foundation/diploma/certiﬁcate · 2016-04-23 · admission requirements foundation programme the...

i knowhow to dream big

APU

PRE-UNIVERSITY Foundation/Diploma/Certificate

INNOVATIVETHINKING

CAN CHANGEYOUR WORLD

TOWARDSASPIRING

& EMPLOYABILITYPROFESSIONALISM

IT STARTS NOW.......IT STARTS HERE

APU FOUNDATION PROGRAMMES

- Foundation (Business & Finance)- Foundation (Computing & Technology)- Foundation (Engineering)- Foundation (Design)- Foundation (Journalism & Creative Media)- Foundation (International Studies)

DIPLOMAPROGRAMMES

• ENGINEERING- APIIT Diploma in Electrical & Electronic Engineering

• DESIGN, MEDIA, JOURNALISM AND INTERNATIONAL STUDIES

- APIIT Diploma in Design & Media- APIIT Diploma in Journalism- APIIT Diploma in International Studies

CERTIFICATEPROGRAMMES

- Certificate in Administrative Skills (CAS)

- Certificate in Information & Communication Technology (CICT)

• COMPUTING & TECHNOLOGY- Diploma in Information & Communications Technology- Diploma in Information & Communications Technology with a specialism in Software Engineering

• BUSINESS & BUSINESS IT- Diploma in Business Administration- Diploma in Business with Information Technology

• ACCOUNTING & FINANCE- Diploma in Accounting- Diploma in Finance

: Why UsThe Asia Pacific University of Technology and Innovation (APU) and Asia Pacific Institute of Information Technology (APIIT) offer a range of Computing & Technology, Engineering, Accounting, Banking, Finance & Quantitative Studies, Business & Management, Industrial Design & Brand Management, Animation & Visual Effects, Creative Media Technology and International Studies & Sustainability programmes which are designed to produce highly employable graduates, by providing our students with an internationally benchmarked academic experience closely aligned to industry requirements.

Superb employability track record

Purpose-built campus in Technology Park Malaysia

years of partnership with Staffordshire University (UK)

WORLD-

CLASS

WORK-READY,WORLD-READY

OUTSTANDING SUPPORT

INDUSTRY-LEADING FACILITIES

20Our solid relationship with Staffordshire University is among the strongest and most successful foreign collaborations in Malay-sia, and is particularly notable in our strong shared mission of producing highly employable graduates.

Our reputation for excellence means that we attract students from around the world. With partner universities overseas, we could even arrange for you to study part of your course overseas.

Regardless of any programmes you choose, you will be supported by highly qualified and enthusiastic professionals. Many enjoy an international reputation for their research and actively engage with leading names in IT.

Students from all over the world

Study with us and we’ll equip you to become ‘The Staffordshire Graduate’ - a world-ready professional, with the knowledge, attributes, skills and expertise that employers look for.

Our centre of computing is a purpose-built facility to rival the best. With hundreds of individual workstations, specialist equipment and facilities, it provides a first-class working environment and is also home to our research.

Established in 1993 / Part of APIIT Education Group

APU’S NEW CAMPUS ready mid 2016

AN ICONIC CAMPUS

APU’S CAMPUS OF THE FUTURE

2016

WHERE LEARNING NEVER ENDS

Asia Pacific University of Technology & Innovation (APU). This new Ultra-Modern University Campus in Technology Park Malaysia (TPM) is designed to be the state-of-the-art teaching, learning and research facility providing a conducive environment for students and staff. TPM is the ideal location for this new and contemporary Campus due to its strong positioning as Malaysia's primary hub for leading-edge and high-tech developments in a wide variety of areas. It is also located in one of the most rapidly developing areas in Kuala Lumpur, and is well served and accessible through major highways, LRT and other forms of public transportation.

APU's new campus being developed in phases will certainly set a new benchmark for design excellence among Malaysian Universities, combining an eco-friendly campus with a dynamic blend of technology and innovation to enable professional learning. It will be a magnificent teaching & learning space for our Students & Staff designed by our award-winning architects & consultants. (All illustrations are artist impressions)

on campus fromSTUDENTS

110 COUNTRIES

11,000Engineering DegreesAccredited under

(accepted Worldwide)

WASHINGTONACCORD Employed

by Graduation

95%+Rated No:1 in Asia and Malaysia

for multicultural learning experience*

MALAYSIA’ S

AWARD

WINNING UNIVERSITY & ALUMNI

GRADUATES

MORE THAN

30,000

Malaysian Qualifications Agency under SETARA 2011 & 2013Rated at Tier 5 (Excellent) by Ministry of Education /

APU amongst the Highest Rated Universities


- Student Barometer Wave 2015, ‘Studying with people from other cultures’

An ultra-modern campus built today for the needs of tomorrow

• A STYLISH BLEND OF FUNCTIONALITY & ACCESSIBILITY

• A UNIQUE FUSION OF TECHNOLOGY, INNOVATION AND CREATIVITY

• CUTTING-EDGE TECHNOLOGIES

• A WIDE VARIETY OF SPACES TO LEARN, ENGAGE & TRANSFORM

APIIT amongst the Highest Rated Colleges

4 PRE-UNIVERSITY | FOUNDATION, DIPLOMA & CERTIFICATE

: Why UsThe Asia Pacific University of Technology and Innovation (APU) and Asia Pacific Institute of Information Technology (APIIT) offer a range of Computing & Technology, Engineering, Accounting, Banking, Finance & Quantitative Studies, Business & Management, Industrial Design & Brand Management, Animation & Visual Effects, Creative Media Technology and International Studies & Sustainability programmes which are designed to produce highly employable graduates, by providing our students with an internationally benchmarked academic experience closely aligned to industry requirements.

Superb employability track record

Purpose-built campus in Technology Park Malaysia

years of partnership with Staffordshire University (UK)

WORLD-

CLASS

WORK-READY,WORLD-READY

OUTSTANDING SUPPORT

INDUSTRY-LEADING FACILITIES

20Our solid relationship with Staffordshire University is among the strongest and most successful foreign collaborations in Malay-sia, and is particularly notable in our strong shared mission of producing highly employable graduates.

Our reputation for excellence means that we attract students from around the world. With partner universities overseas, we could even arrange for you to study part of your course overseas.

Regardless of any programmes you choose, you will be supported by highly qualified and enthusiastic professionals. Many enjoy an international reputation for their research and actively engage with leading names in IT.

Students from all over the world

Study with us and we’ll equip you to become ‘The Staffordshire Graduate’ - a world-ready professional, with the knowledge, attributes, skills and expertise that employers look for.

Our centre of computing is a purpose-built facility to rival the best. With hundreds of individual workstations, specialist equipment and facilities, it provides a first-class working environment and is also home to our research.

Established in 1993 / Part of APIIT Education Group

APU’S NEW CAMPUS ready mid 2016

AN ICONIC CAMPUS

APU’S CAMPUS OF THE FUTURE

2016

WHERE LEARNING NEVER ENDS

Asia Pacific University of Technology & Innovation (APU). This new Ultra-Modern University Campus in Technology Park Malaysia (TPM) is designed to be the state-of-the-art teaching, learning and research facility providing a conducive environment for students and staff. TPM is the ideal location for this new and contemporary Campus due to its strong positioning as Malaysia's primary hub for leading-edge and high-tech developments in a wide variety of areas. It is also located in one of the most rapidly developing areas in Kuala Lumpur, and is well served and accessible through major highways, LRT and other forms of public transportation.

APU's new campus being developed in phases will certainly set a new benchmark for design excellence among Malaysian Universities, combining an eco-friendly campus with a dynamic blend of technology and innovation to enable professional learning. It will be a magnificent teaching & learning space for our Students & Staff designed by our award-winning architects & consultants. (All illustrations are artist impressions)

on campus fromSTUDENTS

110 COUNTRIES

11,000Engineering DegreesAccredited under

(accepted Worldwide)

WASHINGTONACCORD Employed

by Graduation

95%+Rated No:1 in Asia and Malaysia

for multicultural learning experience*

MALAYSIA’ S

AWARD

WINNING UNIVERSITY & ALUMNI

GRADUATES

MORE THAN

30,000

Malaysian Qualifications Agency under SETARA 2011 & 2013Rated at Tier 5 (Excellent) by Ministry of Education /



- Student Barometer Wave 2015, ‘Studying with people from other cultures’

An ultra-modern campus built today for the needs of tomorrow

• A STYLISH BLEND OF FUNCTIONALITY & ACCESSIBILITY

• A UNIQUE FUSION OF TECHNOLOGY, INNOVATION AND CREATIVITY

• CUTTING-EDGE TECHNOLOGIES

• A WIDE VARIETY OF SPACES TO LEARN, ENGAGE & TRANSFORM

APIIT amongst the Highest Rated Colleges

5PRE-UNIVERSITY | FOUNDATION, DIPLOMA & CERTIFICATE

ADMISSION REQUIREMENTS

FOUNDATION PROGRAMME

The Foundation programme gives you an opportunity to sample your future areas of study. This helps you choose which Degree programme to pursue.

• An overall credit pass in at least 5 subjects at SPM level* and a minimum of a pass in Bahasa Malaysia and Sejarah (History); or• 5 grade C passes at ‘O’ Levels / GCSE*; or• A qualification that APU accepts as equivalent to the above.

* Some Degree Programmes may require a Credit pass in Mathematics as their entry requirements.

DIPLOMA PROGRAMMES

Diploma in Information & Communications Technology**Diploma in Information & Communications Technology with a specialism in Software Engineering**Diploma in Accounting Diploma in Finance• An overall credit pass in at least 3 subjects at SPM level including Mathematics and a minimum of a pass in Bahasa Malaysia

and Sejarah (History); or• 3 Grade C passes at ‘O’ Levels / GCSE including Mathematics; or• A qualification that APU accepts as equivalent to the above.

** Students Progressing to BSc (Hons) in Software Engineering and BSc (Hons) in Computer Science are required to have Credit Pass in Additional Mathematics at SPM / ’O’ Levels.

Diploma in International StudiesDiploma in Design & MediaDiploma in JournalismDiploma in Business with Information TechnologyDiploma in Business Administration• An overall credit pass in 3 subjects and a minimum of a pass in Bahasa Malaysia and Sejarah (History) at SPM level; or• 3 Grade C passes at ‘O’ Levels / GCSE; or• A qualification that APU accepts as equivalent to the above.

Diploma in Electrical & Electronic Engineering• An overall credit pass in 3 subjects at SPM level including Mathematics, and a minimum of a pass in any Science subject

(Chemistry, Physics, Biology, Science & Technology OR General Science), Bahasa Malaysia and Sejarah (History); or• Pass Sijil Tinggi Persekolahan Malaysia (STPM) or its equivalent with a pass in Mathematics, English and ONE (1) relevant

science/technical/vocational subject at the SPM level;• or Recognised Certificate in Engineering/Engineering Technology or its equivalent;• or Recognised related Vocational and Technical/Skills Certificate or its equivalent with ONE (1) year of relevant work

experience or a minimum of ONE (1) semester of a bridging programme.• 3 grade C passes, including Mathematics, and a pass in any Science subject (Chemistry, Physic, Biology OR General

Science) and English at ‘O’ Levels / GCSE; or• A qualification that APU accepts as equivalent to the above.

ENGLISH REQUIREMENTS(only applicable for International Students)

Foundation and Diploma Programmes• IELTS : 5.5• TOEFL : 65 (Internet Based Test), 513 (Paper Based Test), 183 (Computer Based Test)• Other Certification or Evidence of English Proficiency that APU accepts as equivalent to the above

Applicants who do not possess the above will be required to sit for the APU English Placement Test, and based on the outcome of the test may be required to attend the APU Intensive English Programme (IEP) prior to commencement of the Foundation/Diploma programme.

(Note that for the programmes listed here, a pass in Bahasa Malaysia and Sejarah (History) at SPM level is required for allMalaysian students).

