protein misfolding diseases (alzheimer’s) zeinab mokhtari introduction alzheimer’s disease...
TRANSCRIPT
![Page 1: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/1.jpg)
Protein misfolding diseases(Alzheimer’s)
Zeinab Mokhtari
Introduction
Alzheimer’s disease
Monday, July-5-2010
Protein misfolding diseases
Preventing amyloid aggregate formation
References
In the name of
God
![Page 2: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/2.jpg)
2
Protein folding
Protein folding refers to the process by which a protein assumes its characteristic structure, known as the native state. The most fundamental question of how an aminoacid sequence specifies both a native structure and the pathway to attain that state has defined the protein folding field.
![Page 3: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/3.jpg)
3
the first phase
Understanding the mechanisms of protein folding and uncovering the fundamental principles that govern the folding transition
the second phase
What are the mechanisms of protein folding in a context, such as under the influence of other biological molecules in the cellular environment?
Fig. 1. Growth of the Protein Folding Field.The average number ofpublications per year in protein folding field and the average number of publications per year that are dedicated to application
Protein folding
two predominant phases
![Page 4: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/4.jpg)
4
Studying protein folding
Anfinsen
• showing that proteins can fold spontaneously• in vitro studies• a milliseconds-to-seconds time scale
Levinthal
o a random conformation search does not occur in foldingo proteins fold by specific ‘folding pathways’o well-defined partially-structured intermediate states
A small number of residues (folding nucleus) need to form their native contacts in order for the folding reaction to proceed fast into the native state.nucleation theory
Protein folding
![Page 5: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/5.jpg)
5
Protein engineering, nuclear magnetic resonance (NMR), mass spectrometry, hydrogen exchange, fluorescence resonance energy transfer (FRET), and atomic force microscopy (AFM)
Computational methods
The Fold-Rate server (http://psfs.cbrc.jp/fold-rate/)The Parasol folding server (http://parasol.tamu.edu/groups/amatogroup/foldingserver)…
The close interplay of computational and experimental efforts has advanced our knowledge of protein folding kinetics, including predicting the protein folding rate, identifying the kinetically-important residues, and characterizing the multiple pathways.
Experimental methods
Protein folding
Studying protein folding
![Page 6: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/6.jpg)
6
I. protein folding in vivo is usually assisted by molecular machinery, such as chaperones (in an ATP-dependent manner), and often involves small molecule cofactors.
II. the concentrations of macromolecular solutes in cells can reach hundreds of grams per liter , but most in vitro studies are performed in buffered solution with <1% of the cellular macromolecule concentration.
Two major differences between protein folding in vivo and in vitro :
Protein folding
![Page 7: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/7.jpg)
7
The thermodynamic stability of a protein is measured by the free-energy difference between the folded state and the unfolded state:
∆G = Gunfold-Gfold
Experimentally, ∆G values can be obtained from denaturing experiments where the protein unfolds by increasing temperature or by adding denaturing agents such as urea and guanidinium HCl (GdHCl).
Native State, one conformation
Unfolded, many conformations
Protein folding
![Page 8: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/8.jpg)
8
While all the information needed for proteins to fold is encoded in their amino-acid sequence, there are many more elements that play a part in vivo. In a crowded cellular environment, surrounded by interacting proteins, nascent polypeptides face a formidable challenge in finding the correct interactions that result in a folded and functional protein.
Protein folding
![Page 9: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/9.jpg)
9
Molecular chaperones, recognize misfolded proteins and provide an environment conducive to the formation of the appropriate native contacts.
Protein folding
![Page 10: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/10.jpg)
Protein misfolding diseases(Alzheimer’s)
Introduction
Alzheimer’s disease
Protein misfolding diseases
Preventing amyloid aggregate formation
References ZeinabMokhtariMonday, J uly-5-2010
![Page 11: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/11.jpg)
11
Many diseases are now associated with protein aggregation and particularly with a form of ordered aggregate called the amyloid fibrils.
Protein misfolding
![Page 12: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/12.jpg)
12
Protein folding diseases:
excessive quantities of wrongly folded proteins collect in the form of uncontrolled piles of molecular rubbish (amyloidoses).
a small error in the genetic blueprint leads to incomplete folding of a protein, which affects its function.
