i),Participations in financial and credit institutions which when aggregated exceed 10% of items included in (a) Participations in financial and credit institutions which are considered strategic as defined in Article 1Other participationsOther strategic participationsOther non-strategic participationsDeposit lodgedNot in deposit lodgedNo rights of set offRights of set offIs a participation, strategic and included in method 1 at group level (no deduction at own funds level)Is a participation, not included in method 1 at group level and deduction at own funds level in accordanceIs a participation, not included in method 1 at group level and deduction at own funds level in accordanceIs a participation, not included in method 1 at group level and there is no deduction at own funds level.Non-controlled participation in a related insurance and reinsurance undertaking under method 1Non-controlled participation in related insurance and reinsurance undertaking under method 2Participation in other financial sectorSubsidiary under method 2Participation in other strategic related undertaking under method 1Participation in other non-strategic related undertaking under method 1Is a participationParticipations in related undertakings that are financial and credit institutions which individually exceed 10Participations in related undertakings that are financial and credit institutions which when aggregated exceeParticipations in related undertakings that are financial and credit institutions which are considered strParticipations in related undertakings that are financial and credit institutions which are strategic (as dOther participations (e.g. participation in other undertakings under method 2)Participations [deducted from own funds]Participations [not deducted from own funds]Own instruments held directly or indirectlyOwn instruments held indirectlyOther than own instruments held directly or indirectlyRing Fenced FundsRemaining part of a fund

Page 909: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Default Owner Creation dateValidity date Last modifiedCount Commentx0 yes s2c 7/7/2014 22x1 s2c 7/7/2014 3x2 s2c 7/7/2014 1x3 s2c 7/7/2014 4x4 s2c 7/7/2014 2x5 s2c 7/7/2014 12/31/2013 1x6 s2c 7/7/2014 12/31/2013 1x7 s2c 7/7/2014 3x8 s2c 7/7/2014 12/31/2013 3x9 s2c 7/7/2014 1x10 s2c 7/7/2014 4x11 s2c 7/7/2014 2x12 s2c 7/7/2014 2x13 s2c 7/7/2014 4x14 s2c 7/7/2014 3x15 s2c 7/7/2014 1x16 s2c 7/7/2014 8x17 s2c 7/7/2014 2x18 s2c 7/7/2014 12/31/2013 1x19 s2c 7/7/2014 1x20 s2c 7/7/2014 2x21 s2c 7/7/2014 2x22 s2c 7/7/2014 9/30/2015 3x23 s2c 7/7/2014 9/30/2015 1x24 s2c 7/7/2014 1x25 s2c 7/7/2014 9/30/2015 4x26 s2c 7/7/2014 3x27 s2c 7/7/2014 12/31/2013 2x28 s2c 7/7/2014 2x29 s2c 7/7/2014 2x30 s2c 7/7/2014 2x31 s2c 7/7/2014 2x32 s2c 7/7/2014 5x33 s2c 7/7/2014 1x34 s2c 7/7/2014 1x35 s2c 7/7/2014 12/31/2013 2x36 s2c 7/7/2014 12/31/2013 2x37 s2c 7/7/2014 12/31/2013 2x38 s2c 7/7/2014 12/31/2013 1x39 s2c 7/7/2014 1x40 s2c 7/7/2014 7/15/2016 8x41 s2c 7/7/2014 1x42 s2c 7/7/2014 1x43 s2c 7/7/2014 3x44 s2c 7/7/2014 1x45 s2c 7/7/2014 1x46 s2c 7/7/2014 1x47 s2c 7/7/2014 1x48 s2c 7/7/2014 1x49 s2c 7/7/2014 4

Page 910: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x50 s2c 7/7/2014 1x51 s2c 9/30/2015 1x52 s2c 9/30/2015 1x53 s2c 9/30/2015 7/15/2016 5x54 s2c 9/30/2015 7/15/2016 6x55 s2c 9/30/2015 1x56 s2c 9/30/2015 1x57 s2c 9/30/2015 2x58 s2c 9/30/2015 1x59 s2c 9/30/2015 1x60 s2c 9/30/2015 7/15/2016 2x61 s2c 9/30/2015 12/31/2013 0x62 s2c 9/30/2015 2x63 s2c 9/30/2015 7/15/2016 1x64 s2c 9/30/2015 12/31/2013 0x65 s2c 9/30/2015 12/31/2013 9/30/2015 1x66 s2c 9/30/2015 12/31/2013 9/30/2015 1x67 s2c 9/30/2015 12/31/2013 1x68 s2c 9/30/2015 12/31/2013 2x69 s2c 9/30/2015 12/31/2013 2x70 s2c 9/30/2015 12/31/2013 2x71 s2c 9/30/2015 1x72 s2c 9/30/2015 1x73 s2c 9/30/2015 1x74 s2c 9/30/2015 1x75 s2c 9/30/2015 12/31/2013 0x76 s2c 9/30/2015 12/31/2013 0x77 s2c 9/30/2015 12/31/2013 0x78 s2c 9/30/2015 12/31/2013 0x79 s2c 9/30/2015 1x80 s2c 9/30/2015 1x81 s2c 9/30/2015 9/30/2015 1x82 s2c 9/30/2015 1x83 s2c 9/30/2015 1x84 s2c 9/30/2015 1x85 s2c 9/30/2015 1x86 s2c 9/30/2015 12/31/2013 1x87 s2c 9/30/2015 12/31/2013 9/30/2015 1x88 s2c 9/30/2015 12/31/2013 1x89 s2c 9/30/2015 12/31/2013 1x90 s2c 9/30/2015 1x91 s2c 9/30/2015 1x92 s2c 9/30/2015 12/31/2013 1x93 s2c 9/30/2015 1x94 s2c 9/30/2015 1x95 s2c 9/30/2015 1x96 s2c 7/15/2016 3x97 s2c 7/15/2016 1

Page 911: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name1: Insurance/trade

Total/NA x0Insurance/reinsurance related x5

Insurance/reinsurance related [risks accepted] x6Reinsurance contracts related [risks transferred] x38

Not insurance/reinsurance related [trade] x182: Investment or own use

Total/NA x0Investment x7

Participations x32Strategic participation [not deducted from own funds] x43

Participations which individually exceed 10% of items included in [a], [b], [d] and [f] ox36Participations which when aggregated exceed 10% of items included in [a], [b], [d] and x37Participations which are considered strategic as defined in Article 152 ER4 of the [De x35

Non-strategic participation [not deducted from own funds] x14Investments other than participations x8

Other than investment x20Own use, cash and cash equivalents x27

Cash and cash equivalents x1Own use x26

Other than investment, cash and cash equivalents and own use x21Own instruments held directly x25Other than investment, own use, own instruments held directly and cash and cash equix22

3: Investment or own useTotal/NA x0

Not a participation x16Participation but not consolidated at group level and not strategic [YNGNS] x28Participation not consolidated at group level but strategic [YNGS] x31Participation consolidated at group level and not strategic [YGNS] x29Participation consolidated at group level and strategic [YGS] x30

4: Investment or own useTotal/NA x0

Not a participation x16Participations x32

Participations which individually exceed 10% of items included in [a], [b], [d] and [f] of A x36Participations which when aggregated exceed 10% of items included in [a], [b], [d] and [f] x37Participations which are considered strategic as defined in Article 152 ER4 of the [Deleg x35

5: Treatment of participations in relation to own fundsTotal/NA x0

To be deducted x44Not to be deducted x19

6: Investment or own useTotal/NA x0

Not a participation x16Participations x32

Participations [controlling] x33Participations [non-controlling] x34

7: Portfolio (Preparatory scope)Total/NA x0

Life [split applicable] x10

Page 912: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Non-life [split applicable] x13Shareholders' funds x49General [no split] x3Material Ring Fenced Funds x40

8: Investment or own useTotal/NA x0

Other than own instruments held directly x23Investment x7

Strategic participation [not deducted from own funds] x43Non-strategic participation and investments other than participations x15

Non-strategic participation [not deducted from own funds] x14Investments other than participations x8

Cash and cash equivalents x1Own use x26Other than investment, own use, own instruments held directly and cash and cash equivx22

Own instruments held directly x259: Portfolio

Total/NA x0Life [split applicable] x10Non-life [split applicable] x13Shareholders' funds x49General [no split] x3Material Ring Fenced Funds x40Issued by the undertaking x9Related to the undertakings’ liabilities x39

10: PurposeTotal/NA x0

Micro hedge [MI] x12Macro hedge [MA] x11Efficient portfolio management [EPM] x2

11: Securitisation assets related and not related to cedant held in trust with other third party than cedant/sponsorSecuritisation assets related to cedant held in trust with other third party than cedant/spon x42Securitisation assets not related to cedant held in trust with other third party than cedant/ x41

12: PortfolioTotal/NA x0

Reporting activity by RFF x4Not reporting activity by RFF x17

13: PortfolioTotal/NA x0

Material Ring Fenced Funds x40Other than ring fenced funds x24

14: Investment or own useTotal/NA x0

Not a participation x16Participation but not consolidated at group level and not strategic [YNGNS] x28Participation not consolidated at group level but strategic [YNGS] x31Participation consolidated at group level and not strategic [YGNS] x29Participation consolidated at group level and strategic [YGS] x30Non-controlled participations under method 1 (NCP1) x45Other Financial Sectors (OFS) x46Subsidiaries under method 2 (SM2) x47

Page 913: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Non-controlled participations under method 2 (NCP2) x48Other related undertaking under method 1 (ORUT1) x50

15: Matching adjustmentUse of matching adjustment x51No use of matching adjustment x52

16: RFF,MAP or Remaining of a fundMaterial Ring Fenced Funds x40Matching Adjustment Portfolios x53Remaining part [other than MAPs and material RFFs] x54

17: RFF, MAP with sub RFF, MAPFund with other funds embedded x55Not a fund with other funds embedded x56

18: Portfolio (investment, securities lending and repo) (Full scope)Life [split applicable] x10Non-life [split applicable] x13Material Ring Fenced Funds x40Other internal funds x57Shareholders' funds x49General [no split] x3

19: PurposeMicro hedge [MI] x12Macro hedge [MA] x11Matching assets and liabilities cash-flows used in the context of matching adjustment portfox58Efficient portfolio management, other than “Matching assets and liabilities cash-flows used x59

20: Ring-fenced fund/matching portfolio/remaining partTotal/NA x0

Material Ring Fenced Fund or Matching Adjustment Portfolio x60Remaining part [other than MAPs and material RFFs] x54

21: Ring-fenced fund/matching portfolio/remaining partTotal/NA x0

Entity level x62Material Ring fenced fund or Matching Adjustment Portfolio [201] x63Remaining part [other than MAPs and material RFFs] x54

22: Investment or own useTotal/NA x0

Not a participation x16Participations x32

Participations in financial and credit institutions which individually exceed 10% of items inx65Participations in financial and credit institutions which when aggregated exceed 10% of itemx66Participations in financial and credit institutions which are considered strategic as def x67

Other participations x68Other strategic participations x69Other non-strategic participations x70

23: PortfolioReporting activity by RFF x4Not reporting activity by RFF x17

24: Deposit Lodged as securityDeposit lodged x71Not in deposit lodged x72

25: Confirmation that there are no rights of set offNo rights of set off x73

Page 914: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Rights of set off x7426: Investment or own use

Not a participation x16Is a participation x85

27: Investment or own useNot a participation x16Non-controlled participation in a related insurance and reinsurance undertaking under met x79Non-controlled participation in related insurance and reinsurance undertaking under methox80Participation in other financial sector x81Subsidiary under method 2 x82Participation in other strategic related undertaking under method 1 x83Participation in other non-strategic related undertaking under method 1 x84Other participations (e.g. participation in other undertakings under method 2) x90

28: RFF,MAP or Remaining of a fundMaterial Ring Fenced Funds x40Matching Adjustment Portfolios x53

29: Investment or own useTotal/NA x0

Not a participation x16Participations x32

Participations in related undertakings that are financial and credit institutions which indi x86Participations in related undertakings that are financial and credit institutions which whex87Participations in related undertakings that are financial and credit institutions which a x88Participations in related undertakings that are financial and credit institutions which ar x89

Other participations x68Other strategic participations x69Other non-strategic participations x70

30: Ring-fenced fund or remaining partTotal/NA x0

Material Ring Fenced Funds x40Remaining part [other than MAPs and material RFFs] x54

31: Investment or own useTotal/NA x0

Investment x7Participations [deducted from own funds] x91Participations [not deducted from own funds] x92

Strategic participation [not deducted from own funds] x43Non-strategic participation [not deducted from own funds] x14

Investments other than participations x8Other than investment x20

Own use, cash and cash equivalents x27Cash and cash equivalents x1Own use x26

Other than investment, cash and cash equivalents and own use x21Own instruments held directly x25Other than investment, own use, own instruments held directly and cash and cash equix22

32: Investment or own useTotal/NA x0

Own instruments held directly or indirectly x93Own instruments held directly x25Own instruments held indirectly x94

Page 915: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other than own instruments held directly or indirectly x9533: Portfolio (investment, securities lending and repo)[210]

Life [split applicable] x10Non-life [split applicable] x13Ring Fenced Funds x96Other internal funds x57Shareholders' funds x49General [no split] x3

34: RFF or MAPRing Fenced Funds x96Matching Adjustment Portfolios x53

35: Ring-fenced fund/matching portfolio/remaining partTotal/NA x0

Entity level x62Material Ring Fenced Fund or Matching Adjustment Portfolio x60Remaining part [other than MAPs and material RFFs] x54

36: RFF,MAP or Remaining of a fundTotal/NA x0

Material Ring Fenced Funds x40Matching Adjustment Portfolios x53Remaining part [other than MAPs and material RFFs] x54

37: RFF,MAP or Remaining of a fundRing Fenced Funds x96Matching Adjustment Portfolios x53Remaining part of a fund x97

Page 916: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy node label Sign Weight Owner Usable Applicable s2c N/A

Total/NA =Insurance/reinsurance related = +Insurance/reinsurance related [risks accepted]+Reinsurance contracts related [risks transferre+Not insurance/reinsurance related [trade] +

s2c IOTotal/NA =Investment = +Participations = +Strategic participation [not deduc = +Participations which individually exceed 10% of +Participations which when aggregated exceed 10%+Participations which are considered strategic +Non-strategic participation [not deducted fro +Investments other than participations +Other than investment = +Own use, cash and cash equivalent= +Cash and cash equivalents +Own use +Other than investment, cash and c = +Own instruments held directly +Other than investment, own use, own instrume+

s2c IOTotal/NA =Not a participation +Participation but not consolidated at group le +Participation not consolidated at group level b+Participation consolidated at group level and +Participation consolidated at group level and s+

s2c IOTotal/NA =Not a participation +Participations = +Participations which individually exceed 10% of +Participations which when aggregated exceed 10%+Participations which are considered strategic +

s2c OUTotal/NA =To be deducted +Not to be deducted +

s2c IOTotal/NA =Not a participation +Participations = +Participations [controlling] +Participations [non-controlling] +

s2c POTotal/NALife [split applicable]

Page 917: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Non-life [split applicable]Shareholders' fundsGeneral [no split]Material Ring Fenced Funds

s2c IOTotal/NA =Other than own instruments held di= +Investment = +Strategic participation [not deducted from ow+Non-strategic participation and inv= +Non-strategic participation [not deducted fro +Investments other than participations +Cash and cash equivalents +Own use +Other than investment, own use, own instrume+Own instruments held directly +

s2c POTotal/NALife [split applicable]Non-life [split applicable]Shareholders' fundsGeneral [no split]Material Ring Fenced FundsIssued by the undertakingRelated to the undertakings’ liabilities

s2c N/ATotal/NAMicro hedge [MI]Macro hedge [MA]Efficient portfolio management [EPM]

11: Securitisation assets related and not related to cedant held in trust with other third party than cedant/sponsor s2c N/ASecuritisation assets related to cedant held in trust with other third party than cedant/sponsorSecuritisation assets not related to cedant held in trust with other third party than cedant/sponsor

s2c POTotal/NA =Reporting activity by RFF +Not reporting activity by RFF +

s2c POTotal/NAMaterial Ring Fenced FundsOther than ring fenced funds

s2c IOTotal/NANot a participationParticipation but not consolidated at group level and not strategic [YNGNS]Participation not consolidated at group level but strategic [YNGS]Participation consolidated at group level and not strategic [YGNS]Participation consolidated at group level and strategic [YGS]Non-controlled participations under method 1 (NCP1)Other Financial Sectors (OFS)Subsidiaries under method 2 (SM2)

Page 918: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Non-controlled participations under method 2 (NCP2)Other related undertaking under method 1 (ORUT1)

s2c PO1- Use of matching adjustment2 - No use of matching adjustment

s2c PO1 – Ring-fenced fund2 – Matching portfolio3 – Remaining part of a fund

s2c PO1 – Fund with other funds embedded2 – Not a fund with other funds embedded

s2c PO1 - Life2 - Non-life3 - Ring fenced funds4 - Other internal funds5 - Shareholders' funds6 - General

s2c N/A1 - Micro hedge2 - Macro hedge3 - Matching assets and liabilities cash-flows used in the context of matching adjustment portfolios4 - Efficient portfolio management, other than “Matching assets and liabilities cash-flows used in the context of match

s2c POTotal/NA no1 - The items reported refer to a RFF/MAP2 - The items reported refer to the remaining part

s2c POTotal/NA no1 - Entity level2 - Material Ring fenced fund or Matching Adjustment Portfolio3 - Remaining part

s2c IOTotal/NA =Not a participation +Participations = +Participations in financial and credit institutio +Participations in financial and credit instituti +Participations in financial and credit institut +Other participations = +Other strategic participations +Other non-strategic participations +

s2c PO1 - Reporting activity by RFF2 - Not reporting activity by RFF

s2c PO1 – Deposit lodged2 – Not in deposit lodged

s2c PO1 - No rights of set off

Page 919: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

2 - Rights of set offs2c IO

1 - Not a participation2 - Is a participation

s2c IO1 - Not a participation2 - Non-controlled participation in a related insurance and reinsurance undertaking under method 13 - Non-controlled participation in related insurance and reinsurance undertaking under method 24 - Participation in other financial sector5 - Subsidiary under method 26 - Participation in other strategic related undertaking under method 17 - Participation in other non-strategic related undertaking under method 18 - Other participations (e.g. participation in other undertakings under method 2)

s2c PO1 – Ring-fenced fund2 – Matching portfolio

s2c IOTotal/NA =Not a participation +Participations = +Participations in related undertakings that are +Participations in related undertakings that are+Participations in related undertakings that are+Participations in related undertakings that are+Other participations = +Other strategic participations +Other non-strategic participations +

s2c POTotal/NA no1 – RFF2 – Remaining part

s2c IOTotal/NA =Investment = +Participations [deducted from own funds] +Participations [not deducted from = +Strategic participation [not deduc = +Non-strategic participation [not deducted fro +Investments other than participations +Other than investment = +Own use, cash and cash equivalent= +Cash and cash equivalents +Own use +Other than investment, cash and c = +Own instruments held directly +Other than investment, own use, own instrume+

s2c IOTotal/NA =Own instruments held directly or in= +Own instruments held directly +Own instruments held indirectly +

Page 920: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Other than own instruments held directly or in+s2c PO

1 - Life2 - Non-life3 - Ring fenced funds4 - Other internal funds5 - Shareholders' funds6 - General

s2c PO1 – Ring-fenced fund2 – Matching portfolio

s2c POTotal/NA1 - Entity level2 - Material Ring fenced fund or Matching Adjustment Portfolio3 - Remaining part

s2c POTotal/NA =1 – Ring-fenced fund +2 – Matching portfolio +3 – Remaining part of a fund +

s2c PO1 – Ring-fenced fund2 – Matching portfolio3 – Remaining part of a fund

Page 921: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable sheets for drop Creation date Validity date Last modified date Comment7/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/2014

Page 922: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014 9/30/20157/7/2014 9/30/20157/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Securitisation assets related to cedant held in trust with other third party than cedant/sponsor 7/7/2014Securitisation assets not related to cedant held in trust with other third party than cedant/sponsor 7/7/2014

7/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 923: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/2014