REQUIREMENTSADMISSIONPATHWAYS &

Honours DegreeLevel 3(1 year)

EMPLOYMENT

Engineering Final Year* (1 year)

*Only applicable forEngineering students

Masters Degree(16 months)



DegreeFoundation

(1 year)

Diploma(2 years/2+ years)

Certificate(16 months)

STPM / ‘A’ Levels /UEC or

equivalent

SPM / ‘O’ Levelsor equivalent

YOUR STUDY PROGRESSION


ADMISSION REQUIREMENTS

FOUNDATION PROGRAMME

The Foundation programme gives you an opportunity to sample your future areas of study. This helps you choose which Degree programme to pursue.

• An overall credit pass in at least 5 subjects at SPM level* and a minimum of a pass in Bahasa Malaysia and Sejarah (History); or• 5 grade C passes at ‘O’ Levels / GCSE*; or• A qualification that APU accepts as equivalent to the above.

* Some Degree Programmes may require a Credit pass in Mathematics as their entry requirements.

DIPLOMA PROGRAMMES

Diploma in Information & Communications Technology**Diploma in Information & Communications Technology with a specialism in Software Engineering**Diploma in Accounting Diploma in Finance• An overall credit pass in at least 3 subjects at SPM level including Mathematics and a minimum of a pass in Bahasa Malaysia

and Sejarah (History); or• 3 Grade C passes at ‘O’ Levels / GCSE including Mathematics; or• A qualification that APU accepts as equivalent to the above.

** Students Progressing to BSc (Hons) in Software Engineering and BSc (Hons) in Computer Science are required to have Credit Pass in Additional Mathematics at SPM / ’O’ Levels.

Diploma in International StudiesDiploma in Design & MediaDiploma in JournalismDiploma in Business with Information TechnologyDiploma in Business Administration• An overall credit pass in 3 subjects and a minimum of a pass in Bahasa Malaysia and Sejarah (History) at SPM level; or• 3 Grade C passes at ‘O’ Levels / GCSE; or• A qualification that APU accepts as equivalent to the above.

Diploma in Electrical & Electronic Engineering• An overall credit pass in 3 subjects at SPM level including Mathematics, and a minimum of a pass in any Science subject

(Chemistry, Physics, Biology, Science & Technology OR General Science), Bahasa Malaysia and Sejarah (History); or• Pass Sijil Tinggi Persekolahan Malaysia (STPM) or its equivalent with a pass in Mathematics, English and ONE (1) relevant

science/technical/vocational subject at the SPM level;• or Recognised Certificate in Engineering/Engineering Technology or its equivalent;• or Recognised related Vocational and Technical/Skills Certificate or its equivalent with ONE (1) year of relevant work

experience or a minimum of ONE (1) semester of a bridging programme.• 3 grade C passes, including Mathematics, and a pass in any Science subject (Chemistry, Physic, Biology OR General

Science) and English at ‘O’ Levels / GCSE; or• A qualification that APU accepts as equivalent to the above.

ENGLISH REQUIREMENTS(only applicable for International Students)

Foundation and Diploma Programmes• IELTS : 5.5• TOEFL : 65 (Internet Based Test), 513 (Paper Based Test), 183 (Computer Based Test)• Other Certification or Evidence of English Proficiency that APU accepts as equivalent to the above

Applicants who do not possess the above will be required to sit for the APU English Placement Test, and based on the outcome of the test may be required to attend the APU Intensive English Programme (IEP) prior to commencement of the Foundation/Diploma programme.

(Note that for the programmes listed here, a pass in Bahasa Malaysia and Sejarah (History) at SPM level is required for allMalaysian students).

REQUIREMENTSADMISSIONPATHWAYS &


EMPLOYMENT

Engineering Final Year* (1 year)

*Only applicable forEngineering students

Masters Degree(16 months)



DegreeFoundation

(1 year)

Diploma(2 years/2+ years)

Certificate(16 months)

STPM / ‘A’ Levels /UEC or

equivalent

SPM / ‘O’ Levelsor equivalent

YOUR STUDY PROGRESSION


FLEXIBILITY OF CHOICE LEARNING OUTCOMES

Our 12-month Foundation Programme is designed to prepare those with SPM, ‘O’ Levels or similar qualifications with the knowledge and skills to progress into the first year of a degree of their choice.

On completion of the Foundation Programme, you will be able to make an informed decision about your interest and pursue your degree of choice.

During the Foundation Programme, you are able to choose different routes depending on your area of interest. This will allow you to progress onto a specific degree programme at APU, related to this area or other relevant areas based on your foundation experience.

You will be able to:

• Enter Level 1 of degree study• Make an informed choice about what degree you want to study• Demonstrate an awareness of the concepts which underpin the study of Accounting, Banking, Finance & Quantitative Studies, Business & Management, Computing & Technology, Engineering, Design Innovation & Brand Management, Animation & Visual Effects, Creative Media Technology, International Studies & Sustainability and Journalism• Communicate effectively verbally and in writing to a given audience• Work effectively in a team• Demonstrate English and other study skills appropriate to undergraduate learning• Apply skills in numeracy, technology and communication• Explain the essential elements of technology• Use appropriate application software and the Internet

PROFESSIONAL CAREERSStart Here

Semester 1[ Common Semester 1 ]

Semester 2 & 3[ Choose your ROUTE in semester 2 & 3 ]

APU FOUNDATION PROGRAMME

DEGREE PROGRAMME AREAS

• Accounting, Banking, Finance & Quantitative Studies• Business & Management• Computing & Technology• Engineering• Media & Mass Communications

• Animation & Visual Effects• Creative Media Technology• International Studies & Sustainability• Journalism• Product Design & Transport Design• Advertising and Brand Management

SPM / ‘O’ Levels (5 credits)

This programme is designed to help those with SPM, ‘O’ Levels or similar qualificationsto develop the skills and knowledge to progress into the first year of a degree of their choice.

PROGRAMMES

APUFOUNDATION• Foundation (Business & Finance)• Foundation (Computing & Technology)• Foundation (Engineering)

• Foundation (Design)• Foundation (Journalism & Creative Media)• Foundation (International Studies)


FLEXIBILITY OF CHOICE LEARNING OUTCOMES

Our 12-month Foundation Programme is designed to prepare those with SPM, ‘O’ Levels or similar qualifications with the knowledge and skills to progress into the first year of a degree of their choice.

On completion of the Foundation Programme, you will be able to make an informed decision about your interest and pursue your degree of choice.

During the Foundation Programme, you are able to choose different routes depending on your area of interest. This will allow you to progress onto a specific degree programme at APU, related to this area or other relevant areas based on your foundation experience.

You will be able to:

• Enter Level 1 of degree study• Make an informed choice about what degree you want to study• Demonstrate an awareness of the concepts which underpin the study of Accounting, Banking, Finance & Quantitative Studies, Business & Management, Computing & Technology, Engineering, Design Innovation & Brand Management, Animation & Visual Effects, Creative Media Technology, International Studies & Sustainability and Journalism• Communicate effectively verbally and in writing to a given audience• Work effectively in a team• Demonstrate English and other study skills appropriate to undergraduate learning• Apply skills in numeracy, technology and communication• Explain the essential elements of technology• Use appropriate application software and the Internet

PROFESSIONAL CAREERSStart Here

Semester 1[ Common Semester 1 ]

Semester 2 & 3[ Choose your ROUTE in semester 2 & 3 ]


DEGREE PROGRAMME AREAS

• Accounting, Banking, Finance & Quantitative Studies• Business & Management• Computing & Technology• Engineering• Media & Mass Communications

• Animation & Visual Effects• Creative Media Technology• International Studies & Sustainability• Journalism• Product Design & Transport Design• Advertising and Brand Management

SPM / ‘O’ Levels (5 credits)

This programme is designed to help those with SPM, ‘O’ Levels or similar qualificationsto develop the skills and knowledge to progress into the first year of a degree of their choice.

PROGRAMMES

APUFOUNDATION• Foundation (Business & Finance)• Foundation (Computing & Technology)• Foundation (Engineering)

• Foundation (Design)• Foundation (Journalism & Creative Media)• Foundation (International Studies)


www.apu.edu.my | www.apiit.edu.my

APUFOUNDATIONPROGRAMME

MODULES YOU STUDYThe modules studied help develop your study skills, introduce you to what you can expect on your degree and also allow you to discover what you can study depending on whether you choose a degree in Accounting, Banking, Finance & Quantitative Studies, Business & Management, Computing & Technology, Engineer-ing, Industrial Design & Brand Management, Animation & Visual Effects, Creative Media Technology, International Studies & Sustainability and Journalism. The modules are:

APU Foundation Students will also have the opportunity to pursue Bachelor Degrees at Staffordshire University in the areas of Comput-ing & Technology, Engineering, Design, Animation & VFX, Brand Management, Creative Media, Journalism, Mass Communication, Accounting, Banking, Finance & Quantitative Studies, Business & Management and International Relations. This is providing, applicants meet the stated admission criteria and English Language Requirements, as determined by Staffordshire University, UK.

PATHWAYS TO STAFFORDSHIRE UNIVERSITY (UK) BACHELOR DEGREES

Flexibility of Choice

YOUR FOUNDATION PATHWAY TO A DEGREE OF YOUR CHOICE(Please refer to individual course brochure for details and admission requirements.)

* UK 3+0 Degrees offered through APIIT** Commencement from 2017 onwards. For further details, kindly refer to our Course Counselors at Student Services Office

Accounting, Banking, Finance & Quantitative Studies

• BA (Hons) in Accounting and Finance• BA (Hons) in Accounting and Finance with a specialism in Forensic Accounting• BA (Hons) in Accounting and Finance with a specialism in Taxation• BA (Hons) in Accounting and Finance with a specialism in Forex and investments• BA (Hons) in Accounting and Finance with specialism in Internal Audit• Bachelor in Banking and Finance (Hons)• Bachelor in Banking and Finance (Hons) with a specialism in Financial Planning• Bachelor in Banking and Finance (Hons) with a specialism in Investment and Risk Management• Bachelor in Islamic Banking and Finance (Hons)• BSc (Hons) in Actuarial Studies

Computing & Technology• BSc (Hons) in Information Technology • BSc (Hons) in Information Technology with a specialism in - Information Systems Security - Database Administration - Cloud Computing - Network Computing - Mobile Technology - Business Information Systems• BSc (Hons) in Software Engineering• BSc (Hons) in Computer Science• BSc (Hons) in Intelligent System• BSc (Hons) in Internet Technology• BSc (Hons) in Multimedia Technology• BSc (Hons) in Technopreneurship • BSc (Hons) in Computer Games Development• BSc (Hons) in Computer Games Development with a specialisms in Games Concept Art

Computing & Business Computing*• BSc (Hons) Cyber Security• BSc (Hons) Forensic Computing• BSc (Hons) in Business Computing• BSc (Hons) in Business Computing with a specialism in E-Commerce• BSc (Hons) in Business Information Technology

Leading from APU Foundation to your Choice of Degree Studies; please note that a Credit Pass in Mathematics at SPM / O-Level is required for the following programmes:

Mathematics

Leading from APU Foundation to your Choice of Degree Studies; please note that a Credit Pass in Mathematics and Physics OR Chemistry at SPM / O-Level is required for the following programmes:

Mathematics

Physics OR Chemistry OR Technical Science

Leading from APU Foundation to your Choice of Degree Studies:CREDIT / GRADE C in SPM / O-Level is required in: CREDIT / GRADE C in SPM / O-Level is required in:

Engineering• B.Eng (Hons) in Electrical & Electronic Engineering• B.Eng (Hons) in Electronic Engineering with specialism in Information Technology• B.Eng (Hons) in Telecommunication Engineering• B.Eng (Hons) in Mechatronic Engineering• B.Eng (Hons) in Petroleum Engineering

Applied Technology*• BSc (Hons) Product Design Technology**• BSc (Hons) Motorsport Technology**• BSc (Hons) Automotive Technology**• BSc (Hons) Aeronautical Technology**

Business & Management• BA (Hons) in Business Management• BA (Hons) in Business Management with a specialism in E-Business• BA (Hons) in International Business Management• BA (Hons) in Marketing Management • BA (Hons) in Human Resource Management • BA (Hons) in Media Marketing• BA (Hons) in Media Marketing with a specialism in Social Media• BA (Hons) in Services Management • BA (Hons) in Tourism Management