(P53 : the malfunctioning of central tumour suppressor could cause cancer. )
![Page 13: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/13.jpg)
13
Disease
Pick’s
Alzheimer’s
Parkinson’s
Prion disease (e.g. Mad Cow)
Amyloid Lateral Sclerosis
( Lou Gehrig’s)
Huntington’s Disease
Protein
tau
APP
alpha synuclein
prion protein
TDP-43
Huntingtin
Protein misfolding diseases
Protein misfolding
amyloidoses
![Page 14: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/14.jpg)
Protein misfolding diseases(Alzheimer’s)
Zeinab Mokhtari
Introduction
Alzheimer’s disease
Monday, July-5-2010
Protein misfolding diseases
Preventing amyloid aggregate formation
References
![Page 15: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/15.jpg)
15
Alois Alzheimer and family,1910
Auguste D
Alzheimer
![Page 16: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/16.jpg)
16
Alzheimer
![Page 17: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/17.jpg)
17
Alzheimer’s is a progressive disease. Age is the biggest risk factor. We don’t know what causes it. We can temporarily slow it’s progression. We can’t cure it. Caregivers and support groups are very important. There is always hope for the future.
Alzheimer
Normal AD
No one knows what causes AD to begin, but we do know a lot about what happens in the brain once AD takes hold.
![Page 18: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/18.jpg)
18
1 .Recent memory loss affecting job 2 .Difficulty performing familiar tasks
3 .Problems with language 4 .Disorientation to time or place
5 .Poor or decreased judgment 6 .Problems with abstract thinking
7 .Misplacing things 8 .Changes in mood or behavior
9 .Changes in personality 10 .Loss of initiative
Alzheimer’s disease is an irreversible, progressive brain disease that slowly destroys memory and thinking skills.
Alzheimer
![Page 19: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/19.jpg)
Protein misfolding diseases(Alzheimer’s)
Zeinab Mokhtari
Introduction
Alzheimer’s disease
Monday, July-5-2010
Protein misfolding diseases
Preventing amyloid aggregate formation
References
![Page 20: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/20.jpg)
20
The aggregation of β-amyloid (Aβ) peptide → Alzheimer’s disease (AD)
Aβ-42 peptide is the key target in the finding of inhibitors of AD-related amyloid formation.
low molecular weight drugs
Aβ-42 monomer–monomer interactions
preventing amyloid aggregate formation
High temperature, low pH, and salt conditions
Alzheimer
![Page 21: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/21.jpg)
21
the effect of α-D-mannosylglycerate (MG) and its structural analogs on the inhibition of Alzheimer’s Aβ aggregate formation and neurotoxicity
Thermal stress Freezing Thawing Drying
MG
MG strongly inhibits amyloid formation of Aβ-42 and its neurotoxicity in vitro.
Alzheimer
![Page 22: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/22.jpg)
22
ThT-induced fluorescence assay and AFM image analysis
no inhibition effect
inhibition effect
Alzheimeramyloid aggregates
→ new emission maximum
![Page 23: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/23.jpg)
23
AFM images of Aβ42 (25 mM) samples incubated with control, α-D-mannosylglycerate, α-D-mannosylglyceramide, mannose, glycerol and methylmannoside at 100 mM concentration.
Alzheimer
inhibition effect
![Page 24: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/24.jpg)
24
carboxyl group
Alzheimer
![Page 25: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/25.jpg)
25
Sequence (Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - Thr - Val - Ile - Val - Ile - OH
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVI
Sequence (One-Letter Code)
covering the ‘‘hot spots’’ responsible for Ab fibrillation
penta peptides such as KLVFF
electrostatic interactions between residues
hydrophobic interactions between highly apolar residues
Alzheimer
![Page 26: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/26.jpg)
26
Some References
peptides 29 (2008) 578 –584
Nanomedicine: Nanotechnology, Biology, and Medicine 1 (2005) 300– 305
Archives of Biochemistry and Biophysics 469 (2008) 4–19
Journal of Molecular Biology (2006) 362, 347–354
Biochimica et Biophysica Acta 1764 (2006) 443–451
![Page 27: Protein misfolding diseases (Alzheimer’s) Zeinab Mokhtari Introduction Alzheimer’s disease Monday, July-5-2010 Protein misfolding diseases Preventing amyloid](https://reader030.vdocument.in/reader030/viewer/2022032707/56649e4e5503460f94b4588a/html5/thumbnails/27.jpg)
27
Everything is okay in the end.If it's not okay, then it's not the
end.