Transcript
  • Slide 1
  • Cell Structure & Function
  • Slide 2
  • Great Website!
  • Slide 3
  • Slide 4
  • Protein Nucleic Acids Lipids Carbohydrates paradigm of molecular biology polypeptide ACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWY nucleic acids AT C GTA G C RNA AU C GUA G C transcription translation Transcribing fixed, permanent information onto a portable, temporary template Translating language of DNA into language of protein folding STRUCTURE&FUNCTION DNA mature protein
  • Slide 5
  • Cells overview size: surface area:volume Prokaryotes Bacteria Structure cell envelope cytoplasm appendages Archaea how they differ from bacteria Eukaryotes structure Nucleus & Ribosomes Endomembrane System ER Golgi Lysosomes Peroxisomes & Vacuoles Energy-related vesicles The cytoskeleton
  • Slide 6
  • Slide 7
  • Slide 8
  • Archaea have these shapes and more: Lobed, Plate-like, and Irregular Additional education website found herehere
  • Slide 9
  • Simplest, most primitive cells of life. What makes them unique? No internal membrane-bound vessicles Circular DNA Chromosome (no nucleus, ER, golgi, mitochondria, etc) Glycocalyx Cell Wall Plasma Membrane with Mesosomes Nucleoid
  • Slide 10
  • Halophiles Sulfolobus archaea
  • Slide 11
  • 1 2 3 Extracellular 1 2 3 4 Intracellular 1 2 3 Adornments
  • Slide 12
  • Interesting Story
  • Slide 13

Top Related