Media & Mass Communications• BA (Hons) in Media Marketing• BA (Hons) in Media Marketing with a specialism in Social Media• BSc (Hons) in Media Informatics

International Studies and Sustainability*• BA (Hons) International Relations • BSc (Hons) Environment and Sustainability**

Journalism*[ Assessment include interview and written exercises ]

• BA (Hons) Journalism**• BA (Hons) Broadcast Journalism**• BA (Hons) Sports Journalism**

Industrial Design and Brand Management*• BA (Hons) Product Design • BA (Hons) Transport Design• BA (Hons) Advertising and Brand Management

Animation & Visual Effects*• BA (Hons) Animation• BA (Hons) VFX : Visual Effects and Concept Design• BSc (Hons) Digital Film and 3D Animation Technology• BSc (Hons) CGI and Digital Effects

Creative Media Technology*• BA (Hons) Advertising and Commercial Film Production**• BA (Hons) Media (Film) Production**• BSc (Hons) Film Production Technology** • BSc (Hons) Television Production Technology**• BA (Hons) Film, Television & Radio Studies**• BA (Hons) Radio Production**

}

PORTFOLIOREQUIRED

INTERVIEWREQUIRED

}

}

}

• Introduction to Business• Individual, State & Society• Global Business Trends • Public Speaking in English

• Introduction to Business• Individual, State & Society• Computing & IT• Public Speaking in English

• Introduction to Business• Individual, State & Society• Engineering Mathematics• Public Speaking in English

• Imaging/Production Skills for Design

• Major Project 1• Design Theory and Practice 1• Public Speaking in English

• Writing Skills for Journalists• Introduction to Journalism

History & Practice• Global Business Trends• Public Speaking in English

• Introduction to International Relations

• Individual, State & Society• Global Business Trends• Public Speaking in English

• Academic Research Skills• Principles of Accounts• Economics for Business• Perspectives in Technology / Further Mathematics • Co-Curricular

• Academic Research Skills• Further Mathematics• Introduction to Multimedia

Applications• Perspectives in Technology• Co-Curricular

• Academic Research Skills• Mechanical Science• Engineering Science or Chemistry• Electrical and Electronic Principles• Co-Curricular

• Academic Research Skills• History of Design and Media• Major Project 2• Design Theory and Practice 2• Co-Curricular

• Academic Research Skills• Critical International Film Studies• Journalism and Society• English for Journalist• Co-Curricular

• Academic Research Skills• Issues in Development Studies• Economics for Business• Critical International Film Studies• Co-Curricular

SEMESTER 1

ROUTES

SEMESTER 2

SEMESTER 3

Students may also choose the following:

SECONDARY PATHWAYS

BUSINESS & FINANCE

• English for Academic Purpose • Communication Skills • Personal Development & Study Methods • IT Applications • MathematicsCOMMON SEMESTER 1

COMPUTING & TECHNOLOGY ENGINEERING DESIGN JOURNALISM & CREATIVE MEDIA INTERNATIONAL STUDIES

PRIMARY PATHWAYS- Computing & Technology - Engineering

- Applied Technology- Industrial Design & Brand

Management - Animation & Visual Effects

- Journalism - Creative Media Technology

- International Studies and Sustainability

- Business & Management- Accounting, Finance, Banking &

Quantitative Studies - Media & Mass Communications

- Computing & Technology - Industrial Design & Brand Management - Animation & Visual Effects- Creative Media Technology - International Studies & Sustainability - Journalism

- Business & Management - Accounting, Finance, Banking &

Quantitative Studies - Media & Mass Communications - Industrial Design & Brand

Management - Animation & Visual Effects - Creative Media Technology - International Studies & Sustainability - Journalism

- Computing & Technology - Accounting, Finance, Banking &

Quantitative Studies- Business & Management - Media & Mass Communications- Industrial Design & Brand



Quantitative Studies- Business & Management - Media & Mass Communications- Creative Media Technology - International Studies & Sustainability - Journalism



Management - Animation & Visual Effects - International Studies & Sustainability



Management - Animation & Visual Effects - Creative Media Technology - Journalism

You may then proceed to Level 1 of a Degree of your choice in the following pathways

[ Commencement from 2017 onwards ]



APUFOUNDATIONPROGRAMME

MODULES YOU STUDYThe modules studied help develop your study skills, introduce you to what you can expect on your degree and also allow you to discover what you can study depending on whether you choose a degree in Accounting, Banking, Finance & Quantitative Studies, Business & Management, Computing & Technology, Engineer-ing, Industrial Design & Brand Management, Animation & Visual Effects, Creative Media Technology, International Studies & Sustainability and Journalism. The modules are:

APU Foundation Students will also have the opportunity to pursue Bachelor Degrees at Staffordshire University in the areas of Comput-ing & Technology, Engineering, Design, Animation & VFX, Brand Management, Creative Media, Journalism, Mass Communication, Accounting, Banking, Finance & Quantitative Studies, Business & Management and International Relations. This is providing, applicants meet the stated admission criteria and English Language Requirements, as determined by Staffordshire University, UK.

PATHWAYS TO STAFFORDSHIRE UNIVERSITY (UK) BACHELOR DEGREES

Flexibility of Choice

YOUR FOUNDATION PATHWAY TO A DEGREE OF YOUR CHOICE(Please refer to individual course brochure for details and admission requirements.)

* UK 3+0 Degrees offered through APIIT** Commencement from 2017 onwards. For further details, kindly refer to our Course Counselors at Student Services Office

Accounting, Banking, Finance & Quantitative Studies

• BA (Hons) in Accounting and Finance• BA (Hons) in Accounting and Finance with a specialism in Forensic Accounting• BA (Hons) in Accounting and Finance with a specialism in Taxation• BA (Hons) in Accounting and Finance with a specialism in Forex and investments• BA (Hons) in Accounting and Finance with specialism in Internal Audit• Bachelor in Banking and Finance (Hons)• Bachelor in Banking and Finance (Hons) with a specialism in Financial Planning• Bachelor in Banking and Finance (Hons) with a specialism in Investment and Risk Management• Bachelor in Islamic Banking and Finance (Hons)• BSc (Hons) in Actuarial Studies

Computing & Technology• BSc (Hons) in Information Technology • BSc (Hons) in Information Technology with a specialism in - Information Systems Security - Database Administration - Cloud Computing - Network Computing - Mobile Technology - Business Information Systems• BSc (Hons) in Software Engineering• BSc (Hons) in Computer Science• BSc (Hons) in Intelligent System• BSc (Hons) in Internet Technology• BSc (Hons) in Multimedia Technology• BSc (Hons) in Technopreneurship • BSc (Hons) in Computer Games Development• BSc (Hons) in Computer Games Development with a specialisms in Games Concept Art

Computing & Business Computing*• BSc (Hons) Cyber Security• BSc (Hons) Forensic Computing• BSc (Hons) in Business Computing• BSc (Hons) in Business Computing with a specialism in E-Commerce• BSc (Hons) in Business Information Technology

Leading from APU Foundation to your Choice of Degree Studies; please note that a Credit Pass in Mathematics at SPM / O-Level is required for the following programmes:

Mathematics

Leading from APU Foundation to your Choice of Degree Studies; please note that a Credit Pass in Mathematics and Physics OR Chemistry at SPM / O-Level is required for the following programmes:

Mathematics

Physics OR Chemistry OR Technical Science

Leading from APU Foundation to your Choice of Degree Studies:CREDIT / GRADE C in SPM / O-Level is required in: CREDIT / GRADE C in SPM / O-Level is required in:

Engineering• B.Eng (Hons) in Electrical & Electronic Engineering• B.Eng (Hons) in Electronic Engineering with specialism in Information Technology• B.Eng (Hons) in Telecommunication Engineering• B.Eng (Hons) in Mechatronic Engineering• B.Eng (Hons) in Petroleum Engineering

Applied Technology*• BSc (Hons) Product Design Technology**• BSc (Hons) Motorsport Technology**• BSc (Hons) Automotive Technology**• BSc (Hons) Aeronautical Technology**

Business & Management• BA (Hons) in Business Management• BA (Hons) in Business Management with a specialism in E-Business• BA (Hons) in International Business Management• BA (Hons) in Marketing Management • BA (Hons) in Human Resource Management • BA (Hons) in Media Marketing• BA (Hons) in Media Marketing with a specialism in Social Media• BA (Hons) in Services Management • BA (Hons) in Tourism Management

Media & Mass Communications• BA (Hons) in Media Marketing• BA (Hons) in Media Marketing with a specialism in Social Media• BSc (Hons) in Media Informatics

International Studies and Sustainability*• BA (Hons) International Relations • BSc (Hons) Environment and Sustainability**

Journalism*[ Assessment include interview and written exercises ]

• BA (Hons) Journalism**• BA (Hons) Broadcast Journalism**• BA (Hons) Sports Journalism**

Industrial Design and Brand Management*• BA (Hons) Product Design • BA (Hons) Transport Design• BA (Hons) Advertising and Brand Management

Animation & Visual Effects*• BA (Hons) Animation• BA (Hons) VFX : Visual Effects and Concept Design• BSc (Hons) Digital Film and 3D Animation Technology• BSc (Hons) CGI and Digital Effects

Creative Media Technology*• BA (Hons) Advertising and Commercial Film Production**• BA (Hons) Media (Film) Production**• BSc (Hons) Film Production Technology** • BSc (Hons) Television Production Technology**• BA (Hons) Film, Television & Radio Studies**• BA (Hons) Radio Production**

}

PORTFOLIOREQUIRED

INTERVIEWREQUIRED

}

}

}

• Introduction to Business• Individual, State & Society• Global Business Trends • Public Speaking in English

• Introduction to Business• Individual, State & Society• Computing & IT• Public Speaking in English

• Introduction to Business• Individual, State & Society• Engineering Mathematics• Public Speaking in English

• Imaging/Production Skills for Design

• Major Project 1• Design Theory and Practice 1• Public Speaking in English

• Writing Skills for Journalists• Introduction to Journalism

History & Practice• Global Business Trends• Public Speaking in English

• Introduction to International Relations

• Individual, State & Society• Global Business Trends• Public Speaking in English

• Academic Research Skills• Principles of Accounts• Economics for Business• Perspectives in Technology / Further Mathematics • Co-Curricular

• Academic Research Skills• Further Mathematics• Introduction to Multimedia

Applications• Perspectives in Technology• Co-Curricular

• Academic Research Skills• Mechanical Science• Engineering Science or Chemistry• Electrical and Electronic Principles• Co-Curricular

• Academic Research Skills• History of Design and Media• Major Project 2• Design Theory and Practice 2• Co-Curricular

• Academic Research Skills• Critical International Film Studies• Journalism and Society• English for Journalist• Co-Curricular

• Academic Research Skills• Issues in Development Studies• Economics for Business• Critical International Film Studies• Co-Curricular

SEMESTER 1

ROUTES

SEMESTER 2

SEMESTER 3

Students may also choose the following:

SECONDARY PATHWAYS

BUSINESS & FINANCE

• English for Academic Purpose • Communication Skills • Personal Development & Study Methods • IT Applications • MathematicsCOMMON SEMESTER 1

COMPUTING & TECHNOLOGY ENGINEERING DESIGN JOURNALISM & CREATIVE MEDIA INTERNATIONAL STUDIES

PRIMARY PATHWAYS- Computing & Technology - Engineering

- Applied Technology- Industrial Design & Brand

Management - Animation & Visual Effects

- Journalism - Creative Media Technology

- International Studies and Sustainability

- Business & Management- Accounting, Finance, Banking &

Quantitative Studies - Media & Mass Communications

- Computing & Technology - Industrial Design & Brand Management - Animation & Visual Effects- Creative Media Technology - International Studies & Sustainability - Journalism

- Business & Management - Accounting, Finance, Banking &

Quantitative Studies - Media & Mass Communications - Industrial Design & Brand






Quantitative Studies- Business & Management - Media & Mass Communications- Creative Media Technology - International Studies & Sustainability - Journalism



Management - Animation & Visual Effects - International Studies & Sustainability



Management - Animation & Visual Effects - Creative Media Technology - Journalism

You may then proceed to Level 1 of a Degree of your choice in the following pathways

[ Commencement from 2017 onwards ]


YOU STUDYMODULES

COMMON MODULES

• Communication Skills You will deal with fundamentals of communication in an

organized setting. You will generally be introduced to presentation techniques, effective use of letters, memos and emails, report writing, ethics in social media, effective telephone communication skills and barriers to communi-cation.