S.01.02 (201) 9/30/20159/30/20159/30/2015

S.01.03 (201) 9/30/2015 7/15/20167/7/2014 7/15/2016

9/30/2015 7/15/20169/30/2015 7/15/2016

S.01.03 (201) 9/30/20159/30/20159/30/2015

S.06.02 (201), SE.06.02 (201 9/30/2015 7/15/20167/7/20147/7/20147/7/2014 7/15/2016

9/30/20157/7/20147/7/2014

S.08.01 (201), S.08.02 (201) 9/30/20157/7/20147/7/2014

3 - Matching assets and liabilities cash-flows used in the context of matching adjustment portfolios 9/30/20154 - Efficient portfolio management, other than “Matching assets and liabilities cash-flows used in the context of match 9/30/2015

SR.01.01 (201), SR.12.01 (20 9/30/2015 7/15/20177/7/2014

9/30/2015 7/15/20169/30/2015 7/15/2016

S.33.01 (201) 9/30/2015 7/15/2016 7/15/20177/7/2014

9/30/20159/30/2015 7/15/20169/30/2015 7/15/20169/30/2015

7/7/20147/7/20147/7/2014

9/30/2015 12/31/2013 9/30/20159/30/2015 12/31/2013 9/30/20159/30/20159/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/2013

S.01.02 (201) 9/30/20157/7/20147/7/2014

S.06.02 (201), SE.06.02 (20 9/30/20159/30/20159/30/2015

S.06.02 (201), SE.06.02 (20 9/30/20159/30/2015

Page 924: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015S.06.02 (201), SE.06.02 (20 9/30/2015

7/7/20149/30/2015

S.06.02 (201) 9/30/2015 9/30/20157/7/2014

2 - Non-controlled participation in a related insurance and reinsurance undertaking under method 1 9/30/20153 - Non-controlled participation in related insurance and reinsurance undertaking under method 2 9/30/2015

9/30/2015 9/30/20159/30/20159/30/20159/30/20159/30/2015

S.01.03 (201) 9/30/2015 7/15/20167/7/2014 7/15/2016

9/30/2015 7/15/20169/30/2015

7/7/20147/7/20147/7/2014

9/30/2015 9/30/20159/30/2015 9/30/20159/30/2015 9/30/20159/30/2015 9/30/20159/30/2015 12/31/20139/30/2015 12/31/20139/30/2015 12/31/2013

SR.02.01 (201) 9/30/2015 7/15/20177/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/2014

9/30/20159/30/2015 12/31/2013

7/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/2014 9/30/2015

9/30/20157/7/2014

9/30/20157/7/2014 9/30/2015

9/30/2015

Page 925: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015S.06.02 (210), SE.06.02 (210 7/15/2016

7/7/20147/7/2014

7/15/20169/30/2015

7/7/20147/7/2014

S.01.03 (210) 7/15/20167/15/20169/30/2015 7/15/2016

S.33.01 (201) 7/15/2016 7/15/20177/7/2014

9/30/20159/30/2015 7/15/20169/30/2015 7/15/2016

S.01.03 (201) 7/15/20167/7/20147/7/2014 7/15/2016

9/30/2015 7/15/20169/30/2015 7/15/2016

S.01.03 (210) 7/15/20167/15/20169/30/2015 7/15/20167/15/2016

Page 926: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerTotal/NA x0 yes s2cAccepted during the period x1 s2cAccepted during the period [covered after the period] x2 s2cAccepted during the period [covered during the period] x3 s2cAccepted prior to the period x4 s2cAccepted prior to the period [covered after the period] x5 s2cAccepted prior to the period [covered during the period] x6 s2cAssuming hedging x7 s2cAviation x8 s2cAviation [hull] x9 s2cAviation [liability] x10 s2cBefore diversification effect x11 s2cCatastrophe risk non-proportional property reinsurance x12 s2cCounter-cyclical premium risk x13 s2cCounterparty default risk x14 s2cCovered after the period x15 s2cCovered after the period [accepted during or prior to the periodx16 s2cCovered and accepted after the period x17 s2cCovered during the period x18 s2cCovered prior to the period x19 s2cCredit & Suretyship x20 s2cCredit & Suretyship [large credit default] x21 s2cCredit & Suretyship [large credit default] 1st biggest x22 s2cCredit & Suretyship [large credit default] 2nd biggest x23 s2cCredit & Suretyship [recession risk] x24 s2cCurrency risk x25 s2cDelta hedged x26 s2cDelta, rho, gamma, vega and FX hedged risks x27 s2cDirectors and officers liability x28 s2cDiversification effect x29 s2cEarthquake x30 s2cEmployers liability x31 s2cEquity risk x32 s2cEquity risk [duration based] x33 s2cEquity risk [other than duration based] x34 s2cFire x35 s2cFlood x36 s2cFurther segmentation into HRGs x37 s2cFX hedged x38 s2cGamma hedged x39 s2cHail x40 s2cHealth accident concentration risk x41 s2cHealth accident concentration risk [accidental death] x42 s2cHealth accident concentration risk [disability 10 years] x43 s2cHealth accident concentration risk [disability 12 months] x44 s2cHealth accident concentration risk [medical treatment] x45 s2cHealth accident concentration risk [permanent disability] x46 s2cHealth catastrophe risk x47 s2cHealth disability-morbidity risk x48 s2cHealth expense risk x49 s2c

Page 927: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Health longevity risk x50 s2cHealth mass accident risk x51 s2cHealth mass accident risk [accidental death] x52 s2cHealth mass accident risk [disability 10 years] x53 s2cHealth mass accident risk [disability 12 months] x54 s2cHealth mass accident risk [medical treatment] x55 s2cHealth mass accident risk [permanent disability] x56 s2cHealth mortality risk x57 s2cHealth pandemic risk x58 s2cHealth pandemic risk [hospitalisation cost] x59 s2cHealth pandemic risk [income protection] x60 s2cHealth pandemic risk [medical expenses] x61 s2cHealth pandemic risk [medical practitioner] x62 s2cHealth pandemic risk [no formal medical care] x63 s2cHealth revision risk x64 s2cHealth underwriting risk x65 s2cHedged risks other than delta, rho, gamma, vega and FX x66 s2cInsurance risk x67 s2cIntangible asset risk x68 s2cInterest rate down shock x69 s2cInterest rate risk x70 s2cInterest rate up shock x71 s2cLiability x72 s2cLiability other than professional malpractice, employers, directorsx73 s2cLife catastrophe risk x74 s2cLife disability-morbidity risk x75 s2cLife expense risk x76 s2cLife lapse risk x77 s2cLife longevity risk x78 s2cLife mass lapse risk x79 s2cLife mortality risk x80 s2cLife revision risk x81 s2cLife risk of decrease in lapse rates x82 s2cLife risk of increase in lapse rates x83 s2cLife underwriting risk x84 s2cMan-made catastrophe risk x85 s2cMarine x86 s2cMarine platform explosion x87 s2cMarine platform explosion [capping of the well or making the wex88 s2cMarine platform explosion [liability insurance and reinsurance obx89 s2cMarine platform explosion [loss of production income] x90 s2cMarine platform explosion [property damage] x91 s2cMarine platform explosion [removal of wreckage] x92 s2cMarine tanker collision x93 s2cMarine tanker collision [hull] x94 s2cMarine tanker collision [liability] x95 s2cMarine tanker collision [oil pollution liability] x96 s2cMarket risk x97 s2cMarket risk concentrations x98 s2cMAT other than marine and aviation x99 s2cMiscellaneous financial loss x100 s2c

Page 928: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Motor vehicle liability x101 s2cNatural catastrophe risk x102 s2cNo further segmentation into HRGs x103 s2cNon-life catastrophe risk x104 s2cNon-life lapse risk x105 s2cNon-life underwriting premium and reserve risk x106 s2cNon-life underwriting premium risk x107 s2cNon-life underwriting reserve risk x108 s2cNon-life underwriting risk x109 s2cNon-proportional casualty reinsurance other than general liabili x110 s2cNon-proportional credit & surety reinsurance x111 s2cNon-proportional liability reinsurance x112 s2cNon-proportional MAT reinsurance other than marine and aviat x113 s2cNot assuming hedging x114 s2cNot treated per components x115 s2cNSLT health lapse risk x116 s2cNSLT health premium and reserve risk x117 s2cNSLT health premium risk x118 s2cNSLT health reserve risk x119 s2cNSLT health underwriting risk x120 s2cOperational risk x121 s2cOperational risk [based on earned premiums] x122 s2cOperational risk [based on technical provisions] x123 s2cOperational risk [partial internal model] x124 s2cOperational risk [standard approach] x125 s2cOther non-life catastrophe risk x126 s2cProfessional malpractice liability x127 s2cProperty risk x128 s2cReceivables from intermediaries due for more than 3 months x129 s2cRho hedged x130 s2cRisks inside ring fenced funds/matching portfolios x131 s2cRisks other than operational risk [standard approach] x132 s2cRisks outside ring fenced funds/matching portfolios x133 s2cScenario A x134 s2cScenario B x135 s2cSLT health lapse risk x136 s2cSLT health risk of decrease in lapse rates x137 s2cSLT health risk of increase in lapse rates x138 s2cSLT health underwriting risk x139 s2cSLT health mass lapse risk x140 s2cSpread risk x141 s2cSpread risk downward shock x142 s2cSpread risk upward shock x143 s2cSubsidence x144 s2cTreated per components x145 s2cType 1 exposures x146 s2cType 2 exposures x147 s2cType 2 exposures other than receivables from intermediaries d x148 s2cVega hedged x149 s2cWindstorm x150 s2cRisks other than operational x151 s2c

Page 929: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Risks other than operational and intangible asset risk x152 s2cCredit & Suretyship [large credit default] Sum of 1st and 2nd bigx153 s2cHealth disability-morbidity risk [medical expenses] x154 s2cHealth disability-morbidity risk [income protection] x155 s2cIncrease currency risk x156 s2cDecrease currency risk x157 s2cSpread risk [type 1 securitisations] x158 s2cSpread risk [type 2 securitisations] x159 s2cSpread risk [resecuritisations] x160 s2cNo basis risk x161 s2cInsufficient subordination for note holders x162 s2cInvestors’ additional recourse against cedant x163 s2cAdditional risks were securitised subsequent to authorisation x164 s2cCedants hold exposure to notes issued x165 s2cOther risk than insufficient subordination for note holders, inve x166 s2cSubstantial part of risks insured not transferred x167 s2cInsufficient trigger to match risk exposure of cedant x168 s2cCover excludes all catastrophic guarantees x169 s2cEarthquake, volcanic eruption, tidal wave etc. are covered x170 s2cFlood is covered x171 s2cHurricane, windstorm, etc. are covered x172 s2cOther risks such as freeze, hail, strong wind are covered x173 s2cTerrorism is covered x174 s2cSRCC (strikes, riots, civil commotion), sabotage, popular uprisin x175 s2cEarthquake, volcanic eruption, tidal wave, flood, hurricane, windsx176 s2cRisks not otherwise included in the listed items are covered x177 s2c

Page 930: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modified datCount Comment7/7/2014 117/7/2014 17/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 37/7/2014 17/7/2014 9/30/2015 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 17/7/2014 37/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 07/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 931: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

Page 932: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 12/31/2013 07/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 9/30/2015 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 07/7/2014 9/30/2015 07/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 9/30/2015 17/7/2014 12/31/2013 07/7/2014 12/31/2013 9/30/2015 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 27/7/2014 17/7/2014 17/7/2014 17/7/2014 9/30/2015 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 1

Page 933: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 1

9/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 7/15/2016 19/30/2015 7/15/2016 19/30/2015 7/15/2016 19/30/2015 29/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 17/15/2016 17/15/2016 17/15/2016 17/15/2016 17/15/2016 17/15/2016 17/15/2016 17/15/2016 17/15/2016 1

Page 934: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy1: Types of hedged risks

Total/NADelta, rho, gamma, vega and FX hedged risks

Delta hedgedRho hedgedGamma hedgedVega hedgedFX hedged

Hedged risks other than delta, rho, gamma, vega and FX3: Risks inside or outside ring fenced funds

Total/NARisks inside ring fenced funds/matching portfoliosRisks outside ring fenced funds/matching portfolios

4: Acceptance/cover of risksTotal/NA

Covered during the periodAccepted during the period [covered during the period]Accepted prior to the period [covered during the period]

Covered after the periodCovered after the period [accepted during or prior to the period]

Accepted during the period [covered after the period]Accepted prior to the period [covered after the period]

Covered and accepted after the periodCovered prior to the period

5: Acceptance/cover of risksTotal/NA

Accepted during the periodAccepted during the period [covered during the period]Accepted during the period [covered after the period]

Accepted prior to the period6: Risk types

Total/NAOperational risk

Operational risk [based on earned premiums]Operational risk [based on technical provisions]

Risks other than operationalIntangible asset riskRisks other than operational and intangible asset risk

Market riskInterest rate risk

Interest rate down shockInterest rate up shock

Equity riskEquity risk [duration based]Equity risk [other than duration based]

Property riskSpread risk

Spread risk downward shockSpread risk upward shock

Market risk concentrations

Page 935: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Currency riskIncrease currency riskDecrease currency risk

Counter-cyclical premium riskCounterparty default risk

Type 1 exposuresType 2 exposures

Receivables from intermediaries due for more than 3 monthsType 2 exposures other than receivables from intermediaries due for more than 3 months

Insurance riskLife underwriting risk

Life mortality riskLife longevity riskLife disability-morbidity riskLife lapse risk

Life risk of increase in lapse ratesLife risk of decrease in lapse ratesLife mass lapse risk

Life expense riskLife revision riskLife catastrophe risk

Health underwriting riskSLT health underwriting risk

Health mortality riskHealth longevity riskHealth disability-morbidity risk

Health disability-morbidity risk [medical expenses]Health disability-morbidity risk [income protection]

SLT health lapse riskSLT health risk of increase in lapse ratesSLT health risk of decrease in lapse ratesSLT health mass lapse risk

Health expense riskHealth revision risk

NSLT health underwriting riskNSLT health premium and reserve risk

NSLT health premium riskNSLT health reserve risk

NSLT health lapse riskHealth catastrophe risk

Health mass accident riskHealth mass accident risk [accidental death]Health mass accident risk [permanent disability]Health mass accident risk [disability 10 years]Health mass accident risk [disability 12 months]Health mass accident risk [medical treatment]

Health accident concentration riskHealth accident concentration risk [accidental death]Health accident concentration risk [permanent disability]Health accident concentration risk [disability 10 years]Health accident concentration risk [disability 12 months]

Page 936: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Health accident concentration risk [medical treatment]Health pandemic risk

Health pandemic risk [income protection]Health pandemic risk [medical expenses]

Health pandemic risk [hospitalisation cost]Health pandemic risk [medical practitioner]Health pandemic risk [no formal medical care]

Non-life underwriting riskNon-life underwriting premium and reserve risk

Non-life underwriting premium riskNon-life underwriting reserve risk

Non-life lapse riskNon-life catastrophe risk

Natural catastrophe riskWindstormEarthquakeFloodHailSubsidence

Catastrophe risk non-proportional property reinsuranceMan-made catastrophe risk

Motor vehicle liabilityMarine

Marine tanker collisionMarine tanker collision [hull]Marine tanker collision [liability]Marine tanker collision [oil pollution liability]

Marine platform explosionMarine platform explosion [property damage]Marine platform explosion [removal of wreckage]Marine platform explosion [loss of production income]Marine platform explosion [capping of the well or making the well secure]Marine platform explosion [liability insurance and reinsurance obligations]

AviationAviation [hull]Aviation [liability]

FireLiability

Professional malpractice liabilityEmployers liabilityDirectors and officers liabilityLiability other than professional malpractice, employers, directors and officers liabilityNon-proportional liability reinsurance

Credit & SuretyshipCredit & Suretyship [large credit default]Credit & Suretyship [large credit default] Sum of 1st and 2nd biggest

Credit & Suretyship [large credit default] 1st biggestCredit & Suretyship [large credit default] 2nd biggest

Credit & Suretyship [recession risk]Other non-life catastrophe risk

MAT other than marine and aviation

Page 937: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Non-proportional MAT reinsurance other than marine and aviationMiscellaneous financial lossNon-proportional casualty reinsurance other than general liabilityNon-proportional credit & surety reinsurance

7: Treatment of componentsTotal/NA

Treated per componentsNot treated per components

8: Scenarios related to hedgingTotal/NA

Assuming hedgingNot assuming hedging

9: Diversification of risk [on indicated level of risk aggregation]Total/NA

Before diversification effectDiversification effect

10: Risk scenarioTotal/NA

Scenario AScenario B

11: Not recognized diversification of risk [on indicated level of risk aggregation between RFF and remaining]Total/NA

Before diversification effectDiversification effect

12: Risk typesSpread risk

Spread risk [type 1 securitisations]Spread risk [type 2 securitisations]Spread risk [resecuritisations]

13: Risk typesNo basis riskInsufficient subordination for note holdersInvestors’ additional recourse against cedantAdditional risks were securitised subsequent to authorisationCedants hold exposure to notes issuedOther risk than insufficient subordination for note holders, investors’ additional recourse against cedant, additional risks were sec

14: Risk typesNo basis riskSubstantial part of risks insured not transferredInsufficient trigger to match risk exposure of cedant

15: Recognized diversification of risk [on indicated level of risk aggregation between RFF and remaining]Total/NA

Before diversification effectDiversification effect

16: Inclusion of catastrophic reinsurance coverCover excludes all catastrophic guaranteesEarthquake, volcanic eruption, tidal wave etc. are coveredFlood is coveredHurricane, windstorm, etc. are coveredOther risks such as freeze, hail, strong wind are coveredTerrorism is covered

Page 938: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

SRCC (strikes, riots, civil commotion), sabotage, popular uprising are coveredEarthquake, volcanic eruption, tidal wave, flood, hurricane, windstorm, freeze, hail, strong wind, terrorism, SRCC (strikes, riots, civRisks not otherwise included in the listed items are covered

Page 939: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Hierarchy nSign Weight Owner Usable Applicable Applicable Creation dates2c HD 7/7/2014

x0 Total/NA = 7/7/2014x27 Delta, rho, = + 7/7/2014x26 Delta hedged + 7/7/2014x130 Rho hedged + 7/7/2014x39 Gamma hedged + 7/7/2014x149 Vega hedged + 7/7/2014x38 FX hedged + 7/7/2014x66 Hedged risks other tha+ 7/7/2014

s2c FZ 7/7/2014x0 Total/NA = 7/7/2014x131 Risks inside ring fence + 7/7/2014x133 Risks outside ring fen + 7/7/2014

s2c IZ 7/7/2014x0 Total/NA = 7/7/2014x18 Covered dur= + 7/7/2014x3 Accepted during the pe+ 7/7/2014x6 Accepted prior to the + 7/7/2014x15 Covered aft= + 7/7/2014x16 Covered aft= + 7/7/2014x2 Accepted during the pe+ 7/7/2014x5 Accepted prior to the p+ 7/7/2014x17 Covered and accepted a+ 7/7/2014x19 Covered prior to the p + 7/7/2014

s2c IZ 7/7/2014x0 Total/NA = 7/7/2014x1 Accepted du= + 7/7/2014x3 Accepted during the pe+ 7/7/2014x2 Accepted during the pe+ 7/7/2014x4 Accepted prior to the + 7/7/2014

s2c RT 7/7/2014x0 Total/NA = 7/7/2014x121 Operational risk + 7/7/2014x122 Operational risk [based on earned premiums] 7/7/2014x123 Operational risk [based on technical provisions] 7/7/2014x151 Risks other = + 7/7/2014x68 Intangible asset risk + 7/7/2014x152 Risks other = + 7/7/2014x97 Market risk= + 7/7/2014x70 Interest rate risk + 7/7/2014x69 Interest rate down shock 7/7/2014x71 Interest rate up shock 7/7/2014x32 Equity risk + 7/7/2014x33 Equity risk [duration based] 7/7/2014x34 Equity risk [other than duration based] 7/7/2014x128 Property risk + 7/7/2014x141 Spread risk + 7/7/2014x142 Spread risk downward shock 7/7/2014x143 Spread risk upward shock 7/7/2014x98 Market risk concentrat+ 7/7/2014

