Slide 1

Cell Structure & Function

Slide 2

Great Website!

Slide 3

Slide 4

Protein Nucleic Acids Lipids Carbohydrates paradigm of molecular biology polypeptide ACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWY nucleic acids AT C GTA G C RNA AU C GUA G C transcription translation Transcribing fixed, permanent information onto a portable, temporary template Translating language of DNA into language of protein folding STRUCTURE&FUNCTION DNA mature protein

Slide 5

Cells overview size: surface area:volume Prokaryotes Bacteria Structure cell envelope cytoplasm appendages Archaea how they differ from bacteria Eukaryotes structure Nucleus & Ribosomes Endomembrane System ER Golgi Lysosomes Peroxisomes & Vacuoles Energy-related vesicles The cytoskeleton

Slide 6

Slide 7

Slide 8

Archaea have these shapes and more: Lobed, Plate-like, and Irregular Additional education website found herehere

Slide 9

Simplest, most primitive cells of life. What makes them unique? No internal membrane-bound vessicles Circular DNA Chromosome (no nucleus, ER, golgi, mitochondria, etc) Glycocalyx Cell Wall Plasma Membrane with Mesosomes Nucleoid

Slide 10

Halophiles Sulfolobus archaea

Slide 11

1 2 3 Extracellular 1 2 3 4 Intracellular 1 2 3 Adornments

Slide 12

Interesting Story

Slide 13