• English for Academic Purposes This module is designed to improve your grasp of the

English language for academic purposes at degree level. You will develop listening, speaking, reading & writing skills in this module.

• Public Speaking in English This module is designed to develop you on Public Speak-

ing skills which will help to build confidence and credibility in your interpersonal skills. You will generally be introduced to audience analysis, delivery, overcome communication apprehension and roles as a speaker and listener.

• Personal Development and Study Skills This module is aimed at giving you the essential skills and

techniques such as time management, note making and thinking skills.

• Academic Research Skills In the realm of academic, this module will be the platform

to dominantly guide you on how to do assignments in degree programmes and generally understand the funda-mental aspects in completing the final year project. You will also be aware of ethical issues pertinent to conducting research at work place.

• Mathematics You will be introduced to the study of the core basic

mathematical and statistical concepts used in a variety of environments, e.g. business and computing. This module includes ratio, proportion & percentages, using algebra, solving equations, graphs of linear / quadratic functions.

BUSINESS AND FINANCE

ENGINEERING

JOURNALISM AND MEDIA

INTERNATIONAL STUDIES

DESIGN

COMPUTING


SPECIALISED MODULES FOR EACH ROUTE

• Introduction to BusinessYou are introduced to the nature and environment of Business, the different forms of business ownership and the key organisational theories, as well as the concepts of marketing, human resource management, accounting and operations management.

• Global Business TrendsThis module introduces you to the micro and mega trends in contem-porary development affecting business such as the usage of technolo-gy, economic-geographic environment, political-legal environment and social-cultural environment.

• Principles of AccountsYou will be introduced to the basics of Accounts such as recording business transactions and ledger entries. Overall, the module equips you with the basic understanding of maintaining, preparing and recording business transactions.

• Economics for BusinessThis module Introduces you to the basics of economics such as consumer supply and demand, firms and supply, macro economy policy and how it affects economic growth as well as understanding International trade, such as the effects of exchange rates in different market structures.

• IT ApplicationYou are provided with practical skills in using IT application packages such as MS Word, MS Excel and MS Access. You will get a detailed understanding through ‘hands on’ experience in the labs.

• Computing & ITYou will be introduced to a number of aspects relating to the input-process-output concept. You will be exposed to areas such as fundamentals of computer systems and microprocessors, problem solving techniques as well as program design and development.

• Introduction to Multimedia ApplicationsThis module provides you with fundamental knowledge and skills to create and document an interactive multimedia application such as graphics, 2D animations and typography settings.

• Perspectives in TechnologyYou are introduced to the role of technology in modern life and its impact on the world and the environment such as in the areas of biotechnology, internet technology, process and design technology as well as Business, Society and Ethics.

• Further Mathematics This module provides you with basic mathematical skills such as matrices, logarithms, calculus and trigonometry.

• Engineering MathematicsThe module aims to provide you with a broad understanding of and practice in trigonometry, matrices, complex number and vectors. The understanding will not only help in developing the analytical concepts but also its use in engineering applications such as analysing electric circuits.

• Engineering ScienceThis module introduces you to basic concepts such as atomic structure, atomic bonding and principles of engineering science such as heat transfer, elasticity and waves. These engineering science principles will develop strong foundations which will help you in your further studies.

• Mechanical ScienceThe module provides you with a strong foundation to understand and solve problems of Newton’s Law, Impact / Collision, Friction, Angular Motion, Coplanar force, Equilibrium of forces, Moment of forces and Centroid.

• Electrical and Electronic PrinciplesThis module provides you the basic concepts and principles of Electric field, Magnetic field, Ohm’s and Kirchhoff’s laws, Semiconductor devices fundamentals and basic digital electronic circuits. You are exposed to the laboratory where you will use electrical components, devices and instruments and construct circuits to verify relevant theories.

• Writing Skills for JournalistYou will be introduced to different writing skills such as editorials, reviews and articles. This would be coupled with the ability in topic selection, language usages and presentation skills.

• Introduction to Journalism History & PracticeThis module introduces the role of the journalist through a study of the history of journalism following the broad stages of technological change that have, in turn, enabled the professionalisation of journalism for print, broadcast and online distribution.

• English for Journalists You will be exposed to areas such as grammar rules, grammar mistakes and confusions, language usage such as vogue words, posh words, jargon and foreign words.

• Journalism and SocietyYou will be introduced to the role and influence of journalism on society and the public domain which includes freedom of speech and privacy, media ethics and responsibility, online journalism and broadcast regulations.

• Critical International Film StudiesThis module imparts you the basic skills of conducting text criticism which includes cinematography, editing, acting performance, and sound design.

• Introduction to International RelationsThis module will provide you with an introduction of key concepts in International Relations like power, national interest, war, balance of power, institutionalism, interdependence and dependence.

• Individual, State and SocietyYou will be exposed to the different systems of governance, understand-ing the basic types of law and their application in society.

• Issues in Development StudiesThe module comprises a series of lectures on particular themes and challenges in development such as gender, population and development, health and life expectancy as well as urbanization & and environmental sustainability.

• Geography and the EnvironmentThe module will enable you to understand a range of key geographical and environmental concepts, mapped patterns and the interrelationship between economic systems, climate, politics and environmental conditions.

• Imaging/Production Skill for DesignYou will improve your observational skills through practising traditional life drawing (for example animals, plants etc) and the use of 3D and digital workshops, using appropriate media in response to a variety of visual problems.

• Major Project 1You will be encouraged to research and generate ideas and ways of working independently by negotiation. This mode of study will result in the production of a body of work in the area of your choice, in the form of a Progress Review.

• Design Theory and Practice: 1This module is about the way that any professional art or design practice is informed by the work and ideas of other people and other times. You will learn about how and why other artists and designers do the things they do, and will understand how your own work can benefit from this knowledge.

• History of Design and MediaYou will learn about the development and the history of aesthetical product and media design, and by understanding the theory, you are also encouraged to explore the application in practice.

• Major Project 2Further in-depth study of the pre-requisite module, you will continue to do research and generate ideas to get more focus on producing a design project based on the choice of your study.

• Design Theory and Practice: 2 As the pre-requisite module, you will learn about the knowledge of design and theory through samples and case studies from people in the creative industries.


PROGRAMMESDIPLOMA

• ENGINEERING- APIIT Diploma in Electrical & Electronic Engineering

• DESIGN, MEDIA, JOURNALISM AND INTERNATIONAL STUDIES

- APIIT Diploma in Design & Media- APIIT Diploma in Journalism- APIIT Diploma in International Studies

• COMPUTING & TECHNOLOGY- Diploma in Information & Communications Technology- Diploma in Information & Communications Technology with a specialism in Software Engineering

• BUSINESS & BUSINESS IT- Diploma in Business Administration- Diploma in Business with Information Technology

• ACCOUNTING & FINANCE- Diploma in Accounting- Diploma in Finance


Diploma in InformatIon & CommunICatIons teChnology

This APU Diploma in Information and Communications Technology is specifically designed to provide:• CoverageoftheacademicaspectaswellasthevocationalaspectofthewideareaofComputingandInformationandCommunicationsTechnology.

• StudentswiththeskillstopreparethemforcareersintheICTenvironmentwithemphasisonsolutionsdesign,softwaredevelopmentandtechnologyinfrastructuresupport.

• Studentswithacademicandprofessionalskillstodevelopsolutionsrequiringtheapplicationoftechnologyinabusinessandorganisationalcontext,soastofacilitateresponsetocontinuousfuturechangesintechnologyandindustrypractices.

• Studentswithcritical,independentandcooperativelearningskillssoastofacilitateresponsestocontinuousfuturechangesinindustrypractises.

SemeSter 1Atthebeginningoftheprogrammestudentswill acquire basic mathematical, languageand communication skills along with coreinformation technology skills. Students willgain an understanding of basic conceptsand terminology related to technology andbusinessmanagement.

modules• EnglishforAcademicPurposes• NumericalSkills• ManagingBusiness• PracticalITSkills

SemeSter 2Thesecondsemesterbuildsonandextendsthefoundationknowledgedevelopedinthefirstsemester.Languageandcommunicationskills are taken to more advanced levelsof research and professionalism. Theability to analyze and solveproblemsusingquantitative skills, and familiarity withtechnologyareenhanced.

modules• ProfessionalCommunication• AcademicResearchSkills• ComputerTechnology• NumericMethods&Logic

SemeSter 3Thissemestermovesstudentstoanewlevelininformationandcommunicationtechnologyrelatedareassuchascomputerprogramming,databases,Internetapplicationsandcomputersystem architecture. With this knowledge,students are able to use computing toolsand techniques to solve common real-worldproblems.

modules• DatabaseSystems• InternetApplications• ComputerSystemsArchitecture• VisualBasic

SemeSter 4Students are exposed to more advanceddevelopment concepts, including theapplicationofusabilityprinciplesinthewebdesign and development process, and thesystem development cycle. Employabilityskills are introduced through the principlesofITOperationsManagementandconceptsof Operating Systems, preparing studentsto provide technical support within anorganisation.

modules• WebDevelopment• ITOperationsManagement• InformationSystems• OperatingSystems• SystemAnalysis&Design

SemeSter 5In their final semester, students acquirebasic knowledge of computer networks,digitalsecurityandforensicstodeepentheirknowledge of computing technology andethicalresponsibilities.Studentsalsodesignandimplementalgorithmsusingtheirsecondprogramming language, and complete aSoftwareDevelopmentProject toshowthatthey can integrate skills, knowledge andunderstanding from the full programme,includingmultimediatechniquesforbusinesspresentationsandentertainment.

modules• JavaProgramming• MultimediaApplications• DigitalSecurityandForensic• Networks&Networking• SoftwareDevelopmentProject

*In addition to the above, all students arealso required to successfully completeGeneral Studies modules as stipulated bytheMalaysianQualificationAgency, as wellasfulfillcreditrequirementsforCo-CurricularActivities.

Further Studies

Upon successful completion of thisprogramme with CGPA of 2.5 and above;youwill be eligible to progress into any ofthefollowingdegreeprogrammesofferedatAPU&APIIT.

• BSc(Hons)inInformationTechnology

• BSc(Hons)inInformationTechnologywithaspecialismin:

-InformationSystemsSecurity -DatabaseAdministration -CloudComputing -NetworkComputing -MobileTechnology -BusinessInformationSystems

• BSc(Hons)inSoftwareEngineering**• BSc(Hons)inComputerScience**

• BSc(Hons)inInternetTechnology

• BSc(Hons)inBusinessComputing

• BSc(Hons)inBusinessComputingwithspecialisminE-Commerce

• BSc(Hons)inBusinessInformationTechnology

• BSc(Hons)inCyberSecurity

• BSc(Hons)inForensicComputing

KPT/JPS(R/481/4/0620)(A11687)07/20

** ACreditPassinAdditionalMathematicsatSPM/‘O’Levelsisrequired.


Diploma in InformatIon & CommunICatIons teChnology wIth a speCIalIsm In software engIneerIng

This APU Diploma in Information & Communications Technology with a specialism in Software Engineering is designed to provide: • Studentswithskillsinsoftwaresystemsdevelopment,withemphasisonaspectsofsoftwareengineering.

• StudentswiththeskillstopreparethemforcareersintheICTenvironmentwithemphasisonsolutionsdesign,softwaredevelopmentandtechnologyinfrastructuresupport.

• Anappreciationoftheprovenprinciplesandtechniquesforthedevelopmentandsupportofsoftwaresystemsincommercialorganisations.