Page 940: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x25 Currency risk + 7/7/2014x156 Increase currency risk 9/30/2015x157 Decrease currency risk 9/30/2015x13 Counter-cyclical premi+ 7/7/2014x14 Counterparty default ri+ 7/7/2014x146 Type 1 exposures 7/7/2014x147 Type 2 exposures 7/7/2014x129 Receivables from intermediaries due for more than 3 months 7/7/2014x148 Type 2 exposures other than receivables from intermediaries due for more tha 7/7/2014x67 Insurance r= + 7/7/2014x84 Life underwr= + 7/7/2014x80 Life mortality risk + 7/7/2014x78 Life longevity risk + 7/7/2014x75 Life disability-morbidity+ 7/7/2014x77 Life lapse risk + 7/7/2014x83 Life risk of increase in lapse rates 7/7/2014x82 Life risk of decrease in lapse rates 7/7/2014x79 Life mass lapse risk 7/7/2014x76 Life expense risk + 7/7/2014x81 Life revision risk + 7/7/2014x74 Life catastrophe risk + 7/7/2014x65 Health unde= + 7/7/2014x139 SLT health = + 7/7/2014x57 Health mortality risk + 7/7/2014x50 Health longevity risk + 7/7/2014x48 Health disab= + 7/7/2014x154 Health disability-morbi+ 9/30/2015x155 Health disability-morbi+ 9/30/2015x136 SLT health lapse risk + 7/7/2014x138 SLT health risk of increase in lapse rates 7/7/2014x137 SLT health risk of decrease in lapse rates 7/7/2014x140 SLT health mass lapse risk 7/7/2014x49 Health expense risk + 7/7/2014x64 Health revision risk + 7/7/2014x120 NSLT health= + 7/7/2014x117 NSLT health premium and reserve risk 7/7/2014x118 NSLT health premium risk 7/7/2014x119 NSLT health reserve risk 7/7/2014x116 NSLT health lapse risk 7/7/2014x47 Health cata= + 7/7/2014x51 Health mass accident r+ 7/7/2014x52 Health mass accident risk [accidental death] 7/7/2014x56 Health mass accident risk [permanent disability] 7/7/2014x53 Health mass accident risk [disability 10 years] 7/7/2014x54 Health mass accident risk [disability 12 months] 7/7/2014x55 Health mass accident risk [medical treatment] 7/7/2014x41 Health accident concen+ 7/7/2014x42 Health accident concentration risk [accidental death] 7/7/2014x46 Health accident concentration risk [permanent disability] 7/7/2014x43 Health accident concentration risk [disability 10 years] 7/7/2014x44 Health accident concentration risk [disability 12 months] 7/7/2014

Page 941: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x45 Health accident concentration risk [medical treatment] 7/7/2014x58 Health pandemic risk + 7/7/2014x60 Health pandemic risk [income protection] 7/7/2014x61 Health pandemic risk [medical expenses] 7/7/2014x59 Health pandemic risk [hospitalisation cost] 7/7/2014x62 Health pandemic risk [medical practitioner] 7/7/2014x63 Health pandemic risk [no formal medical care] 7/7/2014x109 Non-life und= + 7/7/2014x106 Non-life underwriting + 7/7/2014x107 Non-life underwriting premium risk 7/7/2014x108 Non-life underwriting reserve risk 7/7/2014x105 Non-life lapse risk + 7/7/2014x104 Non-life ca = + 7/7/2014x102 Natural cat= + 7/7/2014x150 Windstorm + 7/7/2014x30 Earthquake + 7/7/2014x36 Flood + 7/7/2014x40 Hail + 7/7/2014x144 Subsidence + 7/7/2014x12 Catastrophe risk non-p+ 7/7/2014x85 Man-made c= + 7/7/2014x101 Motor vehicle liability + 7/7/2014x86 Marine = + 7/7/2014x93 Marine tank= + 7/7/2014x94 Marine tanker collision + 7/7/2014x95 Marine tanker collision [+ 7/7/2014x96 Marine tanker collision [+ 7/7/2014x87 Marine plat= + 7/7/2014x91 Marine platform explo+ 7/7/2014x92 Marine platform explo+ 7/7/2014x90 Marine platform explos+ 7/7/2014x88 Marine platform explos+ 7/7/2014x89 Marine platform explosi+ 7/7/2014x8 Aviation = + 7/7/2014x9 Aviation [hull] + 7/7/2014x10 Aviation [liability] + 7/7/2014x35 Fire + 7/7/2014x72 Liability = + 7/7/2014x127 Professional malpractice+ 7/7/2014x31 Employers liability + 7/7/2014x28 Directors and officers li+ 7/7/2014x73 Liability other than pro+ 7/7/2014x112 Non-proportional liabil+ 7/7/2014x20 Credit & Suretyship + 7/7/2014x21 Credit & Suretyship [large credit default] 7/7/2014x153 Credit & Suretyship [large credit default] Sum of 1st and 2nd biggest 7/7/2014x22 Credit & Suretyship [large credit default] 1st biggest 7/7/2014x23 Credit & Suretyship [large credit default] 2nd biggest 7/7/2014x24 Credit & Suretyship [recession risk] 7/7/2014x126 = + 7/7/2014x99 MAT other than marine+ 7/7/2014

Page 942: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x113 Non-proportional MAT + 7/7/2014x100 Miscellaneous financial+ 7/7/2014x110 Non-proportional casual+ 7/7/2014x111 Non-proportional credi+ 7/7/2014

s2c N/A 7/7/2014x0 Total/NA = 7/7/2014x145 Treated per componen+ 7/7/2014x115 Not treated per compo+ 7/7/2014

s2c SH 7/7/2014x0 Total/NA 7/7/2014x7 Assuming hedging 7/7/2014x114 Not assuming hedging 7/7/2014

s2c DV 7/7/2014x0 Total/NA 7/7/2014x11 Before diversification effect 7/7/2014x29 Diversification effect 7/7/2014

s2c N/A S.27.01 (20 7/7/2014x0 Total/NA 7/7/2014x134 Scenario A 7/7/2014x135 Scenario B 7/7/2014

s2c UG 7/7/2014x0 Total/NA 7/7/2014x11 Before diversification effect 7/7/2014x29 Diversification effect 7/7/2014

s2c RT 9/30/2015x141 Spread risk 7/7/2014x158 Spread risk [type 1 securitisations] 9/30/2015x159 Spread risk [type 2 securitisations] 9/30/2015x160 Spread risk [resecuritisations] 9/30/2015

s2c RT S.31.02 (20 9/30/2015x161 1 - No basis risk 9/30/2015x162 2 - Insufficient subordination for note holders 9/30/2015x163 3 - Investors’ additional recourse against cedant 9/30/2015x164 4 - Additional risks were securitised subsequent to authorisation 9/30/2015x165 5 - Cedants hold exposure to notes issued 9/30/2015x166 9 - Other 9/30/2015

s2c RT S.31.02 (20 9/30/2015x161 1 - No basis risk 9/30/2015x167 2 - Substantial part of risks insured not transferred 9/30/2015x168 3 - Insufficient trigger to match risk exposure of cedant 9/30/2015

s2c UH 9/30/2015x0 Total/NA 7/7/2014x11 Before diversification effect 7/7/2014x29 Diversification effect 7/7/2014

s2c N/A 7/15/2016x169 1 - cover excludes all catastrophic guarantees 7/15/2016x170 2 - earthquake, volcanic eruption, tidal wave etc. are covered 7/15/2016x171 3 - flood is covered 7/15/2016x172 4 - hurricane, windstorm, etc. are covered 7/15/2016x173 5 - other risks such as freeze, hail, strong wind are covered 7/15/2016x174 6 - terrorism is covered 7/15/2016

Page 943: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x175 7 - SRCC (strikes, riots, civil commotion), sabotage, popular uprising are covere 7/15/2016x176 8 - all the above mentioned risks are covered 7/15/2016x177 9 - risks not otherwise included in the listed items are covered 7/15/2016

Page 944: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modified date Comment

12/31/201312/31/201312/31/201312/31/201312/31/201312/31/2013

9/30/201512/31/2013 9/30/2015

12/31/201312/31/2013

12/31/201312/31/201312/31/201312/31/2013

12/31/201312/31/2013

7/15/2016

Page 945: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

12/31/2013

12/31/2013

Page 946: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

12/31/2013

Page 947: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/2015

7/15/2016

7/15/20167/15/20167/15/2016

Page 948: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 949: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity dateTotal/NA x0 yes s2c 7/7/2014Closed x1 s2c 7/7/2014Newly reported x2 s2c 7/7/2014Open x3 s2c 7/7/2014Open and settled [with payment] x4 s2c 7/7/2014Other than salvages and subrogationsx5 s2c 7/7/2014Reopened x6 s2c 7/7/2014Salvages and subrogations x7 s2c 7/7/2014Settled [with payment] x8 s2c 7/7/2014Settled [without payment] x9 s2c 7/7/2014

Page 950: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modifi Count Comment Hierarchy Name1 1: Status of claim at a beginning of period2 Open x31 Closed x13 2: Status of claim at the end of period1 Open x31 Closed x11 Settled [with payment] x81 Settled [without payment] x92 3: Change of status during the period2 Newly reported x2

Reopened x64: Change of status during the period

Open and settled [with payment] x4Open x3Settled [with payment] x8

Settled [without payment] x95: Type of claim

Total/NA x0Salvages and subrogations x7Other than salvages and subrogations x5

Page 951: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy nSign Weight Owner Usable Applicable Applicable Creation date Validity dates2c SB 7/7/2014

Open 7/7/2014Closed 7/7/2014

s2c SD 7/7/2014Open 7/7/2014Closed 7/7/2014Settled [with payment] 7/7/2014Settled [without payment] 7/7/2014

s2c CH 7/7/2014Newly reported 7/7/2014Reopened 7/7/2014

s2c CH 7/7/2014Open and settled [with payment] 7/7/2014Open 7/7/2014Settled [with payment] 7/7/2014Settled [without payment] 7/7/2014

s2c AI 7/7/2014Total/NA = 7/7/2014Salvages and subrogat+ 7/7/2014Other than salvages a + 7/7/2014

Page 952: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modifi Comment

Page 953: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name DefaultTotal/NA x0 yesAlternative funds x1Ancillary services x2Ancillary services undertaking as defined in Article 1 (53) of Delegated Regulation (EU) x3Asset allocation funds x4Automobiles and Components x5Banks x6Capital Goods x7Commercial & Professional Services x8Composite insurer x9Undertakings pursuing both life and non-life insurance activity x10Consumer Durables and Apparel x11Consumer Services x12Corporate x13Corporate other than investment funds x14Credit institutions, investment firms and financial institutions, alternative investme x16Credit institutions x17Debt funds x18Diversified Financials x19Energy x20Entities carrying out financial activities x21Entities not carrying out financial activities x22Equity funds x23External reinsurer x24Financial and credit institutions x25Finite reinsurance x26Finite reinsurance undertakings x27Food & Staples Retailing x28Food, Beverage & Tobacco x29General government x30General government and corporate x31Health Care Equipment & Services x32Household & Personal Products x33Households x34Infrastructure funds x35Institutions for occupational retirement provision x37Insurance x38Insurance counterparties x39Insurance holding company x40Insurance holding company as defined in Art. 212§ [f] of Directive 2009/138/EC x41Insurance/Reinsurance x42Insurance/reinsurance counterparties x43Insurance/reinsurance sector x44Insurance/reinsurance undertakings x45Internal reinsurer x46Investment funds x47Investment funds other than equity funds, debt funds, money market funds, asset allocatix48Life insurer x49Materials x50Media x51

Page 954: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Mixed-activity insurance holding company as defined in Art. 212§1 [g] of Directive 200 x52Money market funds x53Mutual x54Non regulated entities carrying out financial activities x55Non-composite undertaking x56Non-life insurer x57Non-mutual x58Non-regulated financial x59Non-regulated undertaking carrying out financial activities as defined in Article 1 (52) x60Other than financial and credit institutions, insurance/reinsurance, third-country re-in x61Other than financial and credit institutions x62Other than households x63Other than households, general government and corporate x64Other than insurance/reinsurance sector x65Other than insurance/reinsurance undertakings x66Other than insurance/reinsurance undertakings and credit institutions x67Pharmaceuticals, Biotechnology & Life Sciences x68Pool entity x69Private equity funds x70Real Estate x71Real estate funds x72Reinsurance captive x73Reinsurance counterparties x74Reinsurance undertakings x75Reinsurers other than SPV and finite reinsurance x76Retailing x77Semiconductors & Semiconductor Equipment x78Software & Services x79Special purpose vehicle [SPV] x80Special purpose vehicle authorized in accordance with Art. 211 of Directive 2009/138/E x81Special purpose vehicle other special purpose vehicle authorized in accordance with Artx82SPV [incorporated] x83SPV [not incorporated] x84Technology Hardware & Equipment x85Telecommunication Services x86Third-country re-insurance x87Transportation x88Utilities x89Other than credit institutions x90Sovereign x91Supranational x92Other x93Mixed financial holding company as defined in Art. 212§1 [h] of Directive 2009/138/EC x94Life undertakings x95Non-Life undertakings x96Direct Life insurer x97Direct Non-life insurer x98Direct Composite insurer x99Captive insurance undertaking x100State pool x101Reinsurance undertaking x102

Page 955: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

UCITS management companies as defined in Article 1 (54) of Delegated Regulation (EU) x103Alternative investment funds managers as defined in Article 1 (55) of Implementing me x104SPV fully funded in relation to cedant obligations x105SPV not fully funded in relation to cedant obligations x106Trusts x107Partnerships x108Limited liability companies x109Other legal entity form not referred above x110Not incorporated x111Central bank (ESA 2010 sector S.121) x112Deposit-taking corporations except the central bank (ESA sector S.122) x113Money market funds (ESA sector S.123) x114Investment funds except money market funds (ESA sector S.124) x115Other financial intermediaries, except insurance corporations and pension funds (excludix116Financial vehicle corporations engaged in securitisation transactions (a subdivision of E x117Insurance corporations (ESA sector S.128) x118Pension funds (ESA sector S.129) x119Non-financial corporations (ESA sector S.11) x120General government (ESA sector S.13) x121Households and non-profit institutions serving households (ESA sector S.14 + ESA sectox122Contribution to the group x123Alternative investment funds managers as defined in Article 1 (55) of Delegated Regula x124Credit institutions, investment firms and financial institutions x125Insurance/reinsurance sector and entities not carrying out financial activities x126Regulated entities [other than insurance/reinsurance sector] carrying out financial activix127Insurance/reinsurance sector, non regulated entities carrying out financial activities and ex128Undertakings pursuing both life and non-life insurance activity - article 73 (2) x129Undertakings pursuing both life and non-life insurance activity - article 73 (5) x130Euler Hermes Rating GmbH (LEI code: 391200QXGLWHK9VK6V27) x131Japan Credit Rating Agency Ltd (LEI code: 35380002378CEGMRVW86) x132BCRA-Credit Rating Agency AD (LEI code: 747800Z0IC3P66HTQ142) x133Creditreform Rating AG (LEI code: 391200PHL11KDUTTST66) x134Scope Ratings AG (previously PSR Rating GmbH) (LEI code: 391200WU1EZUQFHDWE91)x135ICAP Group SA (LEI code: 2138008U6LKT8VG2UK85) x136GBB-Rating Gesellschaft für Bonitätsbeurteilung GmbH (LEI code: 391200OLWXCTKPAD x137ASSEKURATA Assekuranz Rating-Agentur GmbH (LEI code: 529900977LETWLJF3295) x138ARC Ratings, S.A. (previously Companhia Portuguesa de Rating, S.A) (LEI code: 2138 x139AM Best Europe-Rating Services Ltd. (AMBERS) (LEI code: 549300VO8J8E5IQV1T26) x140DBRS Ratings Limited (LEI code: 5493008CGCDQLGT3EH93) x141Fitch France S.A.S. (LEI code: 2138009Y4TCZT6QOJO69) x142Fitch Deutschland GmbH (LEI code: 213800JEMOT1H45VN340) x143Fitch Italia S.p.A. (LEI code: 213800POJ9QSCHL3KR31) x144Fitch Polska S.A. (LEI code: 213800RYJTJPW2WD5704) x145Fitch Ratings España S.A.U. (LEI code: 213800RENFIIODKETE60) x146Fitch Ratings Limited (LEI code: 2138009F8YAHVC8W3Q52) x147Fitch Ratings CIS Limited (LEI code: 213800B7528Q4DIF2G76) x148Moody’s Investors Service Cyprus Ltd (LEI code: 549300V4LCOYCMNUVR81) x149Moody’s France S.A.S. (LEI code: 549300EB2XQYRSE54F02) x150Moody’s Deutschland GmbH (LEI code: 549300M5JMGHVTWYZH47) x151Moody’s Italia S.r.l. (LEI code: 549300GMXJ4QK70UOU68) x152Moody’s Investors Service España S.A. (LEI code: 5493005X59ILY4BGJK90) x153

Page 956: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Moody’s Investors Service Ltd (LEI code: 549300SM89WABHDNJ349) x154Standard & Poor’s Credit Market Services France S.A.S. (LEI code: 54930035REY2YCDSB x155Standard & Poor’s Credit Market Services Italy S.r.l. (LEI code: 54930000NMOJ7ZBUQ06x156Standard & Poor’s Credit Market Services Europe Limited (LEI code: 549300363WVTTH x157

x158Capital Intelligence Ratings Ltd (LEI code: 549300RE88OJP9J24Z18) x159European Rating Agency, a.s. (LEI code: 097900BFME0000038276) x160Axesor conocer para decidir SA (LEI code: 95980020140005900000) x161Cerved Rating Agency S.p.A. (previously CERVED Group S.p.A. ) (LEI code: 8156004AB6 x162Kroll Bond Rating Agency (LEI code: 549300QYZ5CZYXTNZ676) x163The Economist Intelligence Unit Ltd (LEI code: 213800Q7GRZWF95EWN10) x164Dagong Europe Credit Rating Srl (Dagong Europe) (LEI code: 815600BF4FF53B7C6311) x165Spread Research (LEI code: ) x166EuroRating Sp. z o.o. (LEI code: 25940027QWS5GMO74O03) x167HR Ratings de México, S.A. de C.V. (HR Ratings) (LEI code: 549300IFL3XJKTRHZ480) x168Moody’s Investors Service EMEA Ltd (LEI code: 54930009NU3JYS1HTT72) x169Egan-Jones Ratings Co. (EJR) (LEI code: 54930016113PD33V1H31) x170modeFinance S.r.l. (LEI code: 815600B85A94A0122614) x171INC Rating Sp. z o.o. (LEI code: ) x172Rating-Agentur Expert RA GmbH (LEI code: 213800P3OOBSGWN2UE81) x173Feri EuroRating Services AG (LEI code: 529900CSQE528B8SHP93) x174Other nominated ECAI x175

CRIF S.p.A. (LEI code: 815600EAE45F55EE5B73)

Page 957: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Owner Creation date Validity date Last modified date Count Comments2c 7/7/2014 12s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 3s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 4s2c 7/7/2014 7/15/2017 9/30/2015 2s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 9/30/2015 1s2c 7/7/2014 9/30/2015 4s2c 7/7/2014 3s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 3s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 9/30/2015 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 9/30/2015 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 6s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 3s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 3s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 9/30/2015 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 3s2c 7/7/2014 1s2c 7/7/2014 9/30/2015 0

Page 958: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c 7/7/2014 3s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 3s2c 7/7/2014 1s2c 7/7/2014 3s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 3s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 2s2c 7/7/2014 2s2c 7/7/2014 3s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 4s2c 7/7/2014 3s2c 7/7/2014 3s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 9/30/2015 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 3s2c 7/7/2014 3s2c 9/30/2015 4s2c 9/30/2015 4s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1

Page 959: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c 9/30/2015 2s2c 9/30/2015 12/31/2013 0s2c 9/30/2015 2s2c 9/30/2015 2s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 2s2c 9/30/2015 2s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2016 1s2c 7/15/2017 2s2c 7/15/2017 2s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1

Page 960: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1s2c 7/15/2017 1

Page 961: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy1: Counterparties

Total/NAHouseholdsOther than households

General government and corporateGeneral governmentCorporate

Investment fundsEquity fundsDebt fundsMoney market fundsAsset allocation fundsReal estate fundsAlternative fundsPrivate equity fundsInfrastructure fundsInvestment funds other than equity funds, debt funds, money market funds, asset allocation funds, real estate

Corporate other than investment fundsOther than households, general government and corporate

2: CounterpartiesTotal/NA

Insurance/reinsurance undertakingsInsurance counterpartiesReinsurance counterparties

Reinsurance undertakingsSpecial purpose vehicle [SPV]

SPV fully funded in relation to cedant obligationsSPV not fully funded in relation to cedant obligations

Finite reinsurance undertakingsOther than insurance/reinsurance undertakings

Credit institutionsOther than insurance/reinsurance undertakings and credit institutions

