Transcript
- Slide 1
- Cell Structure & Function
- Slide 2
- Great Website!
- Slide 3
- Slide 4
- Protein Nucleic Acids Lipids Carbohydrates paradigm of molecular biology polypeptide ACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWY nucleic acids AT C GTA G C RNA AU C GUA G C transcription translation Transcribing fixed, permanent information onto a portable, temporary template Translating language of DNA into language of protein folding STRUCTURE&FUNCTION DNA mature protein
- Slide 5
- Cells overview size: surface area:volume Prokaryotes Bacteria Structure cell envelope cytoplasm appendages Archaea how they differ from bacteria Eukaryotes structure Nucleus & Ribosomes Endomembrane System ER Golgi Lysosomes Peroxisomes & Vacuoles Energy-related vesicles The cytoskeleton
- Slide 6
- Slide 7
- Slide 8
- Archaea have these shapes and more: Lobed, Plate-like, and Irregular Additional education website found herehere
- Slide 9
- Simplest, most primitive cells of life. What makes them unique? No internal membrane-bound vessicles Circular DNA Chromosome (no nucleus, ER, golgi, mitochondria, etc) Glycocalyx Cell Wall Plasma Membrane with Mesosomes Nucleoid
- Slide 10
- Halophiles Sulfolobus archaea
- Slide 11
- 1 2 3 Extracellular 1 2 3 4 Intracellular 1 2 3 Adornments
- Slide 12
- Interesting Story
- Slide 13