• Studentswithcritical,independentandcooperativelearningskillssoastofacilitateresponsestocontinuousfuturechangesinindustrypractises.




modules• ProfessionalCommunication• AcademicResearchSkills• ComputerTechnology• NumericMethods&Logic

SemeSter 3Thissemestermovesstudentstoanewlevelininformationandcommunicationtechnologyrelatedareassuchascomputerprogramming,databases,Internetapplicationsandcomputersystem architecture. With this knowledge,students are able to use computing toolsand techniques to solve common real-worldproblems.

modules• DatabaseSystems• InternetApplications• ComputerSystemsArchitecture• VisualBasic

SemeSter 4Students are exposed to more advanceddevelopment concepts, including theapplicationofusabilityprinciplesinthewebdesign and development process, and thesystem development cycle. Specialisationstartshere,withadeeperunderstandingofthesystematicmodelsandstandardprocess-orientedmethodologiesthataretheessenceof software engineering as a career field.Software engineering also requires a deepappreciation of algorithmic thinking, basedoncalculusandalgebra.

modules• WebDevelopment• NumericalMethods• IntroductiontoSoftwareEngineering• OperatingSystems• SystemAnalysis&Design

SemeSter 5In their final semester, students acquirebasic knowledge of computer networks,digitalsecurityandforensicstodeepentheirknowledge of computing technology andethicalresponsibilities.Studentsalsodesignandimplementalgorithmsusingtheirsecondprogramming language, and complete aSoftwareDevelopmentProject toshowthatthey can integrate skills, knowledge andunderstanding from the full programme,including a range of AI techniques forproblemsolving.

modules• JavaProgramming• DigitalSecurityandForensic• Networks&Networking• IntroductiontoArtificialIntelligent• SoftwareDevelopmentProject


Further Studies


• BSc(Hons)inInformationTechnology

• BSc(Hons)inInformationTechnologywithaspecialismin:

-InformationSystemsSecurity -DatabaseAdministration -CloudComputing -NetworkComputing -MobileTechnology -BusinessInformationSystems

• BSc(Hons)inComputerScience**

• BSc(Hons)inSoftwareEngineering**

• BSc(Hons)inIntelligentSystems

• BSc(Hons)inInternetTechnology




• BSc(Hons)inCyberSecurity

• BSc(Hons)inForensicComputing

KPT/JPS(R/481/4/0620)(A11687)07/20

** ACreditPassinAdditionalMathematicsatSPM/‘O’Levelsisrequired.


Diploma in BusIness wIth InformatIon teChnology




modules• ProfessionalCommunication• AcademicResearchSkills• ComputerTechnology• QuantitativeMethods

SemeSter 3In this semester students build on theirunderstanding of general business conceptsandprocedurestomorespecificareas,namelymarketingandeconomics.Relatedtechnologyskills in database systems and computerprogramming enhance their knowledge andefficiency in solving problems and makingdecisionwithcomputingtoolsandtechniques.

modules• DatabaseSystems• VisualBasic• Marketing• BusinessEconomics

SemeSter 4The modules in this semester continueto build on the understanding of generalbusiness concepts and procedures to themore specific areas of statistical analysis,accounting, and the legal environment.On the technology side, students areexposedtointernetapplicationsdesignanddevelopment, and the systemdevelopmentcycle.

modules• LegalFrameworkofBusiness• InternetApplications• BusinessStatistics• Accounting• SystemAnalysis&Design

SemeSter 5Thefinalsemesterbringsstudentsintomoreadvanced areas of business management,including issues related to organizationalcapabilities and resources, service qualityand sustainability, and management ofIT resources. Graduates will be able todemonstrate a range of cognitive andintellectual skills as they apply techniquesspecific to business, management andinformationtechnologytocreatesolutionsinreal-worldsituations.

modules• OrganisationalBehaviour• ManagingServices• ManagingInformationSystems• ITOperationsManagement• MultimediaApplications


This APU Diploma in Business with Information Technology is designed to provide: • Studentsforcareersinhybridenvironmentswherebusinessinformationsystemsareincreasinglyintegrated,encompassingawiderangeofenablingtechnologiesandcross-organisational,social,nationalandinternationalboundaries.

• Studentswithacademicandprofessionalskillstodevelopsolutionsrequiringtheapplicationofbothbusinessandinformationtechnologydisciplinesinacommercialandorganisationalcontext.

• Studentswithcritical,independentandcooperativelearningskillssoastofacilitateresponsestocontinuousfuturechangesintechnologyandindustrypractices.

• Studentswithintellectualskills,communicationsabilityandteamworkingcapability.

JPT/BBP(U)1000-801/63/Jld.3(1)(A8238)12/16

Further Studies

Upon successful completion of thisprogramme,youwillbeeligibletoprogressintoanyofthefollowingdegreeprogrammesofferedatAPUandAPIIT:

• BA(Hons)inBusinessManagement

• BA(Hons)inBusinessManagementwithaspecialisminE-Business

• BA(Hons)inInternationalBusinessManagement

• BSc(Hons)inMediaInformatics

• BA(Hons)inMediaMarketing

• BA(Hons)inMediaMarketingwithaspecialisminSocialMedia


• BSc(Hons)inInformationTechnologywithaspecialisminBusinessInformationSystems

• BSc(Hons)inTechnopreneurship





Diploma in BusIness admInIstratIon

This APU Diploma in Business Administration is designed to provide: • Studentsforcareersinthebusinessadministrativeenvironmentwithemphasisongeneralbusinessoperations,organisationandspecialisationoptioninaccounting,tourism,informationtechnologyormarketing.

• Professionalskillstodevelopsolutionsrequiringaholisticoutlookinthebusinessandorganisationalcontext.

• Studentswithcritical,independentandcooperativelearningskillssoastofacilitateresponsetocontinuousfuturechangesinindustrypractices.

• Studentswithintellectualskills,communicationsabilityandteamworkingcapability.

SemeSter 1In this semester students will be equippedwith basic mathematical, language andcommunication as well as informationtechnology skills. Throughout the durationof the semester, students will be exposedtovariousterminologiesandbasicconceptsrelated to businessmanagerial skills. Theseskills are imperative for a smooth transitiontothefollowingsemester.


SemeSter 2Themodules ProfessionalCommunications,Academic Research Skills and QuantitativeMethods that are offered in this semesterhelptofurtherdevelopstudents’knowledgeand skills significantly with emphasis onaspectsthatarecoretothestudyofbusiness.Also theFundamentalsofEntrepreneurshipmodulewillbegintotakethestudentthroughtheprocessandthemethodsinvolvedintheearlystagesofventurecreation.

modules• ProfessionalCommunications• AcademicResearchSkills• FundamentalsofEntrepreneurship• QuantitativeMethods

SemeSter 3This semestermoves the students from thebasic business concepts and proceduresto more advanced topics like PeopleManagement, Marketing and BusinessEconomics. Financial Accounting modulewill expand their knowledge and efficiencyinsolvingproblemsandmakingdecisionsindifferentareasofbusiness.

modules• PeopleManagement• FinancialAccounting• Marketing• BusinessEconomics

SemeSter 4Themodules in this semester are aimed atequippingstudentswiththeknowledgeandskills in the legal, statistical and financialaspectsofbusiness.Inaddition,studentsareexposed to International Business modulewhich allows the students to understandtheenvironmentalandcultural issuesfacingglobalorganisations.Besides,theManagingInformation Systems module will alsointroduce the students to applications ofbusinessdatacommunications.

modules• LegalFrameworkofBusiness• InternationalBusiness• BusinessStatistics• PrinciplesofFinance• ManagingInformationSystems

SemeSter 5Thefinalsemesterallowsstudentstoprogressinto more advanced areas of business andmanagement. Students will experience abalance of business theories and practicalapplications. In addition, students will alsoselect2optionmodulesduringthesemester.Supported by accounting module, theyare expected to be able to demonstratecognitive and intellectual skills relevant tobusiness.

modules• OrganisationalBehaviour• ManagingServices• CostAccounting

Option modules A• ConsumerBehaviour• BusinessOperations• ComputerTechnology

Option modules B• E-Business• E-Commerce• InternetApplications


Further Studies





• BA(Hons)inMarketingManagement

•BA(Hons)inHumanResourceManagement



• BA(Hons)inMediaMarketingwithaspecialisminSocialMedia

JPT/BPP(U)1000-801/63/Jld.6(10)(A8886)01/19


Diploma in aCCountIng

SemeSter 1In this semester, studentswill be equippedwith basic mathematical, language andcommunication as well as informationtechnologyskills.Throughoutthedurationofthestudy,studentswillbeexposedtovariousterminologiesandbasicconceptsrelatedtobusiness managerial skills. These skills areimperative for a smooth transition into thefollowingsemester.


SemeSter 2Themodules ProfessionalCommunications,Quantitative Methods and AcademicResearch Skills that are offered in thissemester help to further develop students’knowledge and skills significantly withemphasis on aspects that are core to thestudy of accounting. Financial Accounting1which toucheson thebasic conceptsandproceduresofaccountingwillbeintroduced.

modules• AcademicResearchSkills• FinancialAccounting1• ProfessionalCommunications•QuantitativeMethods

SemeSter 3Thissemestermovesstudentsfromthebasicaccounting concepts and procedures tomoreadvancedtopicsinfinancialaccounting.There are also modules in related subjectssuchaseconomics,marketingandBusinessStatistics which will expand the knowledgeandefficiencyinsolvingproblemsandmakedecisionsindifferentareasofbusiness.

modules• BusinessEconomics• BusinessStatistics• FinancialAccounting2• Marketing

SemeSter 4Themodules in this semester are aimed atequippingstudentswiththeknowledgeandskills in the legal and quantitative analysisaspectsofbusiness.Inaddition,studentsareexposedtothelatestaccountingconcepts,techniques,trendsandissues in the areas of financial accountingand reporting, finance, and accountinginformation system. These modules aretargeted to enhance the application skillsof students in a higher level of accountingrelatedareas.

modules• AccountingInformationSystem• BusinessLaw• FinancialAccounting3• PrinciplesofFinance• QuantitativeAnalysis

SemeSter 5The final semester allows students toprogress into more advanced areas ofaccounting, taxation, auditing, modellingtechniques using computers and developdataspreadsheets,aswellascostaccounting.Graduates experience a balance ofaccountingtheoryandpracticalapplicationswith integrated computer technologies andare expected to be able to demonstratecognitive and intellectual skills withtechniques in business, management,informationtechnologyandaccounting.

modules• Audit&ControlSystems• BasicTaxation• CostAccounting• FinancialAccounting4• SpreadsheetModellingTechniques


This APU Diploma in Accounting is designed to provide:• Studentswithrelevantknowledgeandskillstofollowacareerinaccounting,businessorfinance.

• Studentswithcritical,independentandcooperativelearningskillssoastofacilitateresponsetocontinuouschangesinindustrypractices.

• Studentswithintellectual,communicationsandteamworkingskills.• Studentswithopportunitiesforprogressionintostudiesatdegreelevelinrelevantareas.

• Opportunitiesforstudentstopursueprofessionalqualificationsfromprofessionalaccountingandfinancialbodies.

KPT/JPS(R/433/4/0202)(A8889)01/19

Further Studies


• BA(Hons)inAccounting&Finance

• BA(Hons)inAccountingandFinancewithaspecialisminForensicAccounting

• BA(Hons)inAccountingandFinancewithaspecialisminTaxation

• BA(Hons)inAccountingandFinancewithaspecialisminForexandInvestments

• BA(Hons)inAccounting&FinancewithaspecialisminInternalAudit





• BA(Hons)inHumanResourceManagement

• BachelorinBankingandFinance(Hons)

• BachelorinBankingandFinance(Hons)withaspecialisminFinancialPlanning

• BachelorinBankingandFinance(Hons)withaspecialisminInvestmentandRiskManagement

• BachelorinIslamicBankingandFinance(Hons)


Diploma in fInanCe

SemeSter 1In this semester students will be equippedwith basic mathematical, language andcommunication as well as informationtechnologyskills.Throughoutthedurationofthestudy,studentswillbeexposedtovariousterminologiesandbasicconceptsrelatedtobusiness managerial skills. These skills areimperative for a smooth transition to thefollowingsemester.