3:Reinsurance counterpartiesTotal/NA

Special purpose vehicle [SPV]SPV [incorporated]SPV [not incorporated]

Finite reinsuranceReinsurers other than SPV and finite reinsurance

4: CounterpartiesTotal/NA

Insurance/reinsurance counterpartiesInsurance counterpartiesReinsurance counterparties

Life insurerNon-life insurerComposite insurerInternal reinsurerExternal reinsurerReinsurance captive

Page 962: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Special purpose vehicle [SPV]Pool entity

Credit institutionsOther than insurance/reinsurance undertakings and credit institutions

5: Entities under consolidationTotal/NA

Insurance/reinsurance sectorOther than insurance/reinsurance sector

Entities carrying out financial activitiesCredit institutions, investment firms and financial institutions, alternative investment funds managers, UCITSInstitutions for occupational retirement provisionNon regulated entities carrying out financial activities

Entities not carrying out financial activities6: Issuer sector

Total/NASovereignSupranationalEnergyMaterialsCapital GoodsCommercial & Professional ServicesTransportationAutomobiles and ComponentsConsumer Durables and ApparelConsumer ServicesContribution to the groupRetailingFood & Staples RetailingFood, Beverage & TobaccoHousehold & Personal ProductsHealth Care Equipment & ServicesPharmaceuticals, Biotechnology & Life SciencesBanksDiversified FinancialsInsuranceReal EstateSoftware & ServicesTechnology Hardware & EquipmentSemiconductors & Semiconductor EquipmentTelecommunication ServicesUtilities

7: Counterparties (Preparatory scope)Total/NA

Life insurerNon-life insurerComposite insurerInsurance holding company as defined in Art. 212§ [f] of Directive 2009/138/ECMixed-activity insurance holding company as defined in Art. 212§1 [g] of Directive 2009/138/ECMixed financial holding company as defined in Art. 212§1 [h] of Directive 2009/138/ECCredit institutions, investment firms and financial institutions, alternative investment funds managers, UCITS maInstitutions for occupational retirement provision

Page 963: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Ancillary services undertaking as defined in Article 1 (53) of Delegated Regulation (EU) 2015/35Non-regulated undertaking carrying out financial activities as defined in Article 1 (52) of Delegated Regulation (EU)Special purpose vehicle authorized in accordance with Art. 211 of Directive 2009/138/ECSpecial purpose vehicle other special purpose vehicle authorized in accordance with Art. 211 of Directive 2009/138Other

8: Legal formMutualNon-mutual

10: CounterpartiesTotal/NA

Financial and credit institutionsOther than financial and credit institutions

Insurance/ReinsuranceThird-country re-insuranceInsurance holding companyAncillary servicesNon-regulated financialOther than financial and credit institutions, insurance/reinsurance, third-country re-insurance, insurance holding

11: Legal formTotal/NA

Undertakings pursuing both life and non-life insurance activityNon-composite undertaking

12: CounterpartiesTotal/NA

Credit institutionsOther than credit institutions

13: Type of undertakingUndertakings pursuing both life and non-life insurance activityLife undertakingsNon-Life undertakings

14: CounterpartiesDirect Life insurerDirect Non-life insurerDirect Composite insurerCaptive insurance undertakingInternal reinsurerExternal reinsurerReinsurance captiveSpecial purpose vehicle [SPV]Pool entityState pool

15: Counterparties (Full scope)Life insurerNon-life insurerReinsurance undertakingComposite insurerInsurance holding company as defined in Art. 212§ [f] of Directive 2009/138/ECMixed-activity insurance holding company as defined in Art. 212§1 [g] of Directive 2009/138/ECMixed financial holding company as defined in Art. 212§1 [h] of Directive 2009/138/ECCredit institutions, investment firms and financial institutionsInstitutions for occupational retirement provision

Page 964: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Ancillary services undertaking as defined in Article 1 (53) of Delegated Regulation (EU) 2015/35Non-regulated undertaking carrying out financial activities as defined in Article 1 (52) of Delegated Regulation (EU) Special purpose vehicle authorized in accordance with Art. 211 of Directive 2009/138/ECSpecial purpose vehicle other special purpose vehicle authorized in accordance with Art. 211 of Directive 2009/138/EUCITS management companies as defined in Article 1 (54) of Delegated Regulation (EU) 2015/35Alternative investment funds managers as defined in Article 1 (55) of Delegated Regulation (EU) 2015/35Other

16: Issuer sectorSPV fully funded in relation to cedant obligationsSPV not fully funded in relation to cedant obligations

17: Legal nature of SPVTrustsPartnershipsLimited liability companiesOther legal entity form not referred aboveNot incorporated

18: Issuer sectorCentral bank (ESA 2010 sector S.121)Deposit-taking corporations except the central bank (ESA sector S.122)Money market funds (ESA sector S.123)Investment funds except money market funds (ESA sector S.124)Other financial intermediaries, except insurance corporations and pension funds (excluding financial vehicle corporatioFinancial vehicle corporations engaged in securitisation transactions (a subdivision of ESA sector S.125)Insurance corporations (ESA sector S.128)Pension funds (ESA sector S.129)Non-financial corporations (ESA sector S.11)General government (ESA sector S.13)Households and non-profit institutions serving households (ESA sector S.14 + ESA sector S.15)

19: Entities under consolidationTotal/NA

Entities carrying out financial activitiesCredit institutions, investment firms and financial institutions, alternative investment funds managers, UCITS Institutions for occupational retirement provisionNon regulated entities carrying out financial activities

Insurance/reinsurance sector and entities not carrying out financial activitiesEntities not carrying out financial activitiesInsurance/reinsurance sector

20: Entities under consolidationTotal/NA

Regulated entities [other than insurance/reinsurance sector] carrying out financial activitiesCredit institutions, investment firms and financial institutions, alternative investment funds managers, UCITS Institutions for occupational retirement provision

Insurance/reinsurance sector, non regulated entities carrying out financial activities and entities not carrying out finaInsurance/reinsurance sectorEntities not carrying out financial activitiesNon regulated entities carrying out financial activities

21: Type of undertaking [220]Life undertakingsNon-Life undertakingsUndertakings pursuing both life and non-life insurance activity - article 73 (2)Undertakings pursuing both life and non-life insurance activity - article 73 (5)

Page 965: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Reinsurance undertakings22: Type of branch [220]

Life undertakingsNon-Life undertakingsUndertakings pursuing both life and non-life insurance activity - article 73 (2)Undertakings pursuing both life and non-life insurance activity - article 73 (5)

23: Counterparties (Full scope)[220]Life undertakingsNon-Life undertakingsReinsurance undertakingsComposite insurerInsurance holding company as defined in Art. 212§ [f] of Directive 2009/138/ECMixed-activity insurance holding company as defined in Art. 212§1 [g] of Directive 2009/138/ECMixed financial holding company as defined in Art. 212§1 [h] of Directive 2009/138/ECCredit institutions, investment firms and financial institutionsInstitutions for occupational retirement provisionAncillary services undertaking as defined in Article 1 (53) of Delegated Regulation (EU) 2015/35Non-regulated undertaking carrying out financial activities as defined in Article 1 (52) of Delegated Regulation (EU) Special purpose vehicle authorized in accordance with Art. 211 of Directive 2009/138/ECSpecial purpose vehicle other special purpose vehicle authorized in accordance with Art. 211 of Directive 2009/138/EUCITS management companies as defined in Article 1 (54) of Delegated Regulation (EU) 2015/35Alternative investment funds managers as defined in Article 1 (55) of Delegated Regulation (EU) 2015/35Other

24: Nominated ECAIEuler Hermes Rating GmbH (LEI code: 391200QXGLWHK9VK6V27)Japan Credit Rating Agency Ltd (LEI code: 35380002378CEGMRVW86)BCRA-Credit Rating Agency AD (LEI code: 747800Z0IC3P66HTQ142)Creditreform Rating AG (LEI code: 391200PHL11KDUTTST66)Scope Ratings AG (previously PSR Rating GmbH) (LEI code: 391200WU1EZUQFHDWE91)ICAP Group SA (LEI code: 2138008U6LKT8VG2UK85)GBB-Rating Gesellschaft für Bonitätsbeurteilung GmbH (LEI code: 391200OLWXCTKPADVV72)ASSEKURATA Assekuranz Rating-Agentur GmbH (LEI code: 529900977LETWLJF3295)ARC Ratings, S.A. (previously Companhia Portuguesa de Rating, S.A) (LEI code: 213800OZNJQMV6UA7D79)AM Best Europe-Rating Services Ltd. (AMBERS) (LEI code: 549300VO8J8E5IQV1T26)DBRS Ratings Limited (LEI code: 5493008CGCDQLGT3EH93)Fitch France S.A.S. (LEI code: 2138009Y4TCZT6QOJO69)Fitch Deutschland GmbH (LEI code: 213800JEMOT1H45VN340)Fitch Italia S.p.A. (LEI code: 213800POJ9QSCHL3KR31)Fitch Polska S.A. (LEI code: 213800RYJTJPW2WD5704)Fitch Ratings España S.A.U. (LEI code: 213800RENFIIODKETE60)Fitch Ratings Limited (LEI code: 2138009F8YAHVC8W3Q52)Fitch Ratings CIS Limited (LEI code: 213800B7528Q4DIF2G76)Moody’s Investors Service Cyprus Ltd (LEI code: 549300V4LCOYCMNUVR81)Moody’s France S.A.S. (LEI code: 549300EB2XQYRSE54F02)Moody’s Deutschland GmbH (LEI code: 549300M5JMGHVTWYZH47)Moody’s Italia S.r.l. (LEI code: 549300GMXJ4QK70UOU68)Moody’s Investors Service España S.A. (LEI code: 5493005X59ILY4BGJK90)Moody’s Investors Service Ltd (LEI code: 549300SM89WABHDNJ349)Standard & Poor’s Credit Market Services France S.A.S. (LEI code: 54930035REY2YCDSBH09)Standard & Poor’s Credit Market Services Italy S.r.l. (LEI code: 54930000NMOJ7ZBUQ063)Standard & Poor’s Credit Market Services Europe Limited (LEI code: 549300363WVTTH0TW460)

Page 966: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Capital Intelligence Ratings Ltd (LEI code: 549300RE88OJP9J24Z18)European Rating Agency, a.s. (LEI code: 097900BFME0000038276)Axesor conocer para decidir SA (LEI code: 95980020140005900000)Cerved Rating Agency S.p.A. (previously CERVED Group S.p.A. ) (LEI code: 8156004AB6C992A99368)Kroll Bond Rating Agency (LEI code: 549300QYZ5CZYXTNZ676)The Economist Intelligence Unit Ltd (LEI code: 213800Q7GRZWF95EWN10)Dagong Europe Credit Rating Srl (Dagong Europe) (LEI code: 815600BF4FF53B7C6311)Spread Research (LEI code: )EuroRating Sp. z o.o. (LEI code: 25940027QWS5GMO74O03)HR Ratings de México, S.A. de C.V. (HR Ratings) (LEI code: 549300IFL3XJKTRHZ480)Moody’s Investors Service EMEA Ltd (LEI code: 54930009NU3JYS1HTT72)Egan-Jones Ratings Co. (EJR) (LEI code: 54930016113PD33V1H31)modeFinance S.r.l. (LEI code: 815600B85A94A0122614)INC Rating Sp. z o.o. (LEI code: )Rating-Agentur Expert RA GmbH (LEI code: 213800P3OOBSGWN2UE81)Feri EuroRating Services AG (LEI code: 529900CSQE528B8SHP93)Other nominated ECAI

CRIF S.p.A. (LEI code: 815600EAE45F55EE5B73)

Page 967: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Hierarchy nSign Weight Owner Usable Applicable dims2c CT

x0 Total/NA =x34 Households +x63 Other than = +x31 General go = +x30 General government +x13 Corporate = +x47 Investment= +x23 Equity funds +x18 Debt funds +x53 Money market funds +x4 Asset allocation funds +x72 Real estate funds +x1 Alternative funds +x70 Private equity funds +x35 Infrastructure funds +x48 Investment funds other +x14 Corporate other than +x64 Other than households+

s2c CTx0 Total/NA =x45 Insurance/r= +x39 Insurance counterparti+x74 Reinsurance= +x75 Reinsurance undertaki+x80 Special purpose vehicl +x105 SPV fully funded in relation to cedant obligationsx106 SPV not fully funded in relation to cedant obligationsx27 Finite reinsurance und+x66 Other than = +x17 Credit institutions +x67 Other than insurance/r+

s2c N/Ax0 Total/NA =x80 Special pur = +x83 SPV [incorporated] +x84 SPV [not incorporated]+x26 Finite reinsurance +x76 Reinsurers other than +

s2c CTx0 Total/NA =x43 Insurance/r= +x39 Insurance counterparti+x74 Reinsurance= +x49 Life insurer +x57 Non-life insurer +x9 Composite insurer +x46 Internal reinsurer +x24 External reinsurer +x73 Reinsurance captive +

Page 968: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x80 Special purpose vehicl +x69 Pool entity +x17 Credit institutions +x67 Other than insurance/r+

s2c SOx0 Total/NA =x44 Insurance/reinsurance +x65 Other than = +x21 Entities car= +x16 Credit institutions, i +x37 Institutions for occupa+x55 Non regulated entities c+x22 Entities not carrying out+

s2c ISx0 Total/NA =x91 Sovereign +x92 Supranational +x20 Energy +x50 Materials +x7 Capital Goods +x8 Commercial & Professio+x88 Transportation +x5 Automobiles and Com +x11 Consumer Durables an+x12 Consumer Services +x123 Contribution to the gr +x77 Retailing +x28 Food & Staples Retaili +x29 Food, Beverage & Tob +x33 Household & Personal +x32 Health Care Equipment+x68 Pharmaceuticals, Biote+x6 Banks +x19 Diversified Financials +x38 Insurance +x71 Real Estate +x79 Software & Services +x85 Technology Hardware +x78 Semiconductors & Sem+x86 Telecommunication Ser+x89 Utilities +

s2c CTx0 Total/NA =x49 Life insurer +x57 Non-life insurer +x9 Composite insurer +x41 Insurance holding comp+x52 Mixed-activity insuran +x94 Mixed financial holdin +x16 Credit institutions, i +x37 Institutions for occupa+

Page 969: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x3 Ancillary services unde+x60 Non-regulated undertaki+x81 Special purpose vehicl +x82 Special purpose vehicl +x93 Other +

s2c N/Ax54 1 - Mutualx58 2 - Non-mutual

s2c CTx0 Total/NA =x25 Financial and credit ins+x62 Other than f= +x42 Insurance/Reinsurance+x87 Third-country re-insur +x40 Insurance holding com+x2 Ancillary services +x59 Non-regulated financia+x61 Other than financial an+

s2c N/Ax0 Total/NA =x10 Undertakings pursuing b+x56 Non-composite undert+

s2c CTx0 Total/NA =x17 Credit institutions +x90 Other than credit insti +

s2c N/Ax10 1 - Undertakings pursuing both life and non-life insurance activityx95 2 - Life undertakingsx96 3 - Non-Life undertakings

s2c CTx97 1 - Direct Life insurerx98 2 - Direct Non-life insurerx99 3 - Direct Composite insurerx100 4 - Captive insurance undertakingx46 5 - Internal reinsurer (reinsurance undertaking which primary focus is to take risk from other insurance undertakx24 6 - External reinsurer (reinsurance undertaking that takes risks from undertakings other than from insurance undx73 7 - Captive reinsurance undertakingx80 8 - Special purpose vehiclex69 9 - Pool entity (where more than one insurance or reinsurance undertakings are involved)x101 10 - State pool

s2c CTx49 1 - Life insurance undertakingx57 2 - Non life insurance undertakingx102 3 - Reinsurance undertakingx9 4 - Composite undertakingx41 5 - Insurance holding company as defined in Article 212(1) (f) of Directive 2009/138/ECx52 6 - Mixed-activity insurance holding company as defined in Article 212(1) (g) of Directive 2009/138/ECx94 7 -Mixed financial holding company as defined in Article 212 (1)(h) of Directive 2009/138/ECx125 8 - Credit institution, investment firm and financial institutionx37 9 - Institution for occupational retirement provision

Page 970: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x3 10 - Ancillary services undertaking as defined in Article 1 (53) of Delegated Regulation (EU) 2015/35x60 11 - Non-regulated undertaking carrying out financial activities as defined in Article 1 (52) of Delegated Regulatix81 12 - Special purpose vehicle authorized in accordance with Article 211 of Directive 2009/138/ECx82 13 - Special purpose vehicle other than special purpose vehicle authorized in accordance with Art. 211 of Directx103 14 - UCITS management companies as defined in Article 1 (54) of Delegated Regulation (EU) 2015/35x124 15 - Alternative investment funds managers as defined in Article 1 (55) of Delegated Regulation (EU) 2015/35x93 99 - Other

s2c ISx105 1 - SPV fully funded in relation to cedant obligationsx106 2 – SPV not fully funded in relation to cedant obligations

s2c N/Ax107 1 – Trustsx108 2 – Partnershipsx109 3 – Limited liability companiesx110 4 – Other legal entity form not referred abovex111 5 – Not incorporated

s2c ISx112 1 – central bank (ESA 2010 sector S.121)x113 2 – deposit-taking corporations except the central bank (ESA sector S.122)x114 3 – money market funds (ESA sector S.123)x115 4 – investment funds except money market funds (ESA sector S.124)x116 5 – other financial intermediaries, except insurance corporations and pension funds (excluding financial vehicle cox117 6 – financial vehicle corporations engaged in securitisation transactions (a subdivision of ESA sector S.125)x118 7 – insurance corporations (ESA sector S.128)x119 8 – pension funds (ESA sector S.129)x120 9 – non-financial corporations (ESA sector S.11)x121 10 – general government (ESA sector S.13)x122 11 – households and non-profit institutions serving households (ESA sector S.14 + ESA sector S.15)

s2c SOx0 Total/NA =x21 Entities car= +x16 Credit institutions, i +x37 Institutions for occupa+x55 Non regulated entities c+x126 Insurance/reinsurance s+x22 Entities not carrying out+x44 Insurance/reinsurance +

s2c SOx0 Total/NA =x127 Regulated en= +x16 Credit institutions, i +x37 Institutions for occupa+x128 Insurance/reinsurance se+x44 Insurance/reinsurance +x22 Entities not carrying out+x55 Non regulated entities c+

s2c N/Ax95 2 - Life undertakingsx96 3 - Non-Life undertakingsx129 4 - Undertakings pursuing both life and non-life insurance activity - article 73 (2)x130 5 - Undertakings pursuing both life and non-life insurance activity - article 73 (5)