SemeSter 2Professional Communications, QuantitativeMethods and Academic Research Skillsmodules are offered in this semester tofurther develop students’ knowledge andskills emphasising on aspects that are coreto the study of finance and accounting.FinancialAccounting1whichtouchesonthebasicconceptsandprocedureofaccountingwillalsobeintroduced.

modules• AcademicResearchSkills• FinancialAccounting1• ProfessionalCommunications• QuantitativeMethods

SemeSter 3Thissemestermovesstudentsfromthebasicaccounting concepts and procedures tomoreadvancedtopicsinfinancialaccounting.There are also modules in related subjectssuchasEconomics,MarketingandBusinessStatisticswhichwillexpandtheirknowledgeandefficiencyinsolvingproblemsandmakedecisionsindifferentareasofbusiness.

modules• BusinessEconomics• BusinessStatistics• FinancialAccounting2• Marketing

SemeSter 4Themodules in this semester are aimed atequipping students with the knowledgeand skills in the legal aspect of business.In addition, students are exposed to morespecialised areas of finance such as RealEstate Finance, Banking and Finance andInsurance. These modules are targeted toenhancetheapplicationskillsofstudentsinahigherleveloffinancerelatedareas.

modules• ManagerialFinance• BusinessLaw• RealEstateFinance• Principlesofinsurance• PrinciplesofBankingandFinance

SemeSter 5The final semester allows students toprogress into more advanced areas offinance, subjects taught are FinancialRegulationsandPractices,PersonalFinanceand Financial Planning, Investment AnalysisandRiskManagement,InternationalFinanceandIslamicFinance.

modules• FinancialRegulationsandPractices• PersonalFinance&FinancialPlanning• InvestmentAnalysisandRiskManagement

• InternationalFinance• IslamicFinance


This APU Diploma in Finance is designed to provide:• Studentswithsolidfoundationinfinancetomeetthedemandsofwiderangeofcareersinthebusiness,accounting,bankingandfinanceenvironment.

• Studentswithacademicandprofessionalskillstodevelopsolutionsrequiringtheapplicationoffinanceinabusinessandindustrialcontext.

• Studentswithcritical,independentandcooperativelearningskillssoastofacilitateresponsetocontinuouschangesinindustrypractices.

• Studentswithintellectual,communicationsandteamworkingskills.• Studentswithopportunitiesforprogressionintostudiesatdegreelevelinrelevantareas.

KPT/JPS(N/343/4/0183)(MQA/PA5692)05/20

Further Studies


• BA(Hons)inAccounting&Finance

• BA(Hons)inAccountingandFinancewithaspecialisminForensicAccounting

• BA(Hons)inAccountingandFinancewithaspecialisminTaxation

• BA(Hons)inAccountingandFinancewithaspecialisminForexandInvestments

• BA(Hons)inAccounting&FinancewithaspecialisminInternalAudit






• BachelorinBankingandFinance(Hons)

• BachelorinBankingandFinance(Hons)withaspecialisminFinancialPlanning

• BachelorinBankingandFinance(Hons)withaspecialisminInvestmentandRiskManagement

• BachelorinIslamicBankingandFinance(Hons)


SemeSter 1Inthissemester,studentswillbeintroducedto preparatory modules which would beessentialforthemtoembarkontheirjourneyincompletionoftheirdiploma.Studentswillbe taught English for writing, reading andspeaking together with basic Mathematics,MechanicsandComputing.StudentsarealsorequiredtotakeoneGeneralStudiesmoduleas required by the Malaysian QualificationAgency.

modules• EnglishforAcademicPurpose• EngineeringMechanics• FoundationofEngineeringMathematics• PracticalITSkills• GeneralStudiesmodule

SemeSter 2Continuitionfromsemester1;studentsstudyMathematicsinmoredepthandareexposedinprofessionalcommunicationandbusinessto prepare them with skills essential topreparethemintheworkingworld.

modules• ProfessionalCommunications• BusinessEnvironment• EngineeringMathematics1

SemeSter 3Insemester3,studentswillcontinuestudyingMathematics. They would also learn toconstruct simple logic circuits and to applycocepts of magnetic and electrical field. Inaddition to these, theywouldbealso learnon atomic structure, properties and failuresofmaterialssuchaspolymersandmetalalloy.

modules• EngineeringMaterials• EngineeringMathematics2• ElectricalandElectronicPrinciple

SemeSter 4From semester 4 onwards, students areintroduced to core engineering modules.They would be learning on calculatingcurrents and voltages in circuits usingKirchoff’s Law, network theorems andnodal and mesh analysis.They also learnabout various types of instruments usedfor engineering measurements and hasthe opportunity to use them; preparingthemselveswithsufficientknowledgeonlabequipments before they experience morelabsincomingsemesters.Studentsarealsoexposed to computer based 3Dmodelling,Boolean Algebra, Karnaugh map andconstructionofdigitalarithmeticcircuits.

modules• AnalysisofCircuits• InstrumentationandMeasurements• DesignPrinciples• DigitalElectronics

SemeSter 5Two of the modules in this semesteruses programming languages. Studentsare taught on how to write assemblylanguage programmes to programme themicroprocessorandmicrocontrollerandalsotodesign,implementandtestalorithmsinCprogramming. In addition to this, studentsarealsoexposedtoanaloguecircuitsanditsanalysis.

modules• MicroprocessorandMicrocontrollerSystems

• AnalogueElectronics• ProblemSolvingandProgramDesignusingC

• OrganisationalBehaviour


SemeSter 6Duringthefinalsemester,studentsaretaughttounderstandandsolveproblemsinvolvingthreephasecircuits, synchronousmachines,transformers, transmission lines and powersystemprotection, learnto interpretcontrolprocess and transform the process intomathematical expression and learn ondetailed construction, types, operatingcharacteristics of DC & AC Machines anddrives. Students also learn on modulationand demodulation of information carryingsignals.

modules• Generation,TransmissionandProtection• ControlSystems• ElectricalMachinesandDrives• CommunicationEngineeringPrinciples

Diploma in eleCtrICal & eleCtronIC engIneerIng

This APIIT Diploma in Electrical & Electronic Engineering is designed to provide:TheDiplomainElectricalandElectronicEngineeringprogrammepreparesyouforcareersintheElectrical,Electronics,Telecommunication,andManufacturingenvironments.Thisprogrammeoffersabroad-basedstudyintheareasofelectricalandelectronicengineering.• Afullrangeofmodulesintheelectricalandelectronicengineeringspectrumisprovided.• Otherskillsnecessaryfortheworkplacearealsoprovided.Theseincludecommunicationskillsandlife-longlearningskills.

• Youwillbeequippedwiththeknowledgeandexpertisetofacethechallengesofbusinessdevelopmentinawiderangeofelectricalandelectronicindustries.

KPT/JPS(R/23/4/0161)(A8890)11/18

Further Studies


• B.Eng(Hons)inElectrical&ElectronicEngineering

• B.Eng(Hons)inElectronicEngineeringwithInformationTechnology

• B.Eng(Hons)inTelecommunicationEngineering

• B.Eng(Hons)inMechatronicEngineering


Diploma in desIgn & medIa

Common Modules:

Semester 1 and 2 of this diploma is aim toprovide some fundamental modules whichare relevant to theDesign andMedia fieldand to prepare students proceed to 5differentroutes.

Here you will be equipped with basicconcept of design theory and practice,communication skills, writing for academicpurposes and also generating ideas fordesign. You will be exposed to variousspecific terminologies related to designandalsosomeofthetechnologiesinvolved.Thesesemesterswillprepareyouforthenextroutethatyouchoose.

SemeSter 1• EnglishforAcademicPurposes• PracticalITSkills• Imaging/ProductionSkillsforDesign• DesignTeamProject

SemeSter 2• ProfessionalCommunications• IdeasGenerationandProblemSolvingforDesign

• MajorProject1• DesignTheoryandPractice1

Route A: Leading to BA (Hons) in Advertising & Commercial Film Production or in Media (Film) Production**

SemeSter 3In this semester, you will learn about filmmaking practical skills together with someproductionknowhowforfilmandmedia.Youwillalsothentoproduceaprojectrelevanttofilmormediaproduction.

modules• PracticalSkillsforFilmMaking• FilmandMediaProduction• MajorProject2• DesignTheoryandPractice2

SemeSter 4You will be exposed to visual and audioeffect in this semester as well as exploringsomeofthepastandcurrenttrends.Youwillbeencouragedtothinkcreativelyandatthesame equip with some practical skills andgood awareness related to advertising andmediatrends.

modules• VisualandAudioEffectsforFilmProduction

• FilmandMediaStudies• InformingtheMasses:AdvertisingandtheMediainthe21stCentury

• TrendsandVisualThinking• TechniquesinFilmProduction

SemeSter 5Duringthissemester,youaremainlyfocusingonpracticalskills inproducingfilmorothermedia.Youwillalsobewellexposedtothecurrent market needs and to investigatethecurrentpractices.Module suchasBasicFilm Making will prepare you with somefundamentals skills in film making startingwithconceptsandbeingcreative.

modules• Crew:Film/ProgrammeProduction1• Crew:Film/ProgrammeProduction2• MarketingFundamentals,ConsumerBehaviorandCreativePractice

• CinemaFilmAnalysis• BasicFilmMaking

Route B: Leading to BA (Hons) Animation

SemeSter 3In this semester, you will learn basics ofAnimationonhowitworks,thebasicconceptofitandhowlayeringworksaswellassometechnical concepts relating to Animation.Youarealsobeingencouragedtobecreativeandtoproduceaprojectinthissemester.

modules • AnimationFundamentals1• AnimationFundamentals2• MajorProject2• DesignTheoryandPractice2

SemeSter 4The concept of Animation will continue inthissemester.Atthesametime,youwillalsolearnthetrendsinadvertisingandmediaandhowanimationplaysarolehere.

modules• AnimationFundamentals3• AnimationFundamentals4• InformingtheMasses:AdvertisingandtheMediainthe21stCentury


SemeSter 5You will be exploring the other aspects ofAnimation including timing concept andmovement.Atthesametime,itisimportanttolookatthehowthis isrelevant inmoviesandsomeconceptofcharacteranimation.

modules• AppliedTiming• AppliedMovement• SculptureforAnimation• CinemaFilmAnalysis• BasicFilmMaking

The APIIT Diploma in Design and Media is designed to:• provideaprogrammethatcoverstheacademicaspectaswellasthevocationalaspectsofDesignandMedia.• preparestudentsforcareersintheDesignandMediaenvironment.• providestudentswithacademicandprofessionalskillstodevelopsolutionsrequiringaholisticoutlookinDesignStudies.• providestudentswithcritical,independentandcooperativelearningskillssoastofacilitatetheirresponsetocontinuousfutureinternationalchange.

• developstudents’intellectualskills,communicationsabilityandteamworkingcapability.• providestudentswithopportunitiesforprogressionintoDegreeProgrammesofDesignandMediastandardinrelevantareas.

** Commencementfrom2017onwards. Forfurtherdetails,kindlyrefertoourCourseCounselorsatStudentServicesOffice

KPT/JPS(N/213/4/0226)(MQA/PA4392)12/19


Route C: Leading to BA (Hons) Advertising and Brand Management

SemeSter 3In this semester, youare introducing to themanagementofthecreativeprocessandthelinkbetweenbusinessandmarketknowledgein formulating effective design solutions.Students will be exposed to methods ofresearchandeffectivewaystoutilisethembywayofateamproject.

modules• CourseIntroduction1• CourseIntroduction2• MajorProject2• DesignTheoryandPractice2

SemeSter 4Duringthissemester,youwillbeintroducedto the basic use of research techniques toanalyse and understand the concepts ofbrandplacementandbrandidentity.Youwillbe taught to develop a design brief basedonthemarketresearchandwillpresenttheirconcept.

modules• IntroductiontoGraphicDesign• ClientBriefConcept1• InformingtheMasses:AdvertisingandtheMediainthe21stCentury


SemeSter 5Inthissemester,youwillbelookingintobasicissues relating to press and understandingthecustomerbehavior.Youwillalsocontinueto analyse and understand the concepts ofbrandplacementandbrandidentity.

modules• UnderstandingthePress• ClientBriefConcept2• MarketingFundamentals,ConsumerBehaviorandCreativePractice


Route D: Leading to BA (Hons) VFX: Visual Effects and Concept Design, Digital Film and 3D Animation Technology, Animation and Media Marketing

SemeSter 3Inthissemester,youwillbeintroducedtothecoremodelingskillsforCGIinentertainment,namely the process of studying real worldobjects and reproducing them in CG to ahighdegreeofaccuracy.Youwillalso learnabout the use of modeling, lighting andmappingtechniques.

modules• DigitalPresentation1• DigitalPresentation2• MajorProject2• DesignTheoryandPractice2

SemeSter 4In this semester youwill learn aboutdigitalimageandmixedmedia integrationasoneof the fundamental aspects to the DigitalCompositingindustry.YouwillalsolearnthetechnicalandcreativemixofskillsrequiredtocreatecomprehensivecompositesforVisualFX.

modules• DigitalPipeline1• DigitalPipeline2• DigitalCompositingforFilm• TrendsandVisualThinking• TechniquesinFilmProduction

SemeSter 5During this semester, you are introducingto the study of animationwith a structuredprogressiontoanimationforvisualeffects.Apreliminary introduction to basic animationtechniquesapplicabletoallanimationgenreswillbeundertakenandyouwillbeencouragedto explore the animation philosophy andlearn how to apply their outcomes throughproblemsolvinginitiatives.

modules• IntroductiontoVFX1• IntroductiontoVFX2• MarketingFundamentals,ConsumerBehaviorandCreativePractice


Route E: Leading to BA (Hons) Product Design and BA (Hons) Transport Design

SemeSter 3In this semester, youare introducing to themanagementofthecreativeprocessandthelinkbetweenbusinessandmarketknowledgein formulating effective design solutions.Students will be exposed to methods ofresearchandeffectivewaystoutilisethembywayofateamproject.

modules• CourseIntroduction1• CourseIntroduction2• MajorProject2• DesignTheoryandPractice2

SemeSter 4In this semester, you are introducing tothe skills needed to research, evaluate andpresent information, in the context of thehistory and practice of industrial design.In addition to illustrated talks and informaldiscussion groups, you will participate ingroup seminars designed to help themunderstand the methods and conventionsby which they can research, evaluate andcommunicateinboththepracticeandhistoryofartanddesign.

modules• CoreSkillsforProductDesigners1• IndustrialDesign:HistoryandContext• IndustrialDesign:StyleandSubstance• TrendsandVisualThinking• TechniquesinFilmProduction

SemeSter 5In this semester, you will be taught all therequired skills for a business presentation.Applicationsofkeymethodsandtechniquesassociated with 2 and 3 dimensionalpresentation will be used extensivelythroughoutthesemester.

modules• CoreSkillsforProductDesigners2• DigitalDesignProject• MarketingFundamentals,ConsumerBehaviorandCreativePractice



Diploma in JournalIsm

The APIIT Diploma in Journalism is designed to:• provideaprogrammethatcoverstheacademicaspectaswellasthevocationalaspectofJournalism

• preparestudentsforcareersinJournalism• providestudentswithacademicandprofessionalskillstodevelopsolutionsrequiringaholisticoutlookJournalism

• providestudentswithcritical,independentandcooperativelearningskillssoastofacilitateresponsetocontinuousfuturechangesinindustrypractices.

• developstudents’intellectualskills,communicationsabilityandteamworkingcapability.

• providestudentswithopportunitiesforprogressionintoDegreesofInternationalstandardinrelevantareas.

Semester1and2oftheProgrammeprovidesageneraldevelopmentof theskillsneededfor degree study as well as preparing youfor the specific demands of the degreeprogrammestowhichyouwillprogressto.

modules

SemeSter 1• EnglishforAcademicPurpose• PublicSpeakinginEnglish• PracticalITSkills• JournalismandSociety

SemeSter 2• ProfessionalCommunications• AcademicResearchSkills• CulturalandVisualInterpretation• EnglishforJournalist

The third, fourth and last semester of theProgramme provides greater details onJournalism including law and ethics forpracticesbesides learningonreportingandwritingskills.Atthesametime,youcanselectto experience some fundamentals of eitherbroadcastjournalismorsportsjournalism.

modules

SemeSter 3• LawandEthicsforJournalismPractices• ReportingandWriting1• InternationalRelations• WritingSkillsforJournalists

SemeSter 4• EssentialLaw&PublicAffairsforJournalist

• ReportingandWriting2• FundamentalsofJournalisminPractice/FundamentalsofSportsJournalism

• BroadcastNewsJournalism/SportsReporting

• IntroductiontoSportManagementandPolicy

SemeSter 5• UnderstandingthePress• FundamentalsofJournalism• JournalisminPractice• ManagingNewsBroadcast• SportManagement

Further Studies


• BA(Hons)Journalism**

• BA(Hons)BroadcastJournalism**

• BA(Hons)SportsJournalism**



• BA(Hons)inMediaMarketingwithspecialisminSocialMedia

KPT/JPS(N/321/4/0160)(MQA/PA4393)03/20

** Commencementfrom2017onwards. Forfurtherdetails,kindlyrefertoourCourseCounselorsatStudentServicesOffice


Diploma in InternatIonal studIes

The APIIT Diploma in International Studies is designed to:• provideaprogrammethatcoverstheacademicaspectaswellasthevocationalaspectsofInternationalStudies.

• preparestudentsforcareersintheInternationalStudiesenvironment.• providestudentswithacademicandprofessionalskillstodevelopsolutionsrequiringaholisticoutlookinInternationalStudies.

• providestudentswithcritical,independentandcooperativelearningskillssoastofacilitatetheirresponsetocontinuousfutureinternationalchange.

• developstudents’intellectualskills,communicationsabilityandteamworkingcapability.

• providestudentswithopportunitiesforprogressionintoDegreesofInternationalstandardinrelevantareas.

Semester 1 and 2 of the Programmeis common and it provides a generaldevelopmentoftheskillsneededfordegreestudyaswellaspreparingyouforthespecificdemands of the degree programmes towhich you will progress to. The APIITDiplomainInternationalStudieswillprovidetwo routes: one toBSc (Hons) Environment& Sustainability and another to BA (Hons)InternationalRelations.

modules

SemeSter 1• EnglishforAcademicPurpose• NumericalSkills• PracticalITSkills• JournalismandSociety

SemeSter 2• ProfessionalCommunications• AcademicResearchSkills• GlobalBusinessTrends• GeographyandtheEnvironment

Route A: Leading to BA (Hons) International Relations

This route provides greater details onsustainable lifestyle, international relationsandsomeoftheenvironmentalrelatedissuesaswell. Itprovidesfactorsthatshapefuturesustainablelifestyleandthechallenges.

modules

SemeSter 3• SustainableLifestyleandCommunities• IssuesinWorldPolitics• InternationalRelations• CriticalInternationalFilmStudies

SemeSter 4• DebatingthePast• ModernPoliticalIdeas• PhilosophyLifeandExistence• EnvironmentIssues&CaseStudies1• IndustrialDesign:HistoryandContext

SemeSter 5• Local&GlobalPerspectivesinHistory• WarPeaceandCooperation• CinemaFilmAnalysis• EnvironmentIssues&CaseStudies2• IndustrialDesign:StyleandSubstance

Route B: Leading to BSc (Hons) Environment and Sustainability**

This route concentrates on world politics,environmental issues, sustainable lifestyleandgeographicalrelatedtopicsaswell.Youwill examine contemporary environmentalchange and the emergence of globalenvironmental issues. Their impacts atglobal, regional and local scale, the effectson the environmental sustainability of thenaturalecosystemsandthequalityoflifeandlivelihoods of individuals and communitiesbecomecentralthemes.Amongsttheissuescovered are food and energy security,biodiversityandwaterstress,globalwarmingandclimatictransformation.

modules

SemeSter 3• SustainableLifestyleandCommunities• IssuesinWorldPolitics• InternationalRelations• PerspectiveinTechnology

SemeSter 4• InvestigatingGeographyandEnvironment• EnvironmentIssues&CaseStudies1• TheDynamicEarth1• GeographyandEnvironmentTutorials• IndustrialDesign:HistoryandContext

SemeSter 5• InvestigatingGeographyandEnvironment• EnvironmentIssues&CaseStudies2• TheDynamicEarth2• WarPeaceCooperation• IndustrialDesign:StyleandSubstance

Further Studies


• BA(Hons)InternationalRelations



• BA(Hons)inBusinessManagementwithspecialisminE-Business



• BSc(Hons)Environment&Sustainability**

KPT/JPS(N/313/4/0021))(PA4059)05/20

** Commencementfrom2017onwards. Forfurtherdetails,kindlyrefertoourCourse

CounselorsatStudentServicesOffice


PROGRAMMESCERTIFICATE

- Certificate in Administrative Skills (CAS) - Certificate in Information & Communication Technology (CICT)


modules

SemeSter 1• BasicITSkills• BasicMathematics• BusinessWritingSkills• OfficeAdministrativeSkills• PersonalSkills• WorkplaceCommunicationSkills

* Inadditiontotheabove,allstudentsarealsorequiredtosuccessfullycompleteGeneralStudiesmodulesasstipulatedbytheMalaysianQualificationAgency,aswellasfulfillcreditrequirementsforCo-curricularactivities.

**StudentsProgressingtoDiplomainAccounting&DiplomainFinancearerequiredtohaveCreditPassinMathematicsatSPM/’O’Levels.

Certificate in admInIstratIVe sKIlls (Cas)

This APIIT Certificate in Administrative Skills (CAS) is designed to provide:

• Strongcommunication,leadershipandadministrativeskillsaswellasthenecessaryfundamentalknowledgetotakeonthischallengingandeverchangingbusinessworld.

• OpportunitiesforprogressionintoDiplomaprogrammesortoembarkonacareerinadministration,marketing,accounting,humanresourcesandapplicationofIT.

DUrAtION16Months(3Semesters)

eNtrY reQUIremeNtS

• 1GradeCpassinSPMandapassinBahasaMalaysiaandSejarah(History)

• 1GradeBpassinUECandapassinBahasaMalaysia

• 1GradeCpassinOLevel/GCSE

Further Studies

Upon successful completion of thisprogramme, you will be eligible toprogress into any of the followingDiplomaprogrammesofferedatAPU/APIIT:

• DiplomainBusinessAdministration

• DiplomainBusinesswithInformationTechnology

• DiplomainFinance**

• DiplomainAccounting**

• DiplomainDesignandMedia

• DiplomainInternationalStudies

• DiplomainJournalism (Commencementfrom2017onwards)

SemeSter 2• BasicAccounting• CustomerServiceSkills• IntroductiontoManagingBusiness• IntroductiontoMultimediaApplication• IntroductiontoStatistics• MeetingandMinutesTaking

SemeSter 3• BasicFinance• BasicMarketingSkills• Book-KeepingandAccountingSoftware• EthicsatWorkplace• PayrollPreparation• PurchasingandInventory

KPT/JPS(N/340/3/0222)(PA1454)03/18


modules

SemeSter 1• BusinessWritingSkills• BasicMathematics• IntroductiontoManagingBusiness• WorkplaceCommunicationSkills• PersonalSkills• FundamentalITSkills

*In addition to the above, all students are also required to successfully completeGeneral Studiesmodules as stipulated by theMalaysianQualificationAgency,aswellasfulfillcreditrequirementsforCo-curricularactivities.