Page 971: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x75 6 - Reinsurance undertakingss2c N/A

x95 2 - Life branchx96 3 - Non-Life branchx129 4 - Branches pursuing both life and non–life insurance activity – article 73 (2)x130 5 - Branches pursuing both life and non–life insurance activity – article 73 (5)

s2c CTx95 1 - Life insurance undertakingx96 2 - Non life insurance undertakingx75 3 - Reinsurance undertakingx9 4 - Composite undertakingx41 5 - Insurance holding company as defined in Article 212(1) (f) of Directive 2009/138/ECx52 6 - Mixed-activity insurance holding company as defined in Article 212(1) (g) of Directive 2009/138/ECx94 7 -Mixed financial holding company as defined in Article 212 (1)(h) of Directive 2009/138/ECx125 8 - Credit institution, investment firm and financial institutionx37 9 - Institution for occupational retirement provisionx3 10 - Ancillary services undertaking as defined in Article 1 (53) of Delegated Regulation (EU) 2015/35x60 11 - Non-regulated undertaking carrying out financial activities as defined in Article 1 (52) of Delegated Regulatix81 12 - Special purpose vehicle authorized in accordance with Article 211 of Directive 2009/138/ECx82 13 - Special purpose vehicle other than special purpose vehicle authorized in accordance with Art. 211 of Directx103 14 - UCITS management companies as defined in Article 1 (54) of Delegated Regulation (EU) 2015/35x124 15 - Alternative investment funds managers as defined in Article 1 (55) of Delegated Regulation (EU) 2015/35x93 99 - Other

s2c N/Ax131 Euler Hermes Rating GmbH (LEI code: 391200QXGLWHK9VK6V27)x132 Japan Credit Rating Agency Ltd (LEI code: 35380002378CEGMRVW86)x133 BCRA-Credit Rating Agency AD (LEI code: 747800Z0IC3P66HTQ142)x134 Creditreform Rating AG (LEI code: 391200PHL11KDUTTST66)x135 Scope Ratings AG (previously PSR Rating GmbH) (LEI code: 391200WU1EZUQFHDWE91)x136 ICAP Group SA (LEI code: 2138008U6LKT8VG2UK85)x137 GBB-Rating Gesellschaft für Bonitätsbeurteilung GmbH (LEI code: 391200OLWXCTKPADVV72)x138 ASSEKURATA Assekuranz Rating-Agentur GmbH (LEI code: 529900977LETWLJF3295)x139 ARC Ratings, S.A. (previously Companhia Portuguesa de Rating, S.A) (LEI code: 213800OZNJQMV6UA7D79)x140 AM Best Europe-Rating Services Ltd. (AMBERS) (LEI code: 549300VO8J8E5IQV1T26)x141 DBRS Ratings Limited (LEI code: 5493008CGCDQLGT3EH93)x142 Fitch France S.A.S. (LEI code: 2138009Y4TCZT6QOJO69)x143 Fitch Deutschland GmbH (LEI code: 213800JEMOT1H45VN340)x144 Fitch Italia S.p.A. (LEI code: 213800POJ9QSCHL3KR31)x145 Fitch Polska S.A. (LEI code: 213800RYJTJPW2WD5704)x146 Fitch Ratings España S.A.U. (LEI code: 213800RENFIIODKETE60)x147 Fitch Ratings Limited (LEI code: 2138009F8YAHVC8W3Q52)x148 Fitch Ratings CIS Limited (LEI code: 213800B7528Q4DIF2G76)x149 Moody’s Investors Service Cyprus Ltd (LEI code: 549300V4LCOYCMNUVR81)x150 Moody’s France S.A.S. (LEI code: 549300EB2XQYRSE54F02)x151 Moody’s Deutschland GmbH (LEI code: 549300M5JMGHVTWYZH47)x152 Moody’s Italia S.r.l. (LEI code: 549300GMXJ4QK70UOU68)x153 Moody’s Investors Service España S.A. (LEI code: 5493005X59ILY4BGJK90)x154 Moody’s Investors Service Ltd (LEI code: 549300SM89WABHDNJ349)x155 Standard & Poor’s Credit Market Services France S.A.S. (LEI code: 54930035REY2YCDSBH09)x156 Standard & Poor’s Credit Market Services Italy S.r.l. (LEI code: 54930000NMOJ7ZBUQ063)x157 Standard & Poor’s Credit Market Services Europe Limited (LEI code: 549300363WVTTH0TW460)

Page 972: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x158x159 Capital Intelligence Ratings Ltd (LEI code: 549300RE88OJP9J24Z18)x160 European Rating Agency, a.s. (LEI code: 097900BFME0000038276)x161 Axesor conocer para decidir SA (LEI code: 95980020140005900000)x162 Cerved Rating Agency S.p.A. (previously CERVED Group S.p.A. ) (LEI code: 8156004AB6C992A99368)x163 Kroll Bond Rating Agency (LEI code: 549300QYZ5CZYXTNZ676)x164 The Economist Intelligence Unit Ltd (LEI code: 213800Q7GRZWF95EWN10)x165 Dagong Europe Credit Rating Srl (Dagong Europe) (LEI code: 815600BF4FF53B7C6311)x166 Spread Research (LEI code: )x167 EuroRating Sp. z o.o. (LEI code: 25940027QWS5GMO74O03)x168 HR Ratings de México, S.A. de C.V. (HR Ratings) (LEI code: 549300IFL3XJKTRHZ480)x169 Moody’s Investors Service EMEA Ltd (LEI code: 54930009NU3JYS1HTT72)x170 Egan-Jones Ratings Co. (EJR) (LEI code: 54930016113PD33V1H31)x171 modeFinance S.r.l. (LEI code: 815600B85A94A0122614)x172 INC Rating Sp. z o.o. (LEI code: )x173 Rating-Agentur Expert RA GmbH (LEI code: 213800P3OOBSGWN2UE81)x174 Feri EuroRating Services AG (LEI code: 529900CSQE528B8SHP93)x175 Other nominated ECAI

CRIF S.p.A. (LEI code: 815600EAE45F55EE5B73)

Page 973: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable sheets for dropdowns Creation date Validity date Last modified date Comment7/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/2014 12/31/20137/7/2014 9/30/20157/7/2014 12/31/20137/7/2014 9/30/20157/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 9/30/20157/7/2014 12/31/20137/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/2015

7/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 974: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/20167/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/2014

S.06.02 (201), SE.06.02 (201), S.11.01 7/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/2014

Page 975: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/2014

S.32.01 (201) 7/7/20147/7/20147/7/2014

S.24.01 (201) 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 7/15/2017 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/2015

S.01.02 (201) 9/30/2015 7/15/20177/7/2014 7/15/2017 9/30/2015

9/30/20159/30/2015

S.30.02 (201), 30.04 (201), 31.01 (201) 9/30/20159/30/20159/30/20159/30/20159/30/2015

5 - Internal reinsurer (reinsurance undertaking which primary focus is to take risk from other insurance undertak 7/7/20146 - External reinsurer (reinsurance undertaking that takes risks from undertakings other than from insurance und 7/7/2014

7/7/20147/7/2014

9 - Pool entity (where more than one insurance or reinsurance undertakings are involved) 7/7/20149/30/2015

S.32.01 (201) 9/30/2015 7/15/20177/7/20147/7/2014

9/30/20157/7/2014

5 - Insurance holding company as defined in Article 212(1) (f) of Directive 2009/138/EC 7/7/20146 - Mixed-activity insurance holding company as defined in Article 212(1) (g) of Directive 2009/138/EC 7/7/20147 -Mixed financial holding company as defined in Article 212 (1)(h) of Directive 2009/138/EC 7/7/2014

9/30/20157/7/2014

Page 976: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

10 - Ancillary services undertaking as defined in Article 1 (53) of Delegated Regulation (EU) 2015/35 7/7/201411 - Non-regulated undertaking carrying out financial activities as defined in Article 1 (52) of Delegated Regulati 7/7/201412 - Special purpose vehicle authorized in accordance with Article 211 of Directive 2009/138/EC 7/7/201413 - Special purpose vehicle other than special purpose vehicle authorized in accordance with Art. 211 of Direct 7/7/201414 - UCITS management companies as defined in Article 1 (54) of Delegated Regulation (EU) 2015/35 9/30/201515 - Alternative investment funds managers as defined in Article 1 (55) of Delegated Regulation (EU) 2015/35 9/30/2015

7/7/2014S.31.02 (201) 9/30/2015

9/30/20159/30/2015

S.31.02 (201) 9/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

SE.06.02 (201) 9/30/20159/30/2015

2 – deposit-taking corporations except the central bank (ESA sector S.122) 9/30/20159/30/20159/30/2015

5 – other financial intermediaries, except insurance corporations and pension funds (excluding financial vehicle co 9/30/20156 – financial vehicle corporations engaged in securitisation transactions (a subdivision of ESA sector S.125) 9/30/2015

9/30/20159/30/20159/30/20159/30/2015

11 – households and non-profit institutions serving households (ESA sector S.14 + ESA sector S.15) 9/30/20157/15/2016

7/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/2014

7/15/20167/7/20147/7/2014

7/15/20167/7/2014

7/15/20167/7/2014 9/30/20157/7/2014

7/15/20167/7/20147/7/20147/7/2014

S.01.02 (220) 7/15/20179/30/20159/30/2015

4 - Undertakings pursuing both life and non-life insurance activity - article 73 (2) 7/15/20175 - Undertakings pursuing both life and non-life insurance activity - article 73 (5) 7/15/2017

Page 977: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014S.01.02 (220) 7/15/2017

9/30/20159/30/2015

4 - Branches pursuing both life and non–life insurance activity – article 73 (2) 7/15/20175 - Branches pursuing both life and non–life insurance activity – article 73 (5) 7/15/2017

S.32.01 (220) 7/15/20179/30/20159/30/2015

7/7/20147/7/2014

5 - Insurance holding company as defined in Article 212(1) (f) of Directive 2009/138/EC 7/7/20146 - Mixed-activity insurance holding company as defined in Article 212(1) (g) of Directive 2009/138/EC 7/7/20147 -Mixed financial holding company as defined in Article 212 (1)(h) of Directive 2009/138/EC 7/7/2014

9/30/20157/7/2014

10 - Ancillary services undertaking as defined in Article 1 (53) of Delegated Regulation (EU) 2015/35 7/7/201411 - Non-regulated undertaking carrying out financial activities as defined in Article 1 (52) of Delegated Regulati 7/7/201412 - Special purpose vehicle authorized in accordance with Article 211 of Directive 2009/138/EC 7/7/201413 - Special purpose vehicle other than special purpose vehicle authorized in accordance with Art. 211 of Direct 7/7/201414 - UCITS management companies as defined in Article 1 (54) of Delegated Regulation (EU) 2015/35 9/30/201515 - Alternative investment funds managers as defined in Article 1 (55) of Delegated Regulation (EU) 2015/35 9/30/2015

7/7/2014S.06.02 (220), S.08.01, S.30.02, S.30.04 7/15/2017

7/15/20177/15/20177/15/20177/15/2017

Scope Ratings AG (previously PSR Rating GmbH) (LEI code: 391200WU1EZUQFHDWE91) 7/15/20177/15/2017

GBB-Rating Gesellschaft für Bonitätsbeurteilung GmbH (LEI code: 391200OLWXCTKPADVV72) 7/15/2017ASSEKURATA Assekuranz Rating-Agentur GmbH (LEI code: 529900977LETWLJF3295) 7/15/2017ARC Ratings, S.A. (previously Companhia Portuguesa de Rating, S.A) (LEI code: 213800OZNJQMV6UA7D79) 7/15/2017AM Best Europe-Rating Services Ltd. (AMBERS) (LEI code: 549300VO8J8E5IQV1T26) 7/15/2017

7/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/2017

Moody’s Investors Service Cyprus Ltd (LEI code: 549300V4LCOYCMNUVR81) 7/15/20177/15/20177/15/20177/15/20177/15/20177/15/2017

Standard & Poor’s Credit Market Services France S.A.S. (LEI code: 54930035REY2YCDSBH09) 7/15/2017Standard & Poor’s Credit Market Services Italy S.r.l. (LEI code: 54930000NMOJ7ZBUQ063) 7/15/2017Standard & Poor’s Credit Market Services Europe Limited (LEI code: 549300363WVTTH0TW460) 7/15/2017

Page 978: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/20177/15/20177/15/20177/15/2017

Cerved Rating Agency S.p.A. (previously CERVED Group S.p.A. ) (LEI code: 8156004AB6C992A99368) 7/15/20177/15/2017

The Economist Intelligence Unit Ltd (LEI code: 213800Q7GRZWF95EWN10) 7/15/2017Dagong Europe Credit Rating Srl (Dagong Europe) (LEI code: 815600BF4FF53B7C6311) 7/15/2017

7/15/20177/15/2017

HR Ratings de México, S.A. de C.V. (HR Ratings) (LEI code: 549300IFL3XJKTRHZ480) 7/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/20177/15/2017

Page 979: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 980: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity dateTotal/NA x0 yes s2c 7/7/2014Ad hoc [A] x1 s2c 7/7/2014Aggregate excess of loss x2 s2c 7/7/2014Borrower [securities lending] x3 s2c 7/7/2014Buyer [repo] x4 s2c 7/7/2014Ceded x5 s2c 7/7/2014Dynamic [D] x6 s2c 7/7/2014Estimated Maximum Loss [EML] x7 s2c 7/7/2014Excess of loss [per event and per risk] x8 s2c 7/7/2014Excess of loss [per event] x9 s2c 7/7/2014Excess of loss [per risk] x10 s2c 7/7/2014Excess of loss “back-up” x11 s2c 7/7/2014Facultative x12 s2c 7/7/2014Facultative-obligatory [facoblig] x13 s2c 7/7/2014 12/31/2013Financial services x14 s2c 7/7/2014Intermediary for placement x15 s2c 7/7/2014Lender [securities lending] x16 s2c 7/7/2014Maximum Possible Loss [MPL] x17 s2c 7/7/2014None [N] x18 s2c 7/7/2014Non-traditional x19 s2c 7/7/2014Non-traditional [financial] x20 s2c 7/7/2014Non-traditional [other than financial] x21 s2c 7/7/2014Non-traditional or Finite RE x22 s2c 7/7/2014Not ceded x23 s2c 7/7/2014Open cover x24 s2c 7/7/2014 12/31/2013SPV authorised under article 211(1) of the Direc x25 s2c 7/7/2014SPV authorised under article 211(3) of the Direc x26 s2c 7/7/2014SPV regulated by a third country supervisory autx27 s2c 7/7/2014SPV not covered above x28 s2c 7/7/2014Other non proportional treaties x29 s2c 7/7/2014Other proportional treaties x30 s2c 7/7/2014Other than non-traditional or Finite RE x31 s2c 7/7/2014Other than sum insured, maximum possible loss x32 s2c 7/7/2014Probable Maximum Loss [PML] x33 s2c 7/7/2014Quota share x34 s2c 7/7/2014Reinstatement cover x35 s2c 7/7/2014Reinsurance other than facultative x36 s2c 7/7/2014Seller [repo] x37 s2c 7/7/2014Static [S] x38 s2c 7/7/2014Stop loss [SL] x39 s2c 7/7/2014Sum Insured [SI] x40 s2c 7/7/2014Surplus x41 s2c 7/7/2014Traditional x42 s2c 7/7/2014Underwriting on behalf x43 s2c 7/7/2014Unlimited excess of loss x44 s2c 7/7/2014Variable quota share x45 s2c 7/7/2014Proportional x46 s2c 7/7/2014Non-proportional x47 s2c 7/7/2014Intermediary for placement and Underwriting onx48 s2c 7/7/2014Intermediary for placement and Financial servicex49 s2c 7/7/2014

Page 981: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Underwriting on behalf and Financial services x50 s2c 7/7/2014Intermediary for placement and Underwriting on x51 s2c 7/7/2014Excess of loss with basic risk x52 s2c 7/7/2014Maximum Loss [ML] x53 s2c 9/30/2015Investments of SPV controlled by cedant and/or sx54 s2c 9/30/2015Investments of SPV held by cedant (equity, notesx55 s2c 9/30/2015Cedant sells reinsurance or other risk mitigation x56 s2c 9/30/2015Cedant has provided guarantee or other credit x57 s2c 9/30/2015Sufficient basis risk retained by cedant x58 s2c 9/30/2015Other x59 s2c 9/30/2015Held in trust with other third party than cedant x60 s2c 9/30/2015Not held in trust with other third party than ced x61 s2c 9/30/2015Life activity x62 s2c 9/30/2015Non-life activity x63 s2c 9/30/2015Facultative proportional x64 s2c 9/30/2015Facultative non-proportional x65 s2c 9/30/2015Financial reinsurance x66 s2c 9/30/2015

Page 982: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modifiedCount Comment Hierarchy Name6 1: Ceded and not ceded1 Total/NA x03 Ceded x51 Facultative x121 Reinsurance other than facultative x362 Not ceded x231 2: Types of hedging strategies2 None [N] x183 Dynamic [D] x63 Static [S] x383 Ad hoc [A] x13 3: Type of underwriting model (Preparatory scope)2 Sum Insured [SI] x400 Maximum Possible Loss [MPL] x172 Probable Maximum Loss [PML] x332 Estimated Maximum Loss [EML] x71 Other than sum insured, maximum possible loss, probable x322 4: Types of reinsurance [traditional or not]1 Total/NA x01 Non-traditional or Finite RE x221 Other than non-traditional or Finite RE x311 5: Type of reinsurance treaty1 Total/NA x01 Traditional x420 Quota share x34

9/30/2015 1 Variable quota share x459/30/2015 1 Surplus x419/30/2015 1 Excess of loss [per event and per risk] x8

9/30/2015 1 Excess of loss [per risk] x103 Excess of loss [per event] x93 Excess of loss “back-up” x111 Excess of loss with basic risk x522 Reinstatement cover x352 Aggregate excess of loss x23 Unlimited excess of loss x443 Stop loss [SL] x391 Other proportional treaties x301 Other non proportional treaties x291 Non-traditional x193 Non-traditional [financial] x202 Non-traditional [other than financial] x213 6: Activity of broker1 Intermediary for placement x152 Underwriting on behalf x433 Financial services x143 Intermediary for placement and Underwriting on behalf x481 Intermediary for placement and Financial services x491 Underwriting on behalf and Financial services x501 Intermediary for placement and Underwriting on behalf and Fx511 7: SPV authorisation conditions

Page 983: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1 SPV authorised under article 211(1) of the Directive 2009/1 x251 SPV authorised under article 211(3) of the Directive 2009/1 x263 SPV regulated by a third country supervisory authority wherex271 SPV not covered above x281 8: Role of reporting entity in repo or securities lending

9/30/2015 1 Buyer [repo] x41 Seller [repo] x37

9/30/2015 1 Lender [securities lending] x161 Borrower [securities lending] x31 9: Proportional or Non-proportional1 Total/NA x01 Ceded x51 Facultative x121 Proportional x461 Non-proportional x471 10: Type of underwriting model (Full scope)1 Sum Insured [SI] x40

Maximum Possible Loss [MPL] x17Probable Maximum Loss [PML] x33Maximum Loss [ML] x53Estimated Maximum Loss [EML] x7Other than sum insured, maximum possible loss, probable x32

11: Type of reinsurance treaty (Full scope)Quota share x34Variable quota share x45Surplus x41Excess of loss [per event and per risk] x8Excess of loss [per risk] x10Excess of loss [per event] x9Excess of loss “back-up” x11Excess of loss with basic risk x52Reinstatement cover x35Aggregate excess of loss x2Unlimited excess of loss x44Stop loss [SL] x39Other proportional treaties x30Other non proportional treaties x29

12: Identification of material investmentsTotal/NA x0Investments of SPV controlled by cedant and/or sponsor (whex54Investments of SPV held by cedant (equity, notes or other s x55Cedant sells reinsurance or other risk mitigation protection x56Cedant has provided guarantee or other credit enhancement x57Sufficient basis risk retained by cedant x58Other x59

13: Ceded and not cededHeld in trust with other third party than cedant / sponsor x60Not held in trust with other third party than cedant / sponsox61

14: Type of reinsurance treaty (Full scope)Quota share x34Variable quota share x45

Page 984: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Surplus x41Excess of loss [per event and per risk] x8Excess of loss [per risk] x10Excess of loss [per event] x9Excess of loss “back-up” x11Excess of loss with basic risk x52Reinstatement cover x35Aggregate excess of loss x2Unlimited excess of loss x44Stop loss [SL] x39Other proportional treaties x30Other non proportional treaties x29Financial reinsurance x66Facultative proportional x64Facultative non-proportional x65

15: Life/non-life activityTotal/NA x0

Life activity x62Non-life activity x63

16: Activity of brokerIntermediary for placement x15Underwriting on behalf x43Financial services x14

Page 985: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy node label

Total/NACededFacultativeReinsurance other than facultativeNot ceded

1 – No hedging2 – Dynamic hedging3 – Static hedging4 - Ad hoc hedging

1 - Sum Insured2 - Maximum Possible Loss3 - Probable Maximum Loss4 - Estimated Maximum Loss5 - Other

Total/NA1 - Non-traditional or Finite RE2 - Other than non-traditional or Finite RE

Total/NATraditionalQuota shareVariable quota shareSurplusExcess of loss [per event and per risk]Excess of loss [per risk]Excess of loss [per event]Excess of loss “back-up”Excess of loss with basic riskReinstatement coverAggregate excess of lossUnlimited excess of lossStop loss [SL]Other proportional treatiesOther non proportional treatiesNon-traditionalNon-traditional [financial]Non-traditional [other than financial]

Intermediary for placementUnderwriting on behalfFinancial servicesIntermediary for placement and Underwriting on behalfIntermediary for placement and Financial servicesUnderwriting on behalf and Financial servicesIntermediary for placement and Underwriting on behalf and Financial services

Page 986: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1 - SPV authorised under article 211(1) of Directive 2009/138/EC2 - SPV authorised under article 211(3) of Directive 2009/138/EC (grandfathered)3 - SPV regulated by a third country supervisory authority where requirements equivalent to those set out in Article 211(2) of Directive 2009/138/EC are met by the special purpose vehicle4 - SPV not covered above

1 - Buyer in a repo2 - Seller in a repo3 - Lender in a securities lending4 - Borrower in a securities lending

Total/NACededFacultative1 - Proportional reinsurance2 - Non-proportional reinsurance

Sum Insured [SI]Maximum Possible Loss [MPL]Probable Maximum Loss [PML]Maximum Loss [ML]Estimated Maximum Loss [EML]Other than sum insured, maximum possible loss, probable maximum loss and estimated maximum loss

1 - quota share2 - variable quota share3 - surplus4 - excess of loss (per event and per risk)5 - excess of loss (per risk)6 - excess of loss (per event)7 - excess of loss “back-up” (protection against follow-on events which certain catastrophes can cause such as flooding or fire)8 - excess of loss with basis risk9 - reinstatement cover10 - aggregate excess of loss11 - unlimited excess of loss12 - stop loss13 - other proportional treaties14 - other non-proportional treaties

1 - Not applicable2 - Investments of SPV controlled by cedant and/or sponsor (where it differs from cedant)3 - Investments of SPV held by cedant (equity, notes or other subordinated debt of the SPV)4 - Cedant sells reinsurance or other risk mitigation protection to the SPV5 - Cedant has provided guarantee or other credit enhancement to SPV or note holders6 - Sufficient basis risk retained by cedant9 - Other

1 – Held in trust with other third party than cedant / sponsor2 – Not held in trust with other third party than cedant / sponsor

1 - quota share2 - variable quota share

Page 987: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

3 - surplus4 - excess of loss (per event and per risk)5 - excess of loss (per risk)6 - excess of loss (per event)7 - excess of loss “back-up” (protection against follow-on events which certain catastrophes can cause such as flooding or fire)8 - excess of loss with basis risk9 - reinstatement cover10 - aggregate excess of loss11 - unlimited excess of loss12 - stop loss13 - other proportional treaties14 - other non-proportional treaties15 – financial reinsurance16 - facultative proportional17 - facultative non-proportional

Total/NALife activityNon-life activity

1 - Intermediary for placement2 - Underwriting on behalf3 - Financial services

Page 988: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Sign Weight Owner Usable Applicable Applicable sheets for dropdowns Creation dates2c CC 7/7/2014

= 7/7/2014= + 7/7/2014

+ 7/7/2014+ 7/7/2014+ 7/7/2014

s2c N/A S.15.02 (201) 7/7/20147/7/20147/7/20147/7/20147/7/2014

s2c N/A S.21.02 (201), S.30.01 (201), S.30.03 ( 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

s2c N/A S.30.01 (201), S.30.03 (201) 7/7/2014= 7/7/2014

+ 7/7/2014+ 7/7/2014

s2c N/A 7/7/20147/7/2014

no 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

no 7/7/20147/7/20147/7/2014

s2c N/A S.30.02, S.30.03 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

s2c N/A S.31.02 (201) 7/7/2014

Page 989: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/2014

3 - SPV regulated by a third country supervisory authority where requirements equivalent to those set out in Article 211(2) of Directive 2009/138/EC are met by the special purpose vehicle 7/7/20147/7/2014

s2c N/A S.10.01 (201) 7/7/20147/7/20147/7/20147/7/20147/7/2014

s2c N/A S.30.01 (201) 7/7/2014no 7/7/2014no 7/7/2014no 7/7/2014

7/7/20147/7/2014

s2c N/A 9/30/20157/7/20147/7/20147/7/2014

9/30/20157/7/20147/7/2014

s2c N/A S.30.03 (201) 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

7 - excess of loss “back-up” (protection against follow-on events which certain catastrophes can cause such as flooding or fire) 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

s2c N/A S.31.02 (201) 9/30/20157/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

s2c CC S.31.02 (201) 9/30/20159/30/20159/30/2015

s2c N/A S.36.03 (201) 9/30/20157/7/20147/7/2014

Page 990: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/2014

7 - excess of loss “back-up” (protection against follow-on events which certain catastrophes can cause such as flooding or fire) 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/20159/30/2015

s2c LE 9/30/20157/7/2014

9/30/20159/30/2015

s2c N/A 9/30/20157/7/20147/7/20147/7/2014

Page 991: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modified date Comment

Page 992: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/20159/30/20159/30/20159/30/2015

9/30/2015

9/30/2015

Page 993: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

Page 994: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerNA x0 yes s2cApplication date of guarantee x1 s2cDate commencement of the specific cover took effect x2 s2cDate of approval of latest major change in internal model x3 s2cDate of authorisation x4 s2cDate of decision related to solo capital add-on x5 s2cDate of formal approval of internal model x6 s2cDate of formal approval of partial internal model x7 s2cDate of inclusion in the scope of group supervision x8 s2cDate of initial approval of internal model x9 s2cDate rating assigned x10 s2cEffective date of agreement/contract underlying transaction if appli x11 s2cEnd date x12 s2cExpiry date of agreement/contract underlying transaction if applicabx13 s2cFinal expiry date of the specific cover x14 s2cFirst call date x15 s2cMaturity date x16 s2cReference date x17 s2cReporting date x18 s2cStart date x19 s2cTrade date x20 s2cTransaction/issue date x21 s2cInitial date of guarantee x22 s2cFinal date of guarantee x23 s2cDate of notice x24 s2cInsurance date x25 s2cFinancial year end x26 s2c

Page 995: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modifi Count Comment7/7/2014 07/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 9/30/2015 17/7/2014 9/30/2015 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 1

9/30/2015 19/30/2015 19/30/2015 19/30/2015 17/15/2017 1

Page 996: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name Hierarchy n1: Types of dates

Application date of guarantee x1 Application date of guaranteeMaturity date x16 Maturity dateStart date x19 Start dateEnd date x12 End dateTrade date x20 Trade dateDate commencement of the specific cover took effect x2 Date commencement of the specific cover took effectFinal expiry date of the specific cover x14 Final expiry date of the specific coverDate rating assigned x10 Date rating assignedTransaction/issue date x21 Transaction/issue dateFirst call date x15 First call dateDate of authorisation x4 Date of authorisationDate of formal approval of partial internal model x7 Date of formal approval of partial internal modelDate of formal approval of internal model x6 Date of formal approval of internal modelEffective date of agreement/contract underlying transaction if applicable x11 Effective date of agreement/contract underlying transaction if applicableExpiry date of agreement/contract underlying transaction if applicable x13 Expiry date of agreement/contract underlying transaction if applicableDate of initial approval of internal model x9 Date of initial approval of internal modelDate of approval of latest major change in internal model x3 Date of approval of latest major change in internal modelDate of decision related to solo capital add-on x5 Date of decision related to solo capital add-onDate of inclusion in the scope of group supervision x8 Date of inclusion in the scope of group supervisionReporting date x18 Reporting dateReference date x17 Reference dateInitial date of guarantee x22 Initial date of guaranteeFinal date of guarantee x23 Final date of guaranteeDate of notice x24 Date of noticeInsurance date x25 Insurance dateFinancial year end x26 Financial year end

Page 997: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Sign Weight Owner Usable Applicable Applicable Creation date Validity dates2c TD 7/7/2014

Application date of guarantee 7/7/2014Maturity date 7/7/2014

7/7/20147/7/2014

Trade date 7/7/2014Date commencement of the specific cover took effect 7/7/2014 12/31/2013Final expiry date of the specific cover 7/7/2014 12/31/2013Date rating assigned 7/7/2014 12/31/2013Transaction/issue date 7/7/2014First call date 7/7/2014Date of authorisation 7/7/2014Date of formal approval of partial internal model 7/7/2014 9/30/2015Date of formal approval of internal model 7/7/2014 9/30/2015Effective date of agreement/contract underlying transaction if applicable 7/7/2014Expiry date of agreement/contract underlying transaction if applicable 7/7/2014Date of initial approval of internal model 7/7/2014Date of approval of latest major change in internal model 7/7/2014Date of decision related to solo capital add-on 7/7/2014Date of inclusion in the scope of group supervision 7/7/2014Reporting date 7/7/2014Reference date 7/7/2014Initial date of guarantee 9/30/2015Final date of guarantee 9/30/2015Date of notice 9/30/2015Insurance date 9/30/2015Financial year end 7/15/2017

Page 998: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modified date Comment9/30/2015

Page 999: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation dat Validity datLast modifi Count CommentN x0 yes s2c 9/30/2015 1Day 1 x1 s2c 9/30/2015 1N+1Y x2 s2c 9/30/2015 1N+2Y x3 s2c 9/30/2015 1N-1Y x4 s2c 9/30/2015 1

Page 1000: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name Hierarchy nSign Weight Owner Usable Applicable Applicable1: Time reference s2c TK

N x0 NDay 1 x1 Day 1N+1Y x2 N+1YN+2Y x3 N+2YN-1Y x4 N-1Y

Page 1001: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity datLast modifi Comment9/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 1002: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity date Last modifiTotal/NA x0 yes s2c 7/7/20140 x1 s2c 7/7/20141 x2 s2c 7/7/20142 x3 s2c 7/7/20143 x4 s2c 7/7/20144 x5 s2c 7/7/20145 x6 s2c 7/7/20146 x7 s2c 7/7/20147 x8 s2c 7/7/20148 x9 s2c 7/7/20149 x10 s2c 7/7/201410 x11 s2c 7/7/201411 x12 s2c 7/7/201412 x13 s2c 7/7/201413 x14 s2c 7/7/201414 x15 s2c 7/7/201415 x16 s2c 7/7/201416 x17 s2c 7/7/201417 x18 s2c 7/7/201418 x19 s2c 7/7/201419 x20 s2c 7/7/201420 x21 s2c 7/7/201421 x22 s2c 7/7/201422 x23 s2c 7/7/201423 x24 s2c 7/7/201424 x25 s2c 7/7/201425 x26 s2c 7/7/201426 x27 s2c 7/7/201427 x28 s2c 7/7/201428 x29 s2c 7/7/201429 x30 s2c 7/7/201430 x31 s2c 7/7/201410 and more x32 s2c 7/7/2014 12/31/20131-12 previous months x33 s2c 7/7/2014 12/31/201313-24 previous months x34 s2c 7/7/2014 12/31/201315 and more x35 s2c 7/7/201425 and previous months x36 s2c 7/7/2014 12/31/201331 and more x37 s2c 7/7/201431-40 x38 s2c 7/7/201441-50 x39 s2c 7/7/201451 and more x40 s2c 7/7/2014N x41 s2c 7/7/2014N-1 x42 s2c 7/7/2014N-1 and prior years x43 s2c 7/7/2014N-10 x44 s2c 7/7/2014N-10 and prior years x45 s2c 7/7/2014N-11 x46 s2c 7/7/2014N-12 x47 s2c 7/7/2014N-13 x48 s2c 7/7/2014N-14 x49 s2c 7/7/2014

Page 1003: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

N-15 and prior years x50 s2c 7/7/2014N-2 x51 s2c 7/7/2014N-3 x52 s2c 7/7/2014N-4 x53 s2c 7/7/2014N-5 x54 s2c 7/7/2014N-6 x55 s2c 7/7/2014N-7 x56 s2c 7/7/2014N-8 x57 s2c 7/7/2014N-9 x58 s2c 7/7/201431 x59 s2c 9/30/201532 x60 s2c 9/30/201533 x61 s2c 9/30/201534 x62 s2c 9/30/201535 x63 s2c 9/30/201536 x64 s2c 9/30/201537 x65 s2c 9/30/201538 x66 s2c 9/30/201539 x67 s2c 9/30/201540 x68 s2c 9/30/201541-45 x69 s2c 9/30/201546-50 x70 s2c 9/30/201551-60 x71 s2c 9/30/201561-70 x72 s2c 9/30/201571 & after x73 s2c 9/30/2015

Page 1004: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Count Comment Hierarchy Name Hierarchy nSign Weight Owner Usable4 1: Projected years s2c2 Total/NA x0 Total/NA =3 1 x2 1 +3 2 x3 2 +3 3 x4 3 +3 4 x5 4 +3 5 x6 5 +3 6 x7 6 +3 7 x8 7 +3 8 x9 8 +3 9 x10 9 +3 10 x11 10 +3 11 x12 11 +3 12 x13 12 +3 13 x14 13 +3 14 x15 14 +2 15 x16 15 +2 16 x17 16 +2 17 x18 17 +2 18 x19 18 +2 19 x20 19 +2 20 x21 20 +2 21 x22 21 +2 22 x23 22 +2 23 x24 23 +2 24 x25 24 +2 25 x26 25 +2 26 x27 26 +2 27 x28 27 +2 28 x29 28 +2 29 x30 29 +2 30 x31 30 +1 31 and morex37 31 and mor= +1 31-40 x38 31-40 +1 41-50 x39 41-50 +1 51 and mox40 51 and more +1 2: Development years s2c1 Total/NA x0 Total/NA =1 0 x1 0 +1 1 x2 1 +1 2 x3 2 +1 3 x4 3 +1 4 x5 4 +1 5 x6 5 +1 6 x7 6 +1 7 x8 7 +1 8 x9 8 +1 9 x10 9 +1 10 and morex32 10 and mor= +1 10 x11 10 +

Page 1005: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

1 11 x12 11 +1 12 x13 12 +1 13 x14 13 +1 14 x15 14 +1 15 and mox35 15 and more +1 3: Previous months/years s2c1 Total/NA x0 Total/NA =1 1-12 previo x33 1-12 previous months+1 13-24 previ x34 13-24 previous month+1 25 and prev x36 25 and previous mont+1 4: Previous months/years s2c1 Total/NA x0 Total/NA =1 N x41 N +1 N-1 and priox43 N-1 and pri= +1 N-1 x42 N-1 +1 N-2 x51 N-2 +1 N-3 x52 N-3 +1 N-4 x53 N-4 +1 N-5 x54 N-5 +1 N-6 x55 N-6 +1 N-7 x56 N-7 +1 N-8 x57 N-8 +1 N-9 x58 N-9 +1 N-10 and px45 N-10 and pr= +

N-10 x44 N-10 +N-11 x46 N-11 +N-12 x47 N-12 +N-13 x48 N-13 +N-14 x49 N-14 +N-15 and x50 N-15 and prior years +

5: Projected years s2c0 x1 01 x2 12 x3 23 x4 34 x5 45 x6 56 x7 67 x8 78 x9 89 x10 910 x11 1011 x12 1112 x13 1213 x14 1314 x15 1415 x16 1516 x17 1617 x18 1718 x19 1819 x20 19

Page 1006: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

20 x21 2021 x22 2122 x23 2223 x24 2324 x25 2425 x26 2526 x27 2627 x28 2728 x29 2829 x30 2930 x31 3031 x59 3132 x60 3233 x61 3334 x62 3435 x63 3536 x64 3637 x65 3738 x66 3839 x67 3940 x68 4041-45 x69 41-4546-50 x70 46-5051-60 x71 51-6061-70 x72 61-7071 & after x73 71 & after

Page 1007: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable Applicable Creation date Validity date Last modifi CommentPY 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

DY 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/2014

Page 1008: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/2014

RM 7/7/20147/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

RM 7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

PY 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 1009: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

Page 1010: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation date Validity dateNA x0 yes s2c 7/7/2014 12/31/2013Identification code of entity x1 s2c 7/7/2014 12/31/2013Identification code of group x2 s2c 7/7/2014 12/31/2013Counterparty Code x3 s2c 7/7/2014 12/31/2013Code of receiver of guarantee x4 s2c 7/7/2014 12/31/2013Code of provider of guarantee x5 s2c 7/7/2014 12/31/2013

Page 1011: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 1012: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modifi Count Comment Hierarchy Name Hierarchy n0 1: Types of URI1 Identification code of entity x1 Identification code of entity1 Identification code of group x2 Identification code of group1 Counterparty Code x3 Counterparty Code1 Code of receiver of guarantee x4 Code of receiver of guarantee1 Code of provider of guarantee x5 Code of provider of guarantee

Page 1013: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Sign Weight Owner Usable Applicable Applicable Creation date Validity date Last modifis2c N/A 7/7/2014

Identification code of entity 7/7/2014 12/31/2013Identification code of group 7/7/2014 12/31/2013Counterparty Code 7/7/2014 12/31/2013Code of receiver of guarantee 7/7/2014 12/31/2013Code of provider of guarantee 7/7/2014 12/31/2013

Page 1014: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Comment

Page 1015: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerNA x0 yes s2cBasic Information x1 s2cBalance Sheet x2 s2cAssets and liabilities by currency x3 s2cList of assets x4 s2cOpen derivatives x5 s2cLife and Health SLT Technical Provisions x6 s2cNon-Life Technical Provisions x7 s2cOwn funds x8 s2cSolvency Capital Requirement x9 s2cSolvency Capital Requirement - SF x10 s2cSolvency Capital Requirement - PIM x11 s2cSolvency Capital Requirement - IM x12 s2cSolvency Capital Requirement - Market risk x13 s2cSolvency Capital Requirement - Counterparty default risk x14 s2cSolvency Capital Requirement - Life underwriting risk x15 s2cSolvency Capital Requirement - Health underwriting risk x16 s2cSolvency Capital Requirement - Non-Life underwriting risk x17 s2cSolvency Capital Requirement - Operational risk x18 s2cSolvency Capital Requirement - Non-Life Catastrophe risk x19 s2cMinimum Capital Requirement x20 s2cMinimum Capital Requirement - Composite x21 s2cEntities in the scope of the group x22 s2c(Re)insurance Solo requirements x23 s2cNon-(re)insurance Solo requirements x24 s2cGroup - contribution of TP x25 s2c

Page 1016: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modifi Count Comment7/7/2014 12/31/2013 07/7/2014 12/31/2013 47/7/2014 12/31/2013 47/7/2014 12/31/2013 17/7/2014 12/31/2013 47/7/2014 12/31/2013 47/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 47/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 27/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 1

Page 1017: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name Hierarchy nSign Weight Owner1: QRS s2c

Basic Information x1 Basic InformationBalance Sheet x2 Balance SheetList of assets x4 List of assetsOpen derivatives x5 Open derivativesLife and Health SLT Technical Provisions x6 Life and Health SLT Technical ProvisionsNon-Life Technical Provisions x7 Non-Life Technical ProvisionsOwn funds x8 Own fundsMinimum Capital Requirement x20 Minimum Capital Requirement

Minimum Capital Requirement - Composite x21 Minimum Capital Requirement - Composite2: ARS s2c

Basic Information x1 Basic InformationBalance Sheet x2 Balance SheetAssets and liabilities by currency x3 Assets and liabilities by currencyList of assets x4 List of assetsOpen derivatives x5 Open derivativesLife and Health SLT Technical Provisions x6 Life and Health SLT Technical ProvisionsNon-Life Technical Provisions x7 Non-Life Technical ProvisionsOwn funds x8 Own fundsSolvency Capital Requirement x9 Solvency Capital Requirement

Solvency Capital Requirement - SF x10 Solvency Capital Requirement - SFSolvency Capital Requirement - PIM x11 Solvency Capital Requirement - PIMSolvency Capital Requirement - IM x12 Solvency Capital Requirement - IMSolvency Capital Requirement - Market risk x13 Solvency Capital Requirement - Market riskSolvency Capital Requirement - Counterparty defaux14 Solvency Capital Requirement - Counterparty default riskSolvency Capital Requirement - Life underwriting rx15 Solvency Capital Requirement - Life underwriting riskSolvency Capital Requirement - Health underwritinx16 Solvency Capital Requirement - Health underwriting riskSolvency Capital Requirement - Non-Life underwritx17 Solvency Capital Requirement - Non-Life underwriting riskSolvency Capital Requirement - Operational risk x18 Solvency Capital Requirement - Operational riskSolvency Capital Requirement - Non-Life Catastropx19 Solvency Capital Requirement - Non-Life Catastrophe risk

Minimum Capital Requirement x20 Minimum Capital RequirementMinimum Capital Requirement - Composite x21 Minimum Capital Requirement - Composite

3: QRG s2cBasic Information x1 Basic InformationBalance Sheet x2 Balance SheetList of assets x4 List of assetsOpen derivatives x5 Open derivativesOwn funds x8 Own funds

4: ARG s2cBasic Information x1 Basic InformationBalance Sheet x2 Balance SheetList of assets x4 List of assetsOpen derivatives x5 Open derivativesOwn funds x8 Own fundsSolvency Capital Requirement x9 Solvency Capital Requirement