SemeSter 2• EnglishforTechnologists• SystemArchitectureDesignFundamentals• WindowsConfiguration&Maintenance• CustomerServiceSkills• IntroductiontoStatistics• WebDesign&Technology• Co-CurricularStudies

SemeSter 3• IntroductiontoMultimediaApplications• FundamentalsofE-BusinessApplications• Mobile&CommunicationTechnology• EthicsatWorkplace• IntroductiontoComputerArchitecture• FundamentalsofVisualProgramming

DUrAtION16Months(3Semesters)

eNtrY reQUIremeNtS

• PassSPMwithaminimumof1creditinanysubjectincludingaminimumpassinMathematics;or

• PassUECwithaminimumof1GradeBinanysubjectincludingaminimumpassinMathematics;or

• PassO-LevelwithGradeCof1creditinanysubjectincludingaminimumpassinMathematics;or

• AqualificationthattheMalaysianGovernmentacceptasequivalenttotheabove.

Further Studies

Upon successful completion of thisprogramme, you will be eligible toprogress into any of the followingDiplomaprogrammesofferedatAPU:

• DiplomainInformationandCommunicationTechnology

• DiplomainInformationandCommunicationTechnologywithaspecialismofSoftwareEngineering

• DiplomainBusinesswithInformationTechnology

Certificate in InformatIon & CommunICatIon teChnology (CICt)

This APIIT Certificate in Information & Communication Technology (CICT) is designed to provide:

• Strongcommunication,leadershipandICTskillsaswellasfundamentalknowledgetotakeonacareerinthischallengingandeverchangingITworld

• OpportunitiesforprogressionintoDiplomaProgrammeortoembarkonacareerinComputing,SoftwareEngineering,andvariousotherapplicationsofIT.

KPT/JPS(N/482/3/0072)(PA5379)02/20


WORLD-CLASS FACILITIES


Awardsreceivedbytheuniversityandourstudentsatlocal,regionalandinternationalcompetitionsareatestimonytotheirknowledge,skillsandprofessionalattributes.

AWARDS AND ACHIEVEMENTSAPIIT EDUCATION GROUP

Industry Excellence Awards 20112011 - WinnerofPrimeMinister’sIndustryExcellenceAward2011 - Winnerof‘SpecialJuryAward’bythePrimeMinister

Asia Pacific ICT Awards (APICTA) Malaysia (Multimedia Development Corporation)2013 - TopAwardfor‘BestofTertiaryStudentProject’2012 - TopAwardfor‘BestofTertiaryStudentProject’2011 - Winnerof‘SpecialJuryAward’2011 - TopAwardfor‘BestofTertiaryStudentProject’2011 - 2MeritAwardsfor‘BestofTertiaryStudentProject’2010 - TopAwardfor‘BestofTertiaryStudentProject’2008 - TopAwardfor‘Bestofe-Inclusion&e-Community’2005 - TopAwardfor‘BestofApplications&InfrastructureTools’2004 - TopAwardfor‘BestofEducation&Training’2004 - TopAwardfor‘BestofApplications&InfrastructureTools’2004 - MeritAwardfor‘BestofResearch&Development’2003 - MeritAwardfor‘BestofResearch&Development’2002 - MeritAwardfor‘BestofSmartLearningApplications’2001 - MeritAwardfor‘BestofSmartLearningApplications’2000 - MeritAwardfor‘BestofSmartLearningApplications’2000 - TopAwardfor‘BestofStudentProject’1999 - MeritAwardfor‘BestofStudentProject’

International Asia Pacific ICT Awards (APICTA)2012 - MeritAwardfor‘BestofTertiaryStudentProject’2011 - MeritAwardfor‘BestofTertiaryStudentProject’2010 - MeritAwardfor‘BestofTertiaryStudentProject’2004 - MeritAwardfor‘BestofEducation&Training’2004 - MeritAwardfor‘BestofApplications&Infrastructure

Tools’

UTP-HAX National Hacking Competition 20142014 - 1stRunner-up2014 - 4thPlace2014 - 1stRunner-up

International Energy Innovation Competition (EIC) Singapore2015 - 1stRunner-up2015 - 4thPlace

International Invention, Innovation & Technology Exhibition(ITEX)2015 - 1GoldAwardfortheInvention,Innovationand

Technologycategory2015 - 1BronzeAwardfortheInvention,Innovationand

Technologycategory2014 - 1GoldAwardfortheInvention,Innovationand

Technologycategory2014 - 1BronzeAwardfortheInvention,Innovationand

Technologycategory2013 - 2SilverMedalsfortheInvention,Innovationand

Technologycategory2013 - 2Goldmedalsfortheinnovatorcategory

1World Culture Festival2015 - ChampionofNusantaraSingingCategory2015 - 1stRunnerUpofNusantaraSingingCategory2015 - BestPerformanceAwardofNusantaraSingingCategory2015 - 2ndRunnerUpofInternationalSingingCategory

Big App Challenge 1.02014 - 1stRunner-up

International Conference On Information, System And Convergence Applications (ICISCA)2015 - 1GoldAward2015 - 1BronzeAward

Makeweekend Robotics Challenge 20132013 - WinnerofWaterDroneCompetition2013 - WinnerofAwesomenessChallenge

Malaysian Greentech Awards 2012 (Ministry Of Energy, Green Technology & Water)2012 - SilverAwardfor‘GreenTechUniversity’

Napei Awards (National Association Of Private Education Institutions, Malaysia)2011 - AwardforEducationalExcellence2007 - AwardforEducationalExcellence2004 - AwardforEducationalExcellence

Stanford University’s Global Innovation Tournament 2009 (Won by APU Student)2009 - WinnerforGlobalInnovationTournamentGlobalChallenge

Ministry Of Higher Education Malaysia Awards2008- TopAwardfor‘BestWebsiteDesign’

Asian Innovation Awards (Far Eastern Economic Review, Singapore)2004 - OnlyMalaysianFinalist

Prime Minister’s Golden Hands Award(Ministry of Works Malaysia)2004 - TopAwardinNetworkandPCMaintenancecategory

Pikom - Computimes ICT Awards 2004 (Association of Computer Industry in Malaysia)2005 - ProductoftheYearAwardfor‘URLChecker’2004 - ProductoftheYearAwardfor‘ScreenshieldSuite’

Ministry Of Education Excellence Awards (Ministry of Education, Malaysia)2003 - AwardofExcellenceinResearch&Development2003 - AwardofExcellenceforDevelopmentofOverseasCentres

Enterprise 50 Awards(Accenture & SMI Devt Corp)1998,1999,2000 - 3rdpositionin2000amongtop50Malaysian

organisations

Asia Student .Net Awards(Microsoft Inc.)2003 - 3rdPrizeAwardfor‘AutomobileManufactureService’software

application2003 - 5thPrizeAwardfor‘i-Mall’softwareapplication

Forum Nokia Mobile Challenge Java Competition(Nokia Inc.)2002 - Top3winnersworldwideforaJava-basede-mailclient

applicationforNokiadevicesusingJ2ME(Java2MicroEdition)


The Brandlaureate – SMEs Best Brands Awards2012 - WinnerofCorporateBrandingAwardinEducation

Microsoft Imagine Cup (Microsoft Inc.)2012 - WinnerofMicrosoftImagineCup(Malaysia)2012 - TopAwardfor‘MDeCSpecialInnovation’2011 - WinnerofMicrosoftImagineCup(Malaysia)2011 - 1stRunner-upofMicrosoftImagineCup(Malaysia)2011 - 2ndRunner-upofMicrosoftImagineCup(Malaysia)2011 - TopAwardfor‘MDeCSpecialInnovation’2011 - TopAwardfor‘PresentationSuperstars’2010 - WinnerofMicrosoftImagineCup(Malaysia)2010 - Top6finalistsatWorldChampionshipinPoland2010 - TopAwardfor‘BestPresentationTeam’2010 - TopAwardfor‘BestImplementationofMultipoint’2004 - 3rdPrizeAwardfor‘SystemGovernmentElections

Software’

CIMA Global Business Challenge Malaysia2014 - 1stRunner-up

CME Global Trading Challenge 2014 - 4thPlace

Materials Lecture Competition (MLC)2014 - SecondPrize

Schneider Electric’s ‘Go Green In The City’ Competition - Malaysia2015 - 1stRunner-up2014 - 1stRunner-up

Pathfinder Robot Competition2015 - 1stRunner-up2015 - CreativityAward

Malaysian/Milo Open Karate Championship2015 - MeritAward

HEP-IPTS Debate Competition (Ministry Of Higher Education Malaysia2012 - ChampionofHEP-IPTSDebateCompetition2012 - BestSpeakerAward2011 - ChampionofHEP-IPTSDebateCompetition

Malaysia Cybersecurity Awards (Cybersecurity Malaysia)2013 - Awardfor‘InformationSecurityTrainingProviderof

theYear’2012 - Awardfor‘InformationSecurityTrainingProviderof

theYear’2009 - Awardfor‘InformationSecurityTrainingProviderof

theYear’

1Malaysia Innovation Tournament (1MIT) 20102010 - Winnerfor‘BestAnimatedAward’2010 - Winnerfor‘MostScariestVideoAward’

Hack In The Box (HITB) International Competition 20102010 - 2ndPrizefor‘WeaponofMassDestruction’

Malaysia Frost & Sullivan Technology Innovation Award 2010(Won By APU Graduates)2010 - Awardfor‘EmergingHumanComputerInterface

Technologies’

World University Debates Championship 20102010 - Runner-upintheGrandFinal

MSC Malaysia Creative Industry Awards 2009(Games Category - Student)2009 - Awardfor‘BestGameDesign’2009 - Awardfor‘BestTechnical’

ITEX 2009 Awards - Won by APU Graduates(International Invention, Innovation & Technology Exhibition)2009 - GoldAwardfor‘BestInvention-SmartSurface’2009 - SpecialAwardforCorporateInvention

Business Excellence Award 2006 (Malaysia Canada Business Council)2006 - BronzeawardforIndustryExcellenceforEducation

DKSH-CSSC Award2006 -FirstPrizeforDKSH-CSSCMediaChallenge2006

E-Genting Bug Hunt2014 - FirstPrize2014 - SecondPrize2014 - ThirdPrize

E-Genting Programming Competition (R&D Division, EGenting)2014 - MeritAwardfor‘SoftwareProgramDesignand

Development’2014 - MeritAwardfor‘SoftwareProgramDesignand

Development’2006 - FirstPrizefor‘SoftwareProgramDesignandDevelopment’2004 - FirstPrizefor‘SoftwareProgramDesignandDevelopment’2003 - FirstPrizefor‘SoftwareProgramDesignandDevelopment’2002 - MeritAwardfor‘SoftwareProgramDesignand

Development’

HSBC Young IT Entrepreneur Awards (Hong Kong Bank)2004 - GoldAwardfor‘UniversalWirelessCharging’solution2004 - JudgesAwardfor‘SecurityTransmitter&Detector’device2002 - SilverAwardfor‘BusinessEdutainmentAccessMedium’

BusinessPlan

MSC-IHL Business Plan Competition(Institutions of Higher Learning Business Plan Competition by Multimedia Development Corporation)2012 - MeritprizeforBusinessIdeaCategory2005 - GrandprizeforBusinessIdeaCategory2005 - MeritprizeforBusinessPlanCategory

Dare To Be Digital Programming Competition (British Council / University of Abertay, Dundee)2003 - 1stPrizeAwardforaMultiplayerOnlineGame2003 - 3rdPrizeAwardforaRolePlayingStrategyGame

All information is correct at the time of publication but may be subject to change in the interests of continuing improvement.

The names, logos, symbols and marks that appear in this publication are acknowledged as the trademarks and copyrights of the respective companies and universities, registered in the country of registration and many jurisdictions worldwide.

Asia Pacific University of Technology & Innovation (APU)Asia Pacific Institute of Information Technology (APIIT)

Technology Park Malaysia, Bukit Jalil, 57000 Kuala Lumpur. Tel : +603-8996 1000 Fax : +603-8996 1001

Email : [email protected] | [email protected]

DU030(W). W4P0035.

Company no. 672203-A

Company no. 260744-W


032016

foundation/diploma/certiﬁcate · 2016-04-23 · admission requirements foundation programme the...

Documents