Solvency Capital Requirement - SF x10 Solvency Capital Requirement - SFSolvency Capital Requirement - PIM x11 Solvency Capital Requirement - PIMSolvency Capital Requirement - IM x12 Solvency Capital Requirement - IMSolvency Capital Requirement - Market risk x13 Solvency Capital Requirement - Market riskSolvency Capital Requirement - Counterparty defaux14 Solvency Capital Requirement - Counterparty default risk

Page 1018: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Solvency Capital Requirement - Life underwriting rx15 Solvency Capital Requirement - Life underwriting riskSolvency Capital Requirement - Health underwritinx16 Solvency Capital Requirement - Health underwriting riskSolvency Capital Requirement - Non-Life underwritx17 Solvency Capital Requirement - Non-Life underwriting riskSolvency Capital Requirement - Operational risk x18 Solvency Capital Requirement - Operational riskSolvency Capital Requirement - Non-Life Catastropx19 Solvency Capital Requirement - Non-Life Catastrophe risk

Entities in the scope of the group x22 Entities in the scope of the group(Re)insurance Solo requirements x23 (Re)insurance Solo requirementsNon-(re)insurance Solo requirements x24 Non-(re)insurance Solo requirementsGroup - contribution of TP x25 Group - contribution of TP

Page 1019: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Usable Applicable Applicable Creation date Validity date Last modifi CommentN/A 7/7/2014

7/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

N/A 7/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

no 7/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

Solvency Capital Requirement - Counterparty default risk 7/7/2014 12/31/2013Solvency Capital Requirement - Life underwriting risk 7/7/2014 12/31/2013Solvency Capital Requirement - Health underwriting risk 7/7/2014 12/31/2013Solvency Capital Requirement - Non-Life underwriting risk 7/7/2014 12/31/2013Solvency Capital Requirement - Operational risk 7/7/2014 12/31/2013Solvency Capital Requirement - Non-Life Catastrophe risk 7/7/2014 12/31/2013

7/7/2014 12/31/20137/7/2014 12/31/2013

N/A 7/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

N/A 7/7/20147/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

no 7/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

Solvency Capital Requirement - Counterparty default risk 7/7/2014 12/31/2013

Page 1020: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Solvency Capital Requirement - Life underwriting risk 7/7/2014 12/31/2013Solvency Capital Requirement - Health underwriting risk 7/7/2014 12/31/2013Solvency Capital Requirement - Non-Life underwriting risk 7/7/2014 12/31/2013Solvency Capital Requirement - Operational risk 7/7/2014 12/31/2013Solvency Capital Requirement - Non-Life Catastrophe risk 7/7/2014 12/31/2013

7/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/20137/7/2014 12/31/2013

Page 1021: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default Owner Creation dateBefore risk mitigation x0 yes s2c 7/7/2014After risk mitigation x1 s2c 7/7/2014After risk mitigation [risk mitigation cost for reinst x2 s2c 7/7/2014After risk mitigation effect x3 s2c 7/7/2014After risk mitigation effect other than from finite rei x4 s2c 7/7/2014Risk mitigation cost for reinstalment premiums x6 s2c 7/7/2014Risk mitigation effect x7 s2c 7/7/2014Risk mitigation effect from finite reinsurance x8 s2c 7/7/2014Risk mitigation effect other than from finite reinsura x9 s2c 7/7/2014Risk mitigation effect other than from finite reinsur x10 s2c 7/7/2014

Page 1022: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity dateLast modifi Count Comment3

12/31/2013 31113

12/31/2013 112/31/2013 3

31

Page 1023: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name Hierarchy n1: Treatment of risk mitigation

After risk mitigation x1 After risk mAfter risk mitigation [risk mitigation cost for reinstalment premium and other t x2 After risk m

Before risk mitigation x0 Before risk mitigationRisk mitigation effect other than from finite reinsurance and risk mitigation x10 Risk mitiga

Risk mitigation effect other than from finite reinsurance x9 Risk mitigation effect Risk mitigation cost for reinstalment premiums x6 Risk mitigation cost f

Risk mitigation effect from finite reinsurance x8 Risk mitigation effect 2: Treatment of risk mitigation

After risk mitigation x1 After risk mAfter risk mitigation effect x3 After risk m

Before risk mitigation x0 Before risk mitigationRisk mitigation effect x7 Risk mitigat

Risk mitigation effect from finite reinsurance x8 Risk mitigation effect Risk mitigation effect other than from finite reinsurance x9 Risk mitigation effect

Risk mitigation cost for reinstalment premiums x6 Risk mitigation cost f3: Treatment of risk mitigation

After risk mitigation x1 After risk mAfter risk mitigation effect other than from finite reinsurance x4 After risk m

Before risk mitigation x0 Before risk mitigationRisk mitigation effect other than from finite reinsurance x9 Risk mitigation effect

Risk mitigation cost for reinstalment premiums x6 Risk mitigation cost fRisk mitigation effect from finite reinsurance x8 Risk mitigation effect

Page 1024: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Sign Weight Owner Usable Applicable Applicable sheets for dropdowns Creation dates2c IT 7/7/2014

= 7/7/2014= + 7/7/2014

Before risk mitigation + 7/7/2014= - 7/7/2014

Risk mitigation effect + 7/7/2014Risk mitigation cost f + 7/7/2014Risk mitigation effect - 7/7/2014

s2c IT 7/7/2014= 7/7/2014= + 7/7/2014

Before risk mitigation + 7/7/2014= - 7/7/2014

Risk mitigation effect + 7/7/2014Risk mitigation effect + 7/7/2014Risk mitigation cost f - 7/7/2014

s2c IT 7/7/2014= 7/7/2014= + 7/7/2014

Before risk mitigation + 7/7/2014Risk mitigation effect - 7/7/2014Risk mitigation cost f - 7/7/2014Risk mitigation effect - 7/7/2014

Page 1025: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Validity date Last modified date Comment

12/31/2013

12/31/2013

12/31/2013

12/31/201312/31/2013

12/31/2013

12/31/2013

Page 1026: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label Name Default OwnerNA x0 yes s2cAccounting standard x1 s2cAdditional information in case of use of discount rates other than risk frex2 s2cContract name x3 s2cCounterparty group x4 s2cCounterparty ID x5 s2cCoupon/interest rate x6 s2cDescription of additional item x7 s2cDescription of ancillary own funds x8 s2cDescription of asset/liability underlying the derivative x9 s2cDescription of average guaranteed rate to the policy holder over the life x10 s2cDescription of basis risk arising from contractual terms x11 s2cDescription of basis risk arising from risk-transfer structure x12 s2cDescription of cases where either the reinsurer's participation is at cond x13 s2cDescription of component x14 s2cDescription of countries or group of countries x15 s2cDescription of criteria of influence other than percent of capital share, x16 s2cDescription of further call dates x17 s2cDescription of guarantees [cover term] x18 s2cDescription of guarantees [general] x19 s2cDescription of impact on: assets/liability/off-balance sheet x20 s2cDescription of incentives to redeem x21 s2cDescription of inclusion of catastrophic guarantees x22 s2cDescription of inflation rate used x23 s2cDescription of item approved by supervisory authority as basic own fund x24 s2cDescription of legal nature x25 s2cDescription of material investments held by cedant in securitisation x26 s2cDescription of own funds from the financial statements that should not bex27 s2cDescription of preference share x28 s2cDescription of reason[s] stated by the supervisor in it’s decision related t x29 s2cDescription of risk x30 s2cDescription of subordinated MMA x31 s2cDescription of trigger event x32 s2cDescription of trigger value x33 s2cDescription of type of product x34 s2cDescription risk category covered x35 s2cDescription, if approval of full internal model for calculating solo SCR re x36 s2cDescription, where partial internal model was used in standard formula [x37 s2cDescription, where simplifications were used in standard formula [if any x38 s2cDescription, where undertaking specific parameters were used in standarx39 s2cDescriptions x40 s2cDescriptions of reinstatements x41 s2cExplanation if the item has been bought back x42 s2cGroup x43 s2cHedge x44 s2cIssuer group x45 s2cItem title x46 s2cLegal form x47 s2cLegal name of undertaking x48 s2cName x49 s2c

Page 1027: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name of broker x50 s2cName of collateral/guarantee provider x51 s2cName of counterparty x52 s2cName of counterparty for which credit protection is purchased x53 s2cName of insured entity x54 s2cName of investor/buyer/transferee/payer/reinsured/beneficiary x55 s2cName of issuer/seller/transferor/receiver/reinsurer/provider x56 s2cName of receiver of guarantee x57 s2cName of reinsurer x58 s2cName of ring fenced fund x59 s2cName of SPV x60 s2cName of Supervisory Authority x61 s2cName of the counterparty of the Group x62 s2cNames of group entities subject to the exposure x63 s2cNames of hedged risks x64 s2cProduct denomination x66 s2cSingle name exposure x69 s2cSwap delivered interest rate [for buyer] x70 s2cSwap received interest rate [for buyer] x71 s2cTitle x72 s2cType of risk transferred x73 s2cVariable annual return x74 s2cIncorporation number x75 s2cTrigger value x76 s2cValuation basis for statutory accounts value x77 s2cTemplate reporting status x78 s2cSingle name exposure code x79 s2cIssuer Sector x81 s2cLegal name of group x82 s2cIssuer code x83 s2cIssuer group code x84 s2cCIC code x85 s2cExternal rating x86 s2cRating agency x87 s2cID code of underlying x88 s2cCounterparty code x89 s2cCounterparty group code x90 s2cNumber of fund x91 s2cCurrency (ISO code) x92 s2cComposite limited CIC code x93 s2cCIC code [third digit] of most significant collateral x94 s2cLimited CIC code x95 s2cID of counterparty [in repo/securities lending] x96 s2cType of asset for which collateral is held x97 s2cName of debtor pledging the collateral x98 s2cCode of group x99 s2cProduct classification ID x100 s2cReinsurance program code x101 s2cRisk identification code x102 s2cFacultative reinsurance placement identification code x103 s2cCode reinsurer x104 s2c

Page 1028: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Code broker x105 s2cName of reinsured entity x106 s2cNature of exposure x110 s2cCode of group of debtor pledging the collateral x111 s2cComposite limited CIC code of underlying x112 s2cCode collateral provider x113 s2cName of ring-fenced fund/Matching adjustment portfolio x114 s2cInternal rating x115 s2cCustodian x116 s2cDescription of product x117 s2cActivity code broker x118 s2cDescription of the reinsurers limit collateralised x119 s2cCode of receiver of guarantee x120 s2cCode of provider of guarantee x121 s2cUndertaking identification code x122 s2cList the counterparty of the subordinated liabilities x123 s2cName of issuer/seller/transferor/receiver/reinsurer/providor x124 s2cLegal name of branch x125 s2cBranch identification code x126 s2cName of a branches included under Article 167 x127 s2cCountries of branches included under Article 167 x128 s2cDescription of encumbered assets x129 s2cDescription of encumbrance x130 s2cDescription of the balance sheet liability x131 s2cCode of SPV x132 s2cName of cedant x133 s2cCedant code x134 s2cDescription of the debt or other financing mechanism issued for arrang x135 s2cName of vessel with the biggest sum insured x136 s2cName of platform with the biggest sum insured x137 s2cName of related party x138 s2cDescription of simplifications x139 s2cComment to technical table x140 s2cUSP - Life underwriting risk x141 s2cUSP - Health underwriting risk x142 s2cUSP - Non life underwriting risk x143 s2cUSP x144 s2c

Page 1029: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Creation date Validity date Last modifiedCount Comment7/7/2014 07/7/2014 12/31/2013 17/7/2014 9/30/2015 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 9/30/2015 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 1

Page 1030: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 17/7/2014 9/30/2015 17/7/2014 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 17/7/2014 12/31/2013 1

Page 1031: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/2014 12/31/2013 17/7/2014 17/7/2014 12/31/2013 17/7/2014 17/7/2014 12/31/2013 17/7/2014 12/31/2013 1

9/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 12/31/2013 19/30/2015 12/31/2013 19/30/2015 19/30/2015 19/30/2015 19/30/2015 9/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 19/30/2015 17/15/2016 17/15/2017 17/15/2017 17/15/2017 17/15/2017 17/15/2017 17/15/2017 1

Page 1032: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy Name1: Types of string

Name x49Name of receiver of guarantee x57Name of collateral/guarantee provider x51Counterparty ID x5Name of counterparty x52Legal name of undertaking x48Legal name of group x82Names of hedged risks x64Name of insured entity x54Name of reinsurer x58Name of SPV x60Name of broker x50Name of counterparty for which credit protection is purchased x53Name of investor/buyer/transferee/payer/reinsured/beneficiary x55Name of issuer/seller/transferor/receiver/reinsurer/provider x56Name of ring fenced fund x59Name of Supervisory Authority x61Names of group entities subject to the exposure x63Name of the counterparty of the Group x62Name of debtor pledging the collateral x98Name of ring-fenced fund/Matching adjustment portfolio x114Custodian x116

Name of reinsured entity x106Title x72

Item title x46Contract name x3Product denomination x66

Group x43Issuer group x45Counterparty group x4Code of group x99

Additional information in case of use of discount rates other than risk free rates x2Descriptions x40

Description of item approved by supervisory authority as basic own funds x24Description of type of product x34Description of average guaranteed rate to the policy holder over the life time of the c x10Description of guarantees [general] x19Description of guarantees [cover term] x18Description of inflation rate used x23Description of risk x30Description risk category covered x35Description of cases where either the reinsurer's participation is at conditions differ x13Description of inclusion of catastrophic guarantees x22Descriptions of reinstatements x41Description of trigger value x33Description of trigger event x32Description of basis risk arising from risk-transfer structure x12Description of basis risk arising from contractual terms x11Description of material investments held by cedant in securitisation x26

Page 1033: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Description of countries or group of countries x15Description of legal nature x25Description of subordinated MMA x31Description of incentives to redeem x21Description of further call dates x17Description of preference share x28Description of ancillary own funds x8Description of own funds from the financial statements that should not be represented x27Description of component x14Description of additional item x7Description of impact on: assets/liability/off-balance sheet x20Description, where undertaking specific parameters were used in standard formula [i x39Description, where simplifications were used in standard formula [if anywhere] x38Description, where partial internal model was used in standard formula [if anywhere] x37Description, if approval of full internal model for calculating solo SCR regards a solo x36Description of reason[s] stated by the supervisor in it’s decision related to capital addx29Description of asset/liability underlying the derivative x9Description of criteria of influence other than percent of capital share, Percent used x16

Type of risk transferred x73Variable annual return x74Legal form x47Single name exposure x69Coupon/interest rate x6Swap delivered interest rate [for buyer] x70Swap received interest rate [for buyer] x71Hedge x44Explanation if the item has been bought back x42Accounting standard x1Incorporation number x75Trigger value x76Valuation basis for statutory accounts value x77Template reporting status x78Single name exposure code x79Issuer Sector x81Issuer code x83Issuer group code x84CIC code x85External rating x86Internal rating x115Rating agency x87ID code of underlying x88Counterparty code x89Counterparty group code x90Number of fund x91Currency (ISO code) x92Composite limited CIC code x93CIC code [third digit] of most significant collateral x94Limited CIC code x95ID of counterparty [in repo/securities lending] x96Type of asset for which collateral is held x97Product classification ID x100

Page 1034: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Reinsurance program code x101Risk identification code x102Facultative reinsurance placement identification code x103Code reinsurer x104Code broker x105Nature of exposure x110Code of group of debtor pledging the collateral x111Composite limited CIC code of underlying x112Code collateral provider x113Description of product x117Activity code broker x118Description of the reinsurers limit collateralised x119Code of receiver of guarantee x120Code of provider of guarantee x121Undertaking identification code x122List the counterparty of the subordinated liabilities x123Name of issuer/seller/transferor/receiver/reinsurer/providor x124Legal name of branch x125Branch identification code x126Name of a branches included under Article 167 x127Countries of branches included under Article 167 x128Description of encumbered assets x129Description of encumbrance x130Description of the balance sheet liability x131Code of SPV x132Name of cedant x133Cedant code x134Description of the debt or other financing mechanism issued for arrangement x135Name of vessel with the biggest sum insured x136Name of platform with the biggest sum insured x137Name of related party x138Description of simplifications x139Comment to technical table x140USP - Life underwriting risk x141USP - Health underwriting risk x142USP - Non life underwriting risk x143USP x144

Page 1035: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy nSign Weight Owner Usable Applicable Applicable Creation date Validity dates2c TS 7/7/2014

Name 7/7/2014 12/31/2013Name of receiver of guarantee 7/7/2014Name of collateral/guarantee provider 7/7/2014Counterparty ID 7/7/2014 12/31/2013Name of counterparty 7/7/2014Legal name of undertaking 7/7/2014Legal name of group 7/7/2014Names of hedged risks 7/7/2014Name of insured entity 7/7/2014Name of reinsurer 7/7/2014Name of SPV 7/7/2014Name of broker 7/7/2014Name of counterparty for which credit protection is purchased 7/7/2014Name of investor/buyer/transferee/payer/reinsured/beneficiary 7/7/2014Name of issuer/seller/transferor/receiver/reinsurer/provider 7/7/2014Name of ring fenced fund 7/7/2014 12/31/2013Name of Supervisory Authority 7/7/2014Names of group entities subject to the exposure 7/7/2014Name of the counterparty of the Group 7/7/2014Name of debtor pledging the collateral 7/7/2014Name of ring-fenced fund/Matching adjustment portfolio 9/30/2015Custodian 9/30/2015Name of reinsured entity 7/7/2014Title 7/7/2014 12/31/2013Item title 7/7/2014Contract name 7/7/2014Product denomination 7/7/2014Group 7/7/2014 12/31/2013Issuer group 7/7/2014Counterparty group 7/7/2014Code of group 7/7/2014 12/31/2013Additional information in case of use of discount rates other than risk free ra 7/7/2014 9/30/2015Descriptions 7/7/2014 12/31/2013Description of item approved by supervisory authority as basic own funds 7/7/2014Description of type of product 7/7/2014Description of average guaranteed rate to the policy holder over the life time 7/7/2014Description of guarantees [general] 7/7/2014Description of guarantees [cover term] 7/7/2014 12/31/2013Description of inflation rate used 7/7/2014Description of risk 7/7/2014Description risk category covered 7/7/2014Description of cases where either the reinsurer's participation is at conditio 7/7/2014Description of inclusion of catastrophic guarantees 7/7/2014Descriptions of reinstatements 7/7/2014Description of trigger value 7/7/2014Description of trigger event 7/7/2014Description of basis risk arising from risk-transfer structure 7/7/2014 12/31/2013Description of basis risk arising from contractual terms 7/7/2014 12/31/2013Description of material investments held by cedant in securitisation 7/7/2014 12/31/2013

Page 1036: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Description of countries or group of countries 7/7/2014Description of legal nature 7/7/2014 12/31/2013Description of subordinated MMA 7/7/2014Description of incentives to redeem 7/7/2014Description of further call dates 7/7/2014Description of preference share 7/7/2014Description of ancillary own funds 7/7/2014Description of own funds from the financial statements that should not be rep 7/7/2014Description of component 7/7/2014Description of additional item 7/7/2014Description of impact on: assets/liability/off-balance sheet 7/7/2014 12/31/2013Description, where undertaking specific parameters were used in standard f 7/7/2014Description, where simplifications were used in standard formula [if anywhe 7/7/2014Description, where partial internal model was used in standard formula [if 7/7/2014Description, if approval of full internal model for calculating solo SCR regar 7/7/2014 9/30/2015Description of reason[s] stated by the supervisor in it’s decision related to c 7/7/2014Description of asset/liability underlying the derivative 7/7/2014Description of criteria of influence other than percent of capital share, Per 7/7/2014Type of risk transferred 7/7/2014 12/31/2013Variable annual return 7/7/2014Legal form 7/7/2014Single name exposure 7/7/2014Coupon/interest rate 7/7/2014Swap delivered interest rate [for buyer] 7/7/2014Swap received interest rate [for buyer] 7/7/2014Hedge 7/7/2014 12/31/2013Explanation if the item has been bought back 7/7/2014Accounting standard 7/7/2014 12/31/2013Incorporation number 7/7/2014Trigger value 7/7/2014Valuation basis for statutory accounts value 7/7/2014 12/31/2013Template reporting status 7/7/2014 12/31/2013Single name exposure code 7/7/2014Issuer Sector 7/7/2014 12/31/2013Issuer code 7/7/2014Issuer group code 7/7/2014CIC code 7/7/2014External rating 7/7/2014Internal rating 9/30/2015Rating agency 7/7/2014ID code of underlying 7/7/2014 9/30/2015Counterparty code 7/7/2014Counterparty group code 7/7/2014Number of fund 7/7/2014 12/31/2013Currency (ISO code) 7/7/2014 12/31/2013Composite limited CIC code 7/7/2014 12/31/2013CIC code [third digit] of most significant collateral 7/7/2014 12/31/2013Limited CIC code 7/7/2014 12/31/2013ID of counterparty [in repo/securities lending] 7/7/2014 12/31/2013Type of asset for which collateral is held 7/7/2014 12/31/2013Product classification ID 7/7/2014 12/31/2013

Page 1037: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Reinsurance program code 7/7/2014 12/31/2013Risk identification code 7/7/2014 12/31/2013Facultative reinsurance placement identification code 7/7/2014 12/31/2013Code reinsurer 7/7/2014 12/31/2013Code broker 7/7/2014 12/31/2013Nature of exposure 7/7/2014 12/31/2013Code of group of debtor pledging the collateral 7/7/2014Composite limited CIC code of underlying 7/7/2014 12/31/2013Code collateral provider 7/7/2014 12/31/2013Description of product 9/30/2015Activity code broker 9/30/2015Description of the reinsurers limit collateralised 9/30/2015Code of receiver of guarantee 9/30/2015Code of provider of guarantee 9/30/2015Undertaking identification code 9/30/2015List the counterparty of the subordinated liabilities 9/30/2015Name of issuer/seller/transferor/receiver/reinsurer/providor 9/30/2015Legal name of branch 9/30/2015Branch identification code 9/30/2015Name of a branches included under Article 167 9/30/2015 12/31/2013Countries of branches included under Article 167 9/30/2015 12/31/2013Description of encumbered assets 9/30/2015Description of encumbrance 9/30/2015Description of the balance sheet liability 9/30/2015Code of SPV 9/30/2015Name of cedant 9/30/2015Cedant code 9/30/2015Description of the debt or other financing mechanism issued for arrangemen 9/30/2015Name of vessel with the biggest sum insured 9/30/2015Name of platform with the biggest sum insured 9/30/2015Name of related party 7/15/2016Description of simplifications 7/15/2017Comment to technical table 7/15/2017USP - Life underwriting risk 7/15/2017USP - Health underwriting risk 7/15/2017USP - Non life underwriting risk 7/15/2017USP 7/15/2017

Page 1038: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Last modified date Comment9/30/2015

Page 1039: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014
Page 1040: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

9/30/2015

Page 1041: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Label NameTotal/NA x0Adjustment for expected losses due to counterparty default x1Adjusted equity methods - applicable for the valuation of participations [AEM] x2Alternative valuation methods x3Before the adjustment for expected losses due to counterparty default x4Best estimate x5Best estimate [before adjustment for expected losses due to counterparty default] x6Calculated as a sum of best estimate and risk margin x7Calculated as a whole x8Calculated as a whole and best estimate x9Callable on demand x10Called up but not yet paid in x11Called up to basic own fund x12Capital add-on x13Capital requirement for business operated in accordance with Art. 4 of Directive 2003/41/EC [transix14Changes in perimeter x15Dated x16Decrease x17Exceptional elements triggering restating of opening BE x18Excluding intra-group transactions x19Excluding the loss-absorbing capacity of technical provisions x20Foreign exchange variation x21IFRS equity methods - applicable for the valuation of participations [IEM] x22Including the loss-absorbing capacity of technical provisions x23Including the loss-absorbing capacity of technical provisions and deferred taxes x24Increase x25Intragroup transactions x26Issued x27Loss-absorbing capacity of deferred taxes x28Loss-absorbing capacity of deferred taxes is modelled [not identifiable] x29Loss-absorbing capacity of deferred taxes is modelled [identifiable] x30Loss-absorbing capacity of deferred taxes is not modelled x31Loss-absorbing capacity of technical provisions x32Loss-absorbing capacity of technical provisions is modelled [not identifiable] x33Loss-absorbing capacity of technical provisions is modelled [identifiable] x34Loss-absorbing capacity of technical provisions is not modelled x35Mark to market [MktMk] x36Mark to model [MktMd] x37Movements in valuation x38New amount made available x39Other variation x40Paid in x41Quoted market price in active markets for similar assets or liabilities x42Quoted market price in active markets for the same assets or liabilities x43Redeemed x44Reduction to amount available x45Regulatory actions x46Risk margin x47SCR before capital add-on x48Undated x49

Page 1042: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Undated with a call option x50Undated with no contractual opportunity to redeem x51Variation x52Variation due to changes in economic environment x53Variation due to changes in non economic assumptions x54Variation due to experience and other sources x55Variation due to unwinding of discount rate x56Variation due to year N projected in and out flows x57Variation explained by capital basic own fund items and other items approved x58Variation explained by deferred tax position x59Variation explained by dividend distribution x60Variation explained by income tax [not deferred] x61Variation explained by investments and financial liabilities management x62Variation explained by technical provisions x63Amount before transitional on Technical Provisions x64Amount of the transitional on Technical Provisions x65Variation due to experience x66Other changes not elsewhere explained x67Amount before matching adjustment and without all the others x68Amount before volatility adjustment and without others transitional measures x69Amount of volatility adjustment set to zero x70Amount of matching adjustment set to zero x71Amount of all LTG/transitional measures x72Amount before transitional on interest rate x73Amount of transitional on interest rate x74Amount after transitional on Technical Provisions [for TP subject to transitional adjustment] x75Amount before transitional on Technical Provisions [for TP subject to transitional adjustment] x76Amount before transitional on Technical Provisions [for TP not subject to transitional adjustment] x77Amount of technical provisions subject to transitional on risk free rate x78Amount of technical provisions subject to volatility adjustment x79Amount of technical provisions subject to matching adjustment x80Asset side x81Liability side x82Off Balance Sheet (contingent asset) x83Off Balance Sheet (contingent liability) x84Amount after transitional on Technical Provisions [for TP not subject to transitional adjustment] x85Quoted market price in active markets for the same assets x86Quoted market price in active markets for similar assets x87Market valuation according to article 9(4) of Delegated Regulation 2015/35 x88Amount before LTG measures x89Amount of LTG measures x90

Page 1043: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Default Owner Creation dateValidity date Last modifi Count Commentyes s2c 7/7/2014 22

s2c 7/7/2014 3s2c 7/7/2014 2s2c 7/7/2014 4s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 12/31/2013 2s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 0s2c 7/7/2014 12/31/2013 0s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 3s2c 7/7/2014 3s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 2s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 1

Page 1044: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 12/31/2013 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 7/7/2014 1s2c 9/30/2015 1s2c 9/30/2015 2s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 12/31/2013 2s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 12/31/2013 1s2c 9/30/2015 1s2c 9/30/2015 1s2c 9/30/2015 2s2c 7/15/2017 1s2c 7/15/2017 1

Page 1045: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Hierarchy1: Valuation method

Total/NAQuoted market price in active markets for the same assets or liabilitiesQuoted market price in active markets for similar assets or liabilitiesAlternative valuation methodsAdjusted equity methods - applicable for the valuation of participations [AEM]IFRS equity methods - applicable for the valuation of participations [IEM]

2: Valuation of provisions [general]Total/NA

Calculated as a wholeCalculated as a sum of best estimate and risk margin

Best estimateBest estimate [before adjustment for expected losses due to counterparty default]Adjustment for expected losses due to counterparty default

Risk margin3: Valuation of provisions [general]

Total/NACalculated as a whole and best estimate

Calculated as a wholeBest estimate

Best estimate [before adjustment for expected losses due to counterparty default]Adjustment for expected losses due to counterparty default

Risk margin4: Valuation method

Total/NAQuoted market price in active markets for the same assets or liabilitiesQuoted market price in active markets for similar assets or liabilitiesAlternative valuation methods

5: Changes in own fundsTotal/NA

IncreaseDecrease

6: Changes in own fundsTotal/NA

IssuedRedeemedMovements in valuationRegulatory actions

7: Changes in own fundsTotal/NA

New amount made availableReduction to amount availableCalled up to basic own fund

8: Changes in technical provisionsTotal/NA

Exceptional elements triggering restating of opening BEChanges in perimeterForeign exchange variationVariation

Variation due to unwinding of discount rate

Page 1046: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Variation due to year N projected in and out flowsVariation due to experience and other sources

Variation due to experienceOther changes not elsewhere explained

Variation due to changes in non economic assumptionsVariation due to changes in economic environment

9: Status of share payment, initial fund or mutual members accountTotal/NA

Paid inCalled up but not yet paid inCallable on demand

10: Dated or undatedTotal/NA

DatedUndated

Undated with a call optionUndated with no contractual opportunity to redeem

11: Changes in excess of assets over liabilitiesTotal/NA

Variation explained by investments and financial liabilities managementVariation explained by technical provisionsVariation explained by capital basic own fund items and other items approvedVariation explained by deferred tax positionVariation explained by income tax [not deferred]Variation explained by dividend distributionOther variation

12: SCR calculationTotal/NA

SCR before capital add-onIncluding the loss-absorbing capacity of technical provisions and deferred taxes

Including the loss-absorbing capacity of technical provisionsExcluding the loss-absorbing capacity of technical provisionsLoss-absorbing capacity of technical provisions

Loss-absorbing capacity of deferred taxesCapital requirement for business operated in accordance with Art. 4 of Directive 2003/41/EC [transitional]

Capital add-on13: Valuation of recoverables

Total/NABefore the adjustment for expected losses due to counterparty defaultAdjustment for expected losses due to counterparty default

14: Loss-absorbing capacity of technical provisionsTotal/NA

Loss-absorbing capacity of technical provisions is modelled [identifiable]Loss-absorbing capacity of technical provisions is modelled [not identifiable]Loss-absorbing capacity of technical provisions is not modelled

15: Loss-absorbing capacity of deferred taxesTotal/NA

Loss-absorbing capacity of deferred taxes is modelled [identifiable]Loss-absorbing capacity of deferred taxes is modelled [not identifiable]Loss-absorbing capacity of deferred taxes is not modelled

16: Treatment of intra-group transactions

Page 1047: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Total/NAExcluding intra-group transactionsIntragroup transactions

17: Transitional adjustment on Technical ProvisionsTotal/NA

Amount before transitional on Technical ProvisionsAmount before transitional on Technical Provisions [for TP subject to transitional adjustment]Amount before transitional on Technical Provisions [for TP not subject to transitional adjustment]

Amount of the transitional on Technical Provisions18: Impact of the long term guarantees and transitional measures

Total/NAAmount before matching adjustment and without all the others

Amount before volatility adjustment and without others transitional measuresAmount of volatility adjustment set to zeroAmount of matching adjustment set to zero

Amount of all LTG/transitional measures19: Impact of the long term guarantees and transitional measures

Total/NAAmount before transitional on interest rateAmount of transitional on interest rate

20: Transitional adjustment on Technical ProvisionsTotal/NA

Amount after transitional on Technical Provisions [for TP subject to transitional adjustment]Amount before transitional on Technical Provisions [for TP subject to transitional adjustment]Amount of the transitional on Technical Provisions

Amount after transitional on Technical Provisions [for TP not subject to transitional adjustment]21: Transitional adjustment on Technical Provisions

Total/NAAmount of technical provisions subject to transitional on risk free rateAmount of technical provisions subject to volatility adjustmentAmount of technical provisions subject to matching adjustment

22:Impact on Assets/Liability/Off Balance SheetAsset sideLiability sideOff Balance Sheet (contingent asset)Off Balance Sheet (contingent liability)

23: Valuation methodQuoted market price in active markets for the same assetsQuoted market price in active markets for similar assetsAlternative valuation methodsAdjusted equity methods - applicable for the valuation of participations [AEM]IFRS equity methods - applicable for the valuation of participations [IEM]Market valuation according to article 9(4) of Delegated Regulation 2015/35

24: Valuation methodQuoted market price in active markets for the same assets or liabilitiesQuoted market price in active markets for similar assets or liabilitiesAlternative valuation methodsMarket valuation according to article 9(4) of Delegated Regulation 2015/35

25: Long term guarantees transitionals and measuresTotal/NA

Amount before LTG measures

Page 1048: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Amount of LTG measures

Page 1049: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Name Hierarchy nSign Weight Owner Usable Applicables2c VM

x0 Total/NAx43 Quoted market price in active markets for the same assets or liabilitiesx42 Quoted market price in active markets for similar assets or liabilitiesx3 Alternative valuation methodsx2 Adjusted equity methods - applicable for the valuation of participations [AEM]x22 IFRS equity methods - applicable for the valuation of participations [IEM]

s2c VLx0 Total/NA =x8 Calculated as a whole +x7 Calculated = +x5 Best estima= +x6 Best estimate [before +x1 Adjustment for expect-x47 Risk margin +

s2c VLx0 Total/NA =x9 Calculated = +x8 Calculated as a whole +x5 Best estima= +x6 Best estimate [before +x1 Adjustment for expect-x47 Risk margin +

s2c VMx0 Total/NAx43 Quoted market price in active markets for the same assets or liabilitiesx42 Quoted market price in active markets for similar assets or liabilitiesx3 Alternative valuation methods

s2c AGx0 Total/NA =x25 Increase +x17 Decrease -

s2c AGx0 Total/NA =x27 Issued +x44 Redeemed -x38 Movements in valuati +x46 Regulatory actions +

s2c AGx0 Total/NA =x39 New amount made ava+x45 Reduction to amount a-x12 Called up to basic own+

s2c HHx0 Total/NA =x18 Exceptional elements t+x15 Changes in perimeter +x21 Foreign exchange vari+x52 Variation = +x56 Variation due to unwin+

Page 1050: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x57 Variation due to year +x55 Variation due to expe +x66 Variation due to expe +x67 Other changes not els+x54 Variation due to chan +x53 Variation due to chan +

s2c SYx0 Total/NA =x41 Paid in +x11 Called up but not yet p+x10 Callable on demand +

s2c DUx0 Total/NAx16 Datedx49 Undatedx50 Undated with a call optionx51 Undated with no contractual opportunity to redeem

s2c XSx0 Total/NA =x62 Variation explained by+x63 Variation explained by+x58 Variation explained by+x59 Variation explained by+x61 Variation explained by+x60 Variation explained by+x40 Other variation +

s2c EAx0 Total/NA =x48 SCR before = +x24 Including t = +x23 Including th= +x20 Excluding the loss-abs+x32 Loss-absorbing capacit-x28 Loss-absorbing capacit-x14 Capital requirement fo+x13 Capital add-on +

s2c RRx0 Total/NA =x4 Before the adjustment +x1 Adjustment for expect-

s2c VMx0 Total/NAx34 Loss-absorbing capacity of technical provisions is modelled [identifiable]x33 Loss-absorbing capacity of technical provisions is modelled [not identifiable]x35 Loss-absorbing capacity of technical provisions is not modelled

s2c VMx0 Total/NAx30 Loss-absorbing capacity of deferred taxes is modelled [identifiable]x29 Loss-absorbing capacity of deferred taxes is modelled [not identifiable]x31 Loss-absorbing capacity of deferred taxes is not modelled

s2c IG

Page 1051: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x0 Total/NAx19 Excluding intra-group transactionsx26 Intragroup transactions

s2c VV,VIx0 Total/NA =x64 Amount before transiti+x76 Amount before transitional on Technical Provisions [for TP subject to transitional adjustment]x77 Amount before transitional on Technical Provisions [for TP not subject to transitional adjustment]x65 Amount of the transiti-

s2c VIx0 Total/NA =x68 Amount before matchin+x69 Amount before volatility adjustment and without others transitional measuresx70 Amount of volatility adjustment set to zerox71 Amount of matching adjustment set to zerox72 Amount of all LTG/tra -

s2c VIx0 Total/NA =x73 Amount before transiti+x74 Amount of transitional-

s2c VVx0 Total/NAx75 Amount afte=x76 Amount before transiti+x65 Amount of the transiti-x85 Amount after transitional on Technical Provisions [for TP not subject to transitional adjustment]

s2c VVx0 Total/NAx78 Amount of technical provisions subject to transitional on risk free ratex79 Amount of technical provisions subject to volatility adjustmentx80 Amount of technical provisions subject to matching adjustment

s2c VMx81 Asset sidex82 Liability sidex83 Off Balance Sheet (contingent asset)x84 Off Balance Sheet (contingent liability)

s2c VMx86 1 - quoted market price in active markets for the same assetsx87 2 - quoted market price in active markets for similar assetsx3 3 - alternative valuation methodsx2 4 - adjusted equity methods (applicable for the valuation of participations)x22 5 - IFRS equity methods (applicable for the valuation of participations)x88 6 - Market valuation according to article 9(4) of Delegated Regulation 2015/35

s2c VMx43 1 - quoted market price in active markets for the same assets or liabilitiesx42 2 - quoted market price in active markets for similar assets or liabilitiesx3 3 - alternative valuation methodsx88 6 - Market valuation according to article 9(4) of Delegated Regulation 2015/35

s2c LHx0 Total/NA =x89 Amount before LTG m+

Page 1052: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

x90 Amount of LTG measu-

Page 1053: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

Applicable sheets for dropdowns Creation date Validity date Last modified date Comment7/7/2014 9/30/20157/7/2014

Quoted market price in active markets for the same assets or liabilities 7/7/2014Quoted market price in active markets for similar assets or liabilities 7/7/2014

7/7/2014Adjusted equity methods - applicable for the valuation of participations [AEM] 7/7/2014IFRS equity methods - applicable for the valuation of participations [IEM] 7/7/2014

7/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/2014 9/30/20157/7/2014

Quoted market price in active markets for the same assets or liabilities 7/7/2014Quoted market price in active markets for similar assets or liabilities 7/7/2014

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 9/30/20157/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Page 1054: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/2014 12/31/2013

9/30/20159/30/2015

7/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014 12/31/20137/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/20147/7/2014

Loss-absorbing capacity of technical provisions is modelled [identifiable] 7/7/2014Loss-absorbing capacity of technical provisions is modelled [not identifiable] 7/7/2014

7/7/20147/7/20147/7/2014

Loss-absorbing capacity of deferred taxes is modelled [identifiable] 7/7/2014Loss-absorbing capacity of deferred taxes is modelled [not identifiable] 7/7/2014

7/7/20147/7/2014

Page 1055: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/7/20147/7/20147/7/2014 12/31/2013

9/30/20157/7/2014

9/30/2015Amount before transitional on Technical Provisions [for TP subject to transitional adjustment] 9/30/2015 12/31/2013Amount before transitional on Technical Provisions [for TP not subject to transitional adjustment] 9/30/2015 12/31/2013

9/30/20159/30/2015

7/7/20149/30/2015

Amount before volatility adjustment and without others transitional measures 9/30/20159/30/20159/30/20159/30/20159/30/2015

7/7/20149/30/20159/30/20159/30/2015

7/7/20149/30/2015 12/31/20139/30/2015 12/31/20139/30/2015

Amount after transitional on Technical Provisions [for TP not subject to transitional adjustment] 9/30/2015 12/31/20139/30/2015

7/7/2014Amount of technical provisions subject to transitional on risk free rate 9/30/2015

9/30/20159/30/20159/30/20159/30/20159/30/20159/30/20159/30/2015

S.06.02 (201), S.11.01 (201), SE.06.02 9/30/20159/30/20159/30/2015

7/7/20144 - adjusted equity methods (applicable for the valuation of participations) 7/7/20145 - IFRS equity methods (applicable for the valuation of participations) 7/7/20146 - Market valuation according to article 9(4) of Delegated Regulation 2015/35 9/30/2015

S.08.01 (201) 7/7/20141 - quoted market price in active markets for the same assets or liabilities 7/7/20142 - quoted market price in active markets for similar assets or liabilities 7/7/2014

7/7/20146 - Market valuation according to article 9(4) of Delegated Regulation 2015/35 9/30/2015

S.12.01 (220), S.17.01 (220), S.22.06 ( 7/15/20177/7/2014

7/15/2017

Page 1056: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014

7/15/2017

Page 1057: DPM Dictionary€¦ · XLS file · Web view · 2017-06-011. 1. 2. 3. 4. 1 7/7/2014. 2 7/7/2014. 3 7/7/2014. 4 7/7/2014. 5 7/7/2014. 6 7/7/2014. 7 7/7/2014. 8 7/7/2014. 9 7/